2A3HA

Cellobiose complex of the endoglucanase cel5a from bacillus agaradherans at 2.0 a resolution
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
300
Chain Sequence
b'SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
molecule tags Endoglucanase
source organism Bacillus agaradhaerens
publication title Structure of the Bacillus agaradherans family 5 endoglucanase at 1.6 A and its cellobiose complex at 2.0 A resolution
pubmed doi rcsb
total genus 117
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2a3hA00
4HMDA 6A3HA 1E55A 4E2OA 2Y24A 3MV11 4KRTA 4B3LA 1B2YA 3DYOA 1W3JA 3NYDA 1OT1A 4JHZA 1QHOA 1TG7A 4QLJA 1UZ4A 3ARTA 3UR7A 1QI5A 2OSXA 4OKDA 5CGTA 4KGJA 1KGWA 3OGRA 5IHRA 4CN6A 2G41A 4D1IA 3VD4A 4UFLA 5ABEA 5EMYA 4HOWA 2WPGA 3VGFA 1GOQA 2OWCA 3RO8A 1WZLA 4L4OA 4QCEA 4UQ9A 4U5KA 1EHAA 2CBIA 1KXQA 1JZ5A 1GORA 4GI6A 5CZKA 1TFVA 1DWGM 4URIA 2W62A 1E6QM 5A6BA 4XV0A 3BLKA 1JDCA 1E4LA 2OSYA 4MTVA 1W2VA 4NRSA 3AXIA 5TD4A 5BXTA 2PB1A 5JBDA 4JFWA 1ZBKA 5HDRA 3IJ9A 1H0IA 4CU8A 1U2YA 4AEFA 3L4YA 3PZOA 1BYDA 1HP5A 3I3EA 5CLWA 3FAWA 3K8KA 1CDGA 4UZSA 1GOOA 1XYFA 1W2PA 1I75A 4X9YA 1KXHA 1M03A 1IZKA 3BCDA 4HTYA 3UERA 1UR1A 4MADA 3QGVA 2VMFA 2QV4A 1UKPA 1VAHA 4PMVA 1B30A 5AYBA 1WB0A 3W6MA 5FOOA 3VGBA 3DYPA 3WIJA 1P6WA 1VBRA 3AIBA 4QCFA 4OBSA 3CZKA 1H5VA 2VI0A 3VGGA 2W67A 1OINA 1DWFM 4PEEA 2HVMA 1SR0A 2DQXA 2JALA 3WD3A 3WUFA 1HVXA 4F9DA 4HU8A 5ABFA 3N9KA 1VB9A 1JXKA 2ZX7A 3CHFA 1JDDA 2WC4A 3BC9A 4PUEA 4FK9A 3WDHA 1Q6CA 1J0ZA 3OZPA 3W82A 5A69A 1HKMA 5E0FA 1OIMA 2YL8A 3VDHA 1CXIA 1CXEA 3ZJKA 1J18A 3L4XA 3AHZA 4OBRA 1G1YA 3UG3A 4JIEA 4Q22A 2JF6A 1DWIM 4NSBA 4AWEA 3ARSA 2YBTA 4IPNB 1LG1A 4LYPA 3WQVA 4CCDA 3UG4A 1J10A 3U5UA 2J7FA 1UUQA 3MO4A 3VGDA 2V38A 5I77A 4D6HA 2XWEA 4P8VA 3ZT6A 1HVQA 4CCCA 1W9XA 1V08A 5KZ6A 4QDMA 1B3YA 2BS9A 3CGTA 3CUIA 1GOMA 4PCTA 5CPSA 2CITA 2PF0A 3OGSA 2PWDA 2FH8A 3T2PA 2QHAA 1KFWA 2WM0A 2VCBA 3ZT5A 3ZJ8A 3TTOA 3AYSA 2WKGA 4QLKA 4AD1A 2DSWA 1XYZA 4FLRA 3VD7A 1V3IA 1QNOA 3GXIA 2VZVA 3VIOA 1EHNA 5FL0A 4Z2KA 3WL0A 2MANA 4OUEA 1AQMA 3AZRA 1ESWA 1SMAA 5IXEA 5DF0A 1QHZA 3AZSA 4U31A 5HOSA 4DUWA 2PWHA 3WNKA 2WW5A 1NWRA 4IM4A 2VT0A 1YHTA 3ALFA 1BHGA 4Z2HA 3MSGA 2YDRA 5CLTA 2CYGA 3N04A 3N15A 1GOIA 1HJWA 1E71M 3II1A 4U3CA 1E4MM 4J27A 5CGMA 3M7SA 5JBEA 4JFUA 4CN4A 3GXFA 2J8GA 4J3SA 2DPEA 5LA1A 3WY1A 3WQ4A 2DSKA 1TZ7A 4S3JA 5ECUA 2G4FA 2F8QA 3DHPA 2W63A 1VIWA 4BCEA 1E5NA 3GZAA 3VD9A 3CUJA 2WZIA 5HBFA 1NWUA 2WVUA 3HMCA 2PWGA 1ISXA 2VNCA 1UQZA 4KMQA 3A4WA 1SYTA 3AQUA 4LGXA 2EO7A 4FLOA 4GI9A 4CGTA 1R87A 2VQUA 2XIIA 1FHDA 1WDPA 2OWXA 2XM2A 3FHQA 1OT2A 3NSXA 3WQ5A 4EAMA 2XIBA 4U33A 1JFHA 1B31A 2IUZA 1M7XA 1QNSA 1PAMA 4NF7A 3WD2A 4V28A 4BQ4A 3CUFA 1WO2A 2ZXQA 4UOJA 1LL7A 1MW2A 1K9FA 4PTWA 1C90A 1E6NA 1FP9A 4AD3A 1MFUA 1GZJA 3MV01 4EKJA 4CN1A 3AISA 2WMJA 3EDKA 2A3CA 1JAEA 3AMCA 2DT2A 2BVYA 5BCAA 3W0KA 2WC7A 1GVYA 3I3DA 1KBKA 3PZQA 3AJ7A 2W91A 2C0HA 4MAZA 2CEQA 1TA3A 4TX8A 1DTUA 2YLLA 3AIWA 2J77A 3A47A 2WCGA 4UTFA 1BTCA 2GJRA 4ATDA 4XUYA 2VUYA 5ABGA 4S3KA 1J0IA 1ITCA 3LPGA 3SIMA 1JIBA 4P7LA 5BXRA 3VOCA 2GK1A 3PZTA 1UWUA 2AOSA 4J3TA 2WHJA 1E43A 1VEPA 3PZVA 2WVTA 2J74A 3GYCA 4YPJA 4WJXA 3CBWA 1WDRA 2WMFA 1BVZA 3BAWA 2E9MA 2EXOA 1UR8A 4RE4A 5GNYA 3VO0A 5CG0A 2YJQA 3SCNA 1V0MA 3WL1A 2ESCA 4A3YA 5JIWA 3KZSA 2YA2A 3L4VA 3AMGA 1J9YA 2DGAA 4NZCA 3E1F1 1E6ZA 1KXTA 4CD6A 3CUHA 1V3MA 3BAXA 3THDA 4AD5A 1GQKA 2J47A 3IJ8A 3A4AA 1GOWA 2JE8A 1CXLA 4W8AA 3VD3A 1ZB5A 3SCTA 4UR9A 1OCQA 4FLQA 3W25A 1H4PA 3CPUA 4K68A 4DWSC 1HNYA 3PN8A 1VBUA 4QP0A 5CQ1A 1BYBA 2BY2A 3WD0A 3ECQA 1CYGA 4D6EA 4CD8A 5AY7A 3QOMA 2O92A 4M82A 2ZICA 2FDMA 1J0HA 2VVNA 4P8WA 3KL0A 4DUXA 3O2LA 1G9HA 2GUYA 5D9NA 4CVWA 5EFDA 1NWTA 2Z1KA 1RP8A 2WVVA 1UA3A 1V03A 4W5UA 4CKQA 2YIHA 1XD0A 2W66A 4H8VA 3B8SA 4MNMA 3WF3A 5D9PA 1H2JA 1W9DM 4HMCA 3AIQA 4MB4A 2CNCA 3WDRA 3EMCA 2WK2A 3PTKA 4DM2A 3A4XA 1Z32X 1PZ3A 4E8DA 1C93A 1ZJBA 4ZFMA 3K4AA 3EDDA 2V3DA 2YL5A 2F2HA 3DECA 1BVNP 4UFHA 1CECA 4PSPA 2VCCA 4AXNA 1ODZA 4PN2A 3ARYA 2E3ZA 3PZNA 3VKKA 4WKFA 1UKQA 1CNVA 1GHSA 3POHA 3WH7A 2NW0A 5M17A 1CGWA 3NDZA 2BY1A 3T2OA 1W9PA 4AIEA 3NUKA 5A95A 1BYCA 3VIGA 4AZCB 4EE9A 3WD1A 3WDQA 1V02A 2ZX9A 1GONA 1JFXA 2O9PA 1MXGA 3L2MA 3LMYA 1Q4NX 1NM9A 1UR0A 3VNZA 1NP2A 2D1ZA 2J7HA 1EGZA 2QPUA 3S6TA 1UYQA 4KRUA 3K1DA 1Q6DA 1KB3A 1H0GA 3OLGA 4M1RA 1CXKA 1K9EA 3QHOA 4YHEA 4Z2GA 1W1PA 4QLLA 4N0RA 1E72M 5GQBA 3VGEA 1JF5A 3WEZA 3WDIA 4J7RA 1V6UA 1BF2A 1MW3A 1UWTA 2WMKA 5JIPA 3L4WA 2PC8A 1XRVA 3W28A 3WNPA 1MXDA 3OB8A 4D6CA 2A3HA 2WMHA 2WBGA 1UKOA 3N12A 1GJUA 1PIFA 2VURA 4HPGA 3WFZA 1O7AA 5F7UA 2PI6A 4JL2A 3WENA 1QW8A 5CJ5A 2RGLA 1E70M 1CGTA 2A3BA 4FMVA 2BXYA 1R85A 3PZMA 4JCLA 4UFKA 2BVDA 1ZBVA 2PWEA 1V0LA 3POCA 1JD7A 3WEMA 2VZUA 4AEEA 2ZXBA 3MANA 1IV8A 1UD8A 1NP0A 3N1AA 1DEDA 4W8BA 1CPUA 1ZBCA 4A4AA 3SEPA 2WB5A 2GDUA 1QVBA 2WHLA 2Y8KA 2EJ1A 3I3BA 4BS0A 3VUPA 4AIUA 3K8MA 2CXGA 4H2CA 1J01A 4HPHA 1E6RA 2WLYA 3W24A 4CU7A 2XGBA 2WSPA 5LA0A 2D0FA 3F5LA 4F9JA 3LPFA 3RIKA 1GOKA 2CERA 4LYRA 1X1NA 3UR8A 4LX4A 1RD6A 1CBGA 3MMUA 3RJXA 4N42A 1Q6GA 2WMGA 1E56A 3PZGA 3CHDA 5DFAA 3FN9A 5JBFA 1IT0A 2WWDA 4W93A 1KR0A 1PPIA 1C7TA 1F4HA 3IK2A 3VNYA 2E8YA 1KR1A 1R7AA 4BQ2A 1GPFA 3VVGA 5LYRA 2XSBA 5CPQA 3IJ7A 3QHMA 5D9OA 3RPMA 2VC9A 4MNJA 4PYSA 5C8BB 2B31A 2X0HA 3M07A 1ISYA 4NRRA 2OYKA 3N13A 3J7HA 3WF0A 3TTSA 2OLHA 5CSYA 2AAAA 5D8WA 2EPMX 1E0WA 3SCOA 2G3MA 2V5CA 2WVSA 4D72A 3WMCA 1XV8A 2XPKA 2FGZA 3D5HA 4Z2LA 1UA7A 1XH0A 2IXVA 4PMXA 3AMDA 1KWKA 1EA9C 2JIEA 1NQ6A 2W61A 4W7UA 1W9BM 4C7DA 1PJ9A 3MKKA 2EPLX 4LPCA 4HOZA 4AZGA 4RL3A 4ZE5A 1KCLA 1VJZA 4AZIA 5BWFA 4J3XA 1XH1A 4V27A 1C3FA 2DSZA 1FOBA 2O9RA 4Y7EA 1BLIA 1JD9A 2WBKA 5A6LA 4WKHA 4PUDA 1HXJA 4M24A 2VZOA 3FAXA 1CGUA 4BQ3A 4U3AA 2AMGA 3AIUA 2J7DA 4CCEA 3QR3A 2EPNA 2ZUTA 2O9OA 3OA5A 2GK1B 4AIOA 1GQJA 3FHAA 3L4ZA 3SURA 1E1FA 5I2UA 5FL1A 1BFNA 1KXVA 4W8LA 4F66A 4C7GA 1UWQA 2G3IA 3QHNA 3WNOA 1FHLA 4ACZA 2WXDM 3LPPA 5A8NA 2VRQA 3AICA 1AMYA 3ZR5A 1MW1A 2XVLA 4MAVA 2BY0A 4WSKA 4MJ2A 4CVUA 2OSWA 4XZBA 1E3ZA 4HP5A 4MNLA 3WMSA 4CD5A 1EDGA 2BHYA 3WNNA 4RE3A 1BAGA 3WKZA 3ZSTA 2A3AA 2XGIA 1B1YA 3F4VA 2F61A 3BCFA 5EBAA 3RMEA 3AFBA 4AZHA 4MDPA 5D9MA 3CZJA 1RP9A 1X6LA 1OGBA 2J25A 1JG9A 3ZJ7A 1LWHA 5I78A 3T0AA 2XJ7A 3WN6A 1OM0A 2VX7A 8A3HA 1C8YA 2E8ZA 3EDJA 1WPCA 2QPSA 2YL6A 3CZLA 1UG6A 4AZBA 3OLDA 3VGHA 4LYQA 2FHFA 1CLVA 4DM1A 1G0CA 5FIPA 4A3HA 1NOFA 2WHMA 4JL1A 4P7QA 3AMLA 2YDQA 4UQDA 2J75A 4PBGA 1KCKA 1SFSA 4GQRA 1HT6A 4JFTA 3KE0A 1W3LA 1DP0A 4HZ6A 1CXFA 3CZGA 2FHBA 2J8FA 4HA1A 1V6YA 1A47A 3BAYA 2G3JA 4FF5A 1EOMA 1WE5A 3AIVA 2VR5A 4QAWA 4R5EA 2VTFA 3TTYA 3OLEA 4HZ8A 1NOWA 1B0IA 5ABFB 3OLIA 2VZSA 1QNQA 2WCSA 4TXEA 2JEQA 3ZO9A 3AOFA 3B9EA 4H8UA 4W5ZA 1OD0A 3VIHA 3U5YA 2ZUWA 3WUBA 2YDSA 2EPKX 1NH6A 3MU7A 3IAPA 1EXPA 1GQIA 1E1EA 6CGTA 1J0KA 1E6XM 1S46A 2GDVA 1UH4A 3CHEA 3EMQA 3VPLA 5GNXA 1WCGA 1JNEA 1LLOA 1PX3A 2BHZA 4JCMA 2BV9A 1ISWA 3VX1A 2W4XA 5A2BA 4D71A 1HKJA 2XVPA 2WLZA 2X1IA 1JYXA 4OJYA 3W37A 4HZ7A 4AY1A 2CCRA 1B3XA 2OYMA 3OG2A 2JIWA 1MVYA 2EBNA 4R27A 2XSAA 1TCMA 5E9AA 1B3WA 1E4IA 1OWQA 3CIVA 3VDBA 4OZOA 3NJ3A 4P7NA 2IXUA 3AXXA 1DWHM 4H8HA 3WUEA 1H09A 1K9TA 4GXPA 1U33A 2JFEX 1VEOA 1OGSA 3VM5A 5AC4A 4GZEA 4AISA 1GNXA 4WKAA 3ZT7A 3T2QA 5A6JA 4HA4A 2PBOA 3U57A 4PRWA 2WWCA 1R86A 4TTUA 3VIJA 4PMRA 5GNZA 5HNNA 4DWSD 4TVCA 2CPUA 4MJ4A 3ARRA 1K6AA 3EBVA 2WNWA 4KGLA 5D4YA 2YA0A 1JGIA 3WD4A 3RJYA 1EQCA 3SCSA 1E73M 1UD3A 1XSIA 4PTVA 4YN5A 1WDSA 5I24A 1PEZA 1E6SM 2XG9A 4JAWA 1KQZA 4JHOA 1JZ4A 4NI3A 1V0KA 3W27A 1HL9A 3VM7A 3ZM8A 1W1YA 4JKMA 4WSJA 4HU0A 5A8OA 2YLAA 1RH9A 2WANA 3WEOA 5A2AA 4H7VA 4OOUA 4PSRA 2GVYA 3U7VA 2XVKA 1XD1A 4AZ5A 4WIWA 1QW9A 4DWSB 3WNLA 3MSDA 1W32A 1UD4A 2YOCA 1C8XA 1LL6A 1E9LA 3VIIA 4D6DA 5IFPA 2Y2WA 1WDQA 2X0YA 2ZX5A 2XTKA 1PBGA 4TVDA 1JDAA 2GJXA 1VRXA 2XWDA 1CGYA 4MB1A 3ARXA 5I3DA 1US3A 2ZX6A 3TA9A 2CKSA 4P8UA 4GIAA 1UD6A 1GW1A 3NSNA 1H1NA 3BXWA 1TMQA 1JZ8A 2QMJA 1B9ZA 5I5RA 5GPRA 3TP4A 1GQLA 1A3HA 4PMQA 3FNDA 4M56A 3MUZ1 1KGUA 1LQ0A 4W87A 1FH7A 3AS2A 1J0JA 4HOXA 3GNPA 3CLWA 4YHGA 2A3EA 1E4NA 3PZUA 1MFVA 3BSHA 3WFLA 5A8PA 4D6JA 2V3EA 5BXSA 4W88A 1AQHA 2Y8VA 4H04A 3B9DA 4UFMA 2VJXA 3BAKA 3WNMA 4OOZA 2JEPA 5CXPA 3GXDA 1Y7VA 2PBGA 4MPKA 2X05A 3SUSA 5HPOA 5A6SA 1ISVA 5A3HA 2J79A 5DT7A 1QHPA 1GVIA 1M53A 2DSUA 1XC6A 5HPCA 1PIGA 2ZUVA 1FA2A 3GXMA 3FY1A 3QOKA 3SCWA 3WDPP 4IISA 2VR4A 4UOQA 1WKYA 1US2A 2YKKA 1UKSA 3N18A 1V6WA 1JYNA 1UWRA 3WH9A 2DH3A 3WQ8A 2E40A 1KWGA 1U30A 3ZOAA 1QPKA 1J0YA 3L4TA 4Z2JA 2ZE0A 3CMJA 1WZAA 5EB8A 3EDEA 2J7GA 1JI1A 4J3UA 4GPNA 3M46A 1G94A 4TUFA 4GZJA 1RPKA 1JNDA 2WZHA 3TOPA 1UR4A 3MUY1 4WK9A 3SCPA 1WAWA 1C8QA 1JAKA 4XX6A 3MMWA 1LJYA 2RGMA 2DDXA 2ZUMA 3EDFA 3OBAA 4PMZA 1UWSA 3G6MA 4JFVA 5EFFA 5E70A 4B15A 1NWSA 2DT0A 2EEXA 2WC3A 5A6BD 1D3CA 5FCZA 2XHYA 4ATWA 1TVPA 4WF7A 1O6IA 3VINA 2W92A 3GM8A 1C92A 2DIEA 1EO7A 2CHOA 2UY5A 1HJQA 5M03A 2V3FA 1FFRA 1E3XA 1V3LA 4AD2A 3T0DA 1CTNA 4M80A 3EYPA 3WF4A 1E6PA 1W91A 1QNRA 4JZ5A 1KQYA 1MW0A 1GHRA 5A94A 3VILA 1VEMA 3F5JA 5I6SA 5IDIA 3FXYA 3L2LA 2UWFA 3ZSSA 5AYIA 7A3HA 1VFOA 3KL3A 3HU7A 4CU6A 3PZIA 3VMNA 2UY2A 1QBAA 4FLSA 1EIBA 2XM1A 1W9UA 2ZUNA 1V6VA 3GDBA 3DC0A 2O9TA 2BHUA 3W29A 3BAJA 5C70A 4W86A 3WQWA 4AZ7A 1J11A 4W84A 5I0DA 1PZ2A 3DHUA 4JKKA 4P8XA 4U5IA 1W9VA 3ZQ9A 2ZUUA 2DT1A 1QI4A 3VDAA 1V0NA 5C71A 8CGTA 4UQAA 1KGXA 1PX4A 3T08A 5BYWA 4M8UA 4D6GA 2YL9A 2CBVA 1M04A 2X09A 3THCA 3NDYA 2ZXDA 4ACZB 2BXZA 5D8ZA 2D2OA 4M81A 5FD0A 4PMUA 3B9AA 2CBJA 3WBAA 3WH8A 1MYRA 3UETA 2X8RA 1FP8A 2VRJA 1MQQA 1VFFA 5BRQA 2FHCA 2J62A 3GH5A 4ATLA 3A3HA 2Z1SA 4MDOA 2WCAA 5DMYA 1V3JA 2WKLA 3W38A 3K46A 4AZ6A 4JKLA 3D3AA 4GZIA 3PTQA 1K9DA 1V3HA 4TX6A 1HP4A 5E6ZA 1PX8A 1JYVA 4UZUA 5BROA 2JF7A 5M5DA 5A6KA 2GJPA 4ZEPA 1HJSA 3MMDA 2D0HA 3RILA 3KWXA 2WMIA 1X6NA 2E9BA 4J3WA 5AC5A 1VJSA 1LF1A 2NT1A 2J7BA 3RDKA 2V5DA 1E0XA 1MQPA 1WZKA 4F79A 3WBEA 2WZEA 4GI8A 3OIHA 2VL4A 3WH6A 1R8LA 2GFTA 2V3GA 3GH7A 3AIEA 3VIFA 1HL8A 3CZEA 2QF8A 1E5JA 1HJXA 2WAGA 4W89A 4PMDA 3KEHA 1UOKA 4IPLA 4QFUA 3WSUA 4J28A 3PZ9A 4TTGA 1W3KA 3MUAA 2HISA 4AD0A 5JUVA 1HN1A 2E0PA 2VX5A 3WF1A 4ZE4A 3AROA 5LA2A 5FKYA 3T0BA 1OSEA 2C8NA 5E09A 4BF7A 3A6OA 3LPOA 3VIMA 3VX0A 1HIZA 4MNKA 5A1AA 3SUUA 1VF8A 2TAAA 3OGVA 3N17A 1HX0A 1L0PA 1JXJA 1ZS2A 3CZ8A 1JZ2A 2ZWYA 3SCUA 2DH2A 2C7FA 3IANA 1UHVA 4ZXOA 4CD4A 1QBBA 3GNRA 4EK7A 1ZU8A 4AMCA 4GO8A 4M29A 4DUVA 1E15A 1V02E 2E9LA 4AYSA 3NCOA 4AC1X 4MB5A 1Q6FA 3W81A 3PTMA 1M01A 5A6AA 2GJXB 3T09A 1B3ZA 1QI3A 2X2YA 4KWUA 1BSIA 4ML4A 1FH8A 2VRKA 2YBUA 3VD5A 3K8LA 2XFFA 1ECEA 1UR2A 5HXMA 3SCQA 1V6XA 3APGA 3PHAA 3CTTA 2D0GA 3ZMRA 1B90A 1BG9A 2XFYA 4L4PA 4UCFA 1BQCA 4UFIA 4UNIA 3BAIA 1H41A 2NT0A 2VO5A 4PMYA 1GCYA 4ZXLA 3NIYA 2Q8XA 1JZ6A 1JZ3A 1GUVA 3ZJ6A 3CO4A 1V3KA 3ARUA 1N82A 4U2ZA 1QI0A 3RM9A 1OIFA 1JF6A 2ZXAA 4F8XA 1UH3A 4X0NA 3SUWA 2ZOXA 4ACYA 2D24A 3RM8A 1DWJM 2WMIB 1DHKA 1E40A 1AVAA 2PWFA 1E0VA 2DIJA 3W6LA 4KH2A 3SUTA 2XVNA 4HA3A 2WVVB 1CWYA 1TE1A 6TAAA 2VOTA 4D6IA 1UWIA 3VDCA 4PCSA 2OYLA 1OB0A 2XFRA 2D20A 4RE2A 3NSMA 4CUCA 2G3NA 1CZ1A 2CIPA 1ISZA 1OGGA 3BLPX 3M6DA 4HMEA 3AHXA 2YA1A 4DWSA 2D3LA 1OBAA 1NOUA 3AXHA 5DO8A 4B3KA 3VTRA 2E4TA 3ARWA 1IZJA 4OIFA 5BRPA 3W53A 4PTXA 1QNPA 4EANA 1UD5A 4BA0A 5IFTA 1MWOA 2DSVA 3RM4A 1D7FA 1B3VA 2ZUSA 3ARZA 5DT5A 2QLYA 1WNOA 2XYLA 3AHTA 1CENA 3UG5A 1UD2A 1AQ0A 1ZBWA 3ALGA 4ZENA 1ZL1A 1L8NA 1HKIA 7TAAA 5E6YA 2QMKA 4W7WA 1W1VA 1W3HA 2XVGA 4GKLA 2G8ZA 4LXFA 1CGVA 1HJVA 2CKRA 4W7VA 3OZOA 3F5KA 3CMGA 1QI2A 2VX4A 3UCQA 1XSKA 2ZIDA 1XCWA 2J7EA 2NSXA 4IUGA 2DEPA 1CGXA 1XHGA 3WDJA 1OD8A 3W26A 3ZIZA 4WLCA 4UFJA 1CIUA 4UQCA 4XZWA 2CBUA 3ZR6A 1ODUA 1C91A 3GBDA 4BZYA 4B16A 4PMNA 4W85A 4GINA 4PMOA 1JYWA 1TUXA 3GTNA 3GH4A 2VVSA 1QOXA 5E0CA 3L4UA 5ABHA 2DT3A 1HKKA 2ZX8A 3TTQA 1HF6A 1TR1A 1EDQA 3WH5A 5A8QA 1G5AA 4D1JA 5BXPA 1EH9A 1UZ1A 3WF2A 2Y4SA 1TA3B 3AI0A 2D22A 1ITXA 1WZMA 2BVTA 3HJEA 5IHSA 1UQYA 4UOZA 2UY4A 1F4AA 3AMKA 2XUCA 1EO5A 3WUGA 3CH9A 2J7CA 3EMZA 2ZWZA 3G6LA 1WP6A 3O9NA 5CSUA 2VQTA 2J4GA 3AIRA 1CLXA 1XSJA 1BGGA 3BH4A 3VIKA 1ZJAA 1JI2A 3WMBA 1VENA 1FH9A 4P7OA 3AZTA 3DYMA 3FW6A 1JL8A 3ARQA 4XB3A 4GO9A 2D23A 1NARA 3WELA 3AYRA 5I23A 2D3NA 4AD4A 4UQEA 1BYAA 4H41A 1UKTA 2VCAA 4B9ZA 3IAQA 2BNJA 1W1TA 3ARPA 1HJUA 3AHVA 3BMVA 4GQQA 4MB3A 1D2KA 1R7OA 2WHKA 1C7SA 5A8MA 2UY3A 1BPLB 2VZTA 2WSKA 1Q6EA 5I79A 3S2CA 3UEQA 5KEZA 4LQ1A 7CGTA 2EQDA 3CHCA 4JFSA 1LWJA 1I1WA 3N11A 1VFMA 4TOQA 1UH2A 1G01A 2BFGA 1GJWA 1H11A 1XH2A 3BGAA 3U7BA 3SUVA 3AS0A 1EQPA 1EOKA 3HN3A 3MUIA 5DEZA 3GNOA 1KBBA 2VX6A 4D6FA 2CETA 3BMWA 2Y5EA 1TVNA 4V2XA 4X0VA 1SMDA 4Z2IA 1JZ7A 3W4RA 1BGAA 4PTMA 1I1XA 3VIPA 3MS8A 3WQ6A 3TONA 2W5FA 2GSJA 3PBGA 3RCNA 4J3VA 2J78A 3JUGA 2FH6A 1EDTA 4B9YA 3AHYA 4E8CA 4U2YA 1LL4A 1FFQA 2EPOA 5CPTA 2OWWA 1MQRA 5A2CA 4BQ5A 4P7RA 4TVUA 1UR9A 1LG2A 3AS1A 5A6MA 1CEOA 4UQBA 1DWAM 5M3WA 2CESA 1XGZA 1H3GA 1XCXA 2CHNA 9CGTA 1CXHA 2BY3A 4AZCA 3SCVA 4E4PA 3SCRA 3CUGA 3VMOA 1BG4A 1YQ2A 3GBEA 3O6AA 1VFUA 1H49A 2WYSA 1J12A 3VMPA 4AW7A 4CD7A 3AS3A 4Q7NA 3VU2A 3UESA 4C7FA 3ARVA 3KL5A 3K4DA 3BSGA 2FGLA
chains in the Genus database with same CATH superfamily
6A3HA 2REQA 2OODA 4E2OA 3NYDA 1OT1A 4JHZA 2DJLA 4QLJA 3SGZA 1UZ4A 3UR7A 4IXHA 1SZFA 5CGTA 4HYVA 3VNDA 2G41A 4JIQA 5LHFA 3WLNA 5JMUA 3SBFA 5ABEA 3S8HA 7REQA 5K7JA 2NWRA 1X7IA 4DO7A 4QCEA 2CBIA 1JZ5A 4IOTA 4URIA 1E6QM 3H12A 2IPGA 1JDCA 3IK4A 2VFDA 1E4LA 2OSYA 1W2VA 3LI1A 4NRSA 3ITYA 1XLJA 3IJ9A 1NSJA 1U2YA 1IIGA 1E1CB 3PZOA 1UPPA 1CCWB 1BYDA 1DKWA 1FY6A 4NAFB 2WNNA 1RCQA 3RLGA 3S3GA 1AJ0A 1ITQA 2VMFA 4IMFA 3B97A 2BG5A 1VAHA 5AYBA 4S3AA 1KCXA 3WIJA 1HL2A 2KAUC 3FJ4A 1P6WA 2QJGA 3AIBA 4OBSA 3CZKA 2VI0A 1IXNA 2R82A 4G1NA 1NTHA 1VLIA 4HHLA 2P88A 1L6WA 3NNTA 2VEPA 4S2BA 3NL3A 4NZ5A 3N9KA 3CEPA 3L5AA 1VB9A 3GFXA 2ZX7A 3CHFA 1JQVA 3C0QA 3E5PA 4PUEA 5LXEA 2Z29A 4QSFA 4QEEA 5A69A 1OIMA 3NOEA 3KDOA 3AALA 3HB9A 4ZL1A 3ARSA 4LC6A 2W79A 4WJ8A 2J7FA 1UUQA 3MO4A 3VGDA 3F4WA 3QMRA 4UXDA 1W9XA 1XFCA 3S83A 2J6XA 3GAKA 4CQDA 3CGTA 1K7EA 3CUIA 2G4JA 4V15A 1QW7A 2CITA 3E9AA 3M4HA 1BKHA 2FH8A 1DIOA 2QHAA 1B9BA 2WM0A 3UNTA 2VCBA 1TREA 3ABZA 1R3WA 2PGRA 2Y70A 2YCLB 4QLKA 2VUNA 3FDGA 4UMAA 1V3IA 4YCPA 2VZVA 3WL0A 3KBVA 1AQMA 4F0RA 3DU0A 4ZODA 5DF0A 6ENLA 4U31A 3M1ZA 1EIXA 2QUMA 3H2MA 1L8PA 2VT0A 1YHTA 1Z48A 1BHGA 1F74A 3JU2A 4C6QA 3D47A 4KW2A 2DY3A 3CIXA 3N15A 2CZVA 4LUIA 2DZXA 1IR1A 1I45A 3CB3A 4J27A 5CGMA 2Q09A 3KBJA 3GXFA 4J3SA 2DIKA 3PG9A 2WJEA 5I03A 1ZP4A 2DSKA 1ADSA 1KA9F 1TZ7A 1OYAA 3W01A 3W1XA 4OGZA 2GVEA 4PODA 1Q7QA 3UFYA 2PAJA 2YXGA 1E5NA 3G0UA 3W7JA 3GZAA 1F6KA 1Z6KA 3M5ZA 4XD5A 1UQZA 3AQUA 2NQJA 1A50A 4CGTA 2VQUA 5AHMA 1V4YA 1NF7A 1WDPA 2OWXA 2XM2A 2TPSA 4IUOA 4O1CA 3U9IA 4FALA 4GVFA 4XD4A 4GUJA 4HYRA 4U33A 1JQXA 1JFHA 1B31A 3A3XA 3CM4A 1PAMA 4E0CA 3GR4A 2ZXQA 4UOJA 3E0LA 1C90A 1E6NA 1FP9A 5HMDA 4AD3A 4ZFCA 2WQDA 3W1AA 1XUZA 3L23A 3NQBA 1GVQA 1KFKA 3FKRA 4Q7BA 4CN1A 4PUKA 4PRTA 4HNUA 1SSDA 4ZCWA 2DT2A 2BVYA 3CTLA 5BCAA 3EKZA 2NVCA 3U8GA 4AHPA 1KBKA 1LCOA 5K9CA 1TTJA 3AJ7A 2CEQA 4G2DA 3U2ZA 3VE7A 1CT5A 5LZLA 3C2OA 1O66A 1TQJA 1TTPA 2J77A 3A47A 2WCGA 4UTFA 1K7FA 2GJRA 4XUYA 2VUYA 4GNKB 3W85A 1A53A 4S3KA 1J0IA 1R2RA 1ITCA 1XYBA 3VZZA 1UJQA 3LPGA 4IGMA 3MT1A 4P7LA 3VOCA 4RNJA 2AOSA 3OYZA 2WHJA 1E43A 4J3TA 4JTLA 4JTJA 3HF3A 3E49A 4NNCA 3RX2A 4XWUA 3WLQA 1WDRA 3BAWA 3LXCA 3S6OA 3ABQA 3VO0A 4DEFA 4E8GA 5GNYA 5CG0A 5HR6A 3KZSA 1NAL1 3V7PA 1J9YA 1OABA 2DGAA 3JR2A 3E1F1 3Q58A 4KEUA 1W5PA 1KXTA 2I5IA 2IS7A 2J6VA 5K2ZA 1GZ1A 2VFHA 4AD5A 2EF9A 4EP8C 1HZYA 1GOWA 2JE8A 4S39A 1CXLA 1ZENA 2GVJA 1OK4A 2A7PA 3SCTA 3HV9A 4LVGA 4ZB0A 4PBEA 5IM51 4JX5A 5BOEA 1G69A 2PEVA 3PPHA 1XIGA 4QP0A 1BYBA 1Q45A 2QJHA 3LHWA 1LOQA 1CYGA 2I9UA 4MJMA 5AY7A 1G9HA 2GUYA 5EFDA 4J9JA 1RP8A 4M7TA 5G1MA 5L6UA 3KCLA 3GDKA 3PG8A 2Y8UA 2BZNA 4H8VA 3QBUA 3S1UA 1ZHAA 4O53A 1B54A 5D9PA 3EMCA 3UJRA 1GVEA 3O8AA 4YNGA 2ALRA 1US0A 1XDMA 4GVIA 3VKCA 4IGNA 2B7OA 5HAOA 2ZCGA 3WJSA 2YL5A 1KO0A 3TVAA 3DIPA 1ZPTA 3INPA 1XIHA 4LEFA 4O0ZA 1CECA 2VCCA 2GWNA 3L0NA 2E3ZA 5I3GA 3PZNA 3VKKA 4WKFA 2FQIA 3UZXA 3VOGA 4TO8A 1W9PA 4JQ1A 3NUKA 5CH9A 4WY0F 3W73A 4BI5A 1C8VA 3TYDA 3SAZA 1FRBA 2GOUA 5E0KA 3VIGA 4I9MA 2VD8A 4LF1A 1DQWA 3FA3A 5A8GA 3T4CA 3P5ZA 3VC6A 1VC4A 4YXGA 3UJ2A 1BWVA 4IMGA 4Q8OA 1DXEA 1NP2A 4KIRA 2Q8ZA 1EGZA 2QPUA 2OEJA 3CYVA 4LJ3A 3S6TA 5BNKA 3PFRA 2PDGA 4GY1A 1P0KA 3QEZA 3CH0A 1SFJA 4M19A 5FESA 4MYXA 3OLGA 1K9EA 3QHOA 4C6KA 4YWSA 4YHEA 4PFHA 1W1PA 1KCZA 4A3UA 3E2RA 5GQBA 3NR0A 1AD1A 3PR2A 4O10A 2QV5A 3B8TA 5D37A 1UWTA 4EXQA 4JY8A 4IFKA 3QFEA 1VFTA 1XRVA 4CQAA 1FCVA 3P8IA 4HPGA 3GAYA 1O7AA 1NELA 2RGLA 5EL1A 4B3ZA 3TN3A 2PDNA 4J2PA 1ZBVA 3POCA 1JD7A 2C14A 3FYPA 3KFTA 4AWSA 3UW6A 3MANA 3W2MA 1TMHA 1PXGA 1IV8A 1UD8A 3QF0A 3N1AA 2AAMA 1DEDA 3EOLA 2OKOA 1CPUA 2QW5A 3PY2A 1ZBCA 3SEPA 3CQKA 3TLQA 2Y8KA 4BS0A 1AJZA 2QJIA 1W54A 1QMLA 1EX1A 2FYMA 3I6RA 1GKPA 4K36A 3W24A 3TX9A 4CU7A 1JCLA 3BOLA 2WSPA 3HG4A 2HCVA 2D0FA 2FVKA 1R3RA 1VCVA 1DE5A 3E02A 1H7PA 2Y89A 2A6LA 3KX6A 4G7EB 5DN1A 2Z1BA 1V77A 3UVIA 1CBGA 5BMXA 3MMUA 3NVTA 4N42A 3NURA 4ML9A 3PZGA 2PTZA 5DFAA 3FN9A 2F6UA 4K39A 1XLAA 2HTMA 2HS8A 4DF1A 2Y5SA 2E8YA 5JXQA 3T0CA 4BQ2A 1FCUA 3C8NA 1GPFA 4ERAA 3VVGA 4DUOA 4WJEA 5HMSA 2B31A 2C91A 3M07A 1ISYA 3J7HA 4RDYA 4QISA 4KF1A 4F0HA 1M65A 1O12A 1W17A 2G3MA 3C5QA 4QIUA 2V5CA 3WMCA 2XPKA 2FGZA 4AF0B 3SFWA 3KLKA 4PMXA 1P6BA 4WHBA 3L12A 5CC3A 3GE7A 1FWIC 3NPUA 4MKVA 4W7UA 1PJ9A 2JBMA 4IP4A 4LPCA 5HQMA 4FS9A 4RL3A 3XIMA 1R47A 2ZZ1A 5BU9A 4IFKB 4E5TA 5E93A 1KCLA 3TYEA 1XRTA 2DSZA 4J40A 5AYZA 4GISA 4H6EA 2O9RA 4XAPA 1JR1A 3UZWA 3TXVA 1LUCB 2WBKA 4S3CA 1HXJA 2VZOA 3E96A 2R8WA 1IZCA 3BQ5A 3N3MA 3IGSA 2PCEA 2AMGA 3AIUA 3GTHA 4GFIA 5CPMA 3CL8A 3R79A 2GK1B 1XX1A 1GQJA 3JVAA 3L4ZA 5I2UA 1E1FA 1KV8A 1MSSA 2XH4A 3LOTA 4ZR8A 2WJZA 4HK5A 1RCXB 1A3XA 1LRQA 1UWQA 2XISA 1K3UA 3UY8A 1YX1A 4IQDA 4XZIA 3M6YA 5A8NA 2FFIA 1MW1A 2XVLA 2BY0A 1SPQA 1F3XA 4GQBA 2E7FA 1Q7ZA 4MJ2A 4WSKA 4NXKA 4CVUA 2OSWA 1E3ZA 3WMSA 5I7GA 1VFLA 2BHYA 2GWGA 1PKNA 2BDQA 3KBNA 3MJMA 3TN6A 1G4EA 2XSXA 1B1YA 3LG3A 1NDYA 3AUOA 5D05A 5EBAA 3AFBA 5D9MA 5AOUA 3CZJA 4KETA 1SO3A 5HWJA 2ON3A 1X6LA 4MG4A 3TYZA 3SRKA 2J25A 1JG9A 3RU6A 1N2VA 3T0AA 4IQEA 4TQTA 1EWDA 3W1UA 2E8ZA 4QROA 2YL6A 4AZBA 3VGHA 2FHFA 1CLVA 4LFYA 2GDQA 2PDKA 5FIPA 2BOEX 2WHMA 4JL1A 2IW0A 3AMLA 2CZDA 4DBUA 3NQMA 4GQRA 4Q32A 2AL2B 2E28A 2Q8LA 1W1B1 4CNUA 3BZJA 1WE5A 1FDZA 2VR5A 1MO0A 2EJAA 3NQEA 4HNLA 3PBYA 4R5EA 4JTIA 3TTYA 4HZ8A 4UMBA 1NOWA 4DLMA 5ABFB 4NT0A 3OLIA 3GKFA 1WV2A 2OXNA 4W9TA 3XISA 4TXEA 2PE4A 3LZ5A 3DG7A 3LSBA 4E3VA 2J24A 3QV8A 3WUBA 4C6BA 3U2CA 3IGUA 4XSLA 3AU2A 1GQIA 3SY5A 1E1EA 4Z0SA 3LDVA 3WX7A 4IFOA 1J0KA 3CHEA 4HYWA 5C7HA 5GNXA 1JNEA 4UWMA 3VX1A 3LQLA 2ZZ5A 1J79A 1JYXA 4GCAA 4HZ7A 2PDQA 2POTA 3LEPA 2DVUA 3IVSA 3M0YA 1TPVA 1B3WA 1OWQA 4OZOA 4CNOA 5AKQA 1QTWA 4P7NA 3CPGA 2GGIA 3FYYA 1GTEA 3KZPA 3JW7A 4GXPA 1VEOA 4GLEA 4WDWA 3VM5A 5AC4A 2CLHA 4GZEA 4AISA 3V5OA 1SJBA 4XIAA 2POZA 1EX5A 4QG6A 3SRDA 3NQ6A 1ZSXA 3BOXA 4NJGA 1LROA 3ITLA 1UZHA 4MJ4A 3EBVA 3IIVA 3DH7A 5FJJA 3NEHA 2E25A 5LNWA 1WKFA 2EKCA 4L1GA 1E73M 4E2DA 5FF4A 1O1HA 4YN5A 3N73A 1DJZA 4JAWA 4XAFA 4H6KA 3VM7A 3RNDA 3EXRA 1W1YA 3VOJA 1XIJA 3TFXA 5A8OA 2XINA 4F2TA 3MO7A 4PSRA 3NZGA 2GVYA 4C6CA 4LBRA 3UCDA 1W32A 1UD4A 1F05A 3EGJA 4WRHA 1LL6A 1F5ZA 1GOXA 5DBTA 4FHAA 4DY1A 3LERA 4U10A 4V33A 2XTKA 4B90A 1PBGA 3LUTA 1WKDA 1DHPA 1H50A 4LCSA 1XLFA 3WCZA 1MZRA 3DI0A 2Z1XA 1US3A 2ZX6A 3V1PA 3CXOA 4XVDA 3M5VA 2H9AA 2PP0A 2PLCA 5T9CE 4PBFA 4MFDA 3V4BA 3S42A 4PMQA 3GTXA 4M56A 1KGUA 4W87A 2ZADA 4LUSA 3QR1A 5ENLA 3UJSA 1J0JA 5G1TA 3P81A 3LU2A 3EWWA 4YHGA 1MFVA 4ZSTA 5AVHA 3TQPA 5BXSA 3PPGA 1M68A 2Y8VA 3B9DA 4UFMA 1ONRA 4MM1A 3TH6A 3BAKA 3W76A 1W5MA 3GXDA 3H2FA 4HBKA 3QJAA 3E0WA 3IJ6A 4H9ZA 5DT7A 1QHPA 1M53A 5HPCA 4IJCA 3MCOA 2ABAA 3FY1A 3SCWA 4FPSA 3GXTA 4UOQA 3MHUA 4KCUA 2YKKA 3EOEA 1RVKA 8XIAA 1M3UA 3BW4A 3WQ8A 3U0HA 2QKFA 1J0YA 3CASA 4Z2JA 5FF3A 4Q7IA 3EDEA 2NXGA 4OV4A 4D8AA 2FZDA 3CQJA 4XZHA 4GPNA 4YVPA 4HB7A 1TRIA 4JTGA 4WK9A 4OU1A 1WAWA 3ME3A 3EWBX 2CHRA 3IV8A 5FJRA 1OX4B 4XX6A 1SO5A 2DDXA 3LNMA 1PS9A 3DBNA 3OBAA 4JDYA 2QQ6A 4PMZA 3GFYA 4B15A 2DT0A 2EEXA 3W87A 1D3CA 5FCZA 1GQNA 1TVPA 2DVXA 2XZ9A 2AL1A 3TV8A 3V3WA 4NHVA 5D02A 4ICCX 4GQ0A 1OHLA 2PODA 4YTUA 3F03K 1FFRA 1J5TA 4H6QA 3PULA 3EXSA 4AD2A 2QIWA 1TB3A 1IEIA 3LCXA 1LYXA 4TU1A 1W91A 4J2MA 2YW3A 1EWEA 3TYAA 4WEVX 1Q6OA 3ZSSA 4F0MA 2VWTA 4MGGA 3HU7A 5I07A 4J5NA 3TUUA 3LCWA 1X97A 2C3ZA 4UR7A 4L80A 3THAA 1QJWA 4PCNA 4POCA 2ZRWA 3ID7A 3E2VA 3KTSA 4MSSA 5AFDA 2O9TA 4XKMA 3OVGA 5HULA 4RJEA 4W86A 4W84A 1PZ2A 1NY1A 3MQTA 4P8XA 4U5IA 2DT1A 1V0NA 1RK5A 4Y8EA 3P3BA 5C71A 1KGXA 3MA8A 3G18A 3ZWSA 3SADA 4BFAA 4QJ5B 3FXGA 1WUFA 2YL9A 2CBVA 2DUZA 1VR6A 4X9SA 4ADTA 2ZXDA 1FCQA 5F4WA 5D8ZA 4L9ZA 3BJSA 3WBAA 3WH8A 5LNUA 2HE5A 1FP8A 5BRQA 4ATLA 1H7RA 3A3HA 3PNZA 2WCAA 5JH2A 2OQLA 4FNQA 2C18A 3HQOA 2XIQA 1KTBA 1BVWA 3G1HA 1XICA 3L0GA 3O7UA 5H91A 4EVZA 4UZUA 5BROA 2JF7A 4GE8A 4L56A 1XLCA 1HJSA 2BODX 3CHVA 5TQLA 1KKRA 3MI2A 1R2TA 1MQPA 1WZKA 1SVDA 1FUYA 3BGJA 3WH6A 3P0WA 5CJMA 3Q65A 4L9YA 2JK2A 1Z89A 2WSYA 5EBUA 4PZVA 1UOKA 2A7NA 2X30A 2GJNA 4WSHA 3BLDA 3G1FA 2VGGA 3GR7A 4TTGA 3MUAA 2I56A 4AD0A 1B57A 3G3DA 4CEXC 3WF1A 4H9XA 4ZE4A 1VRDA 3AROA 5LA2A 4G7EA 2ICSA 4GZ7A 4IICA 3W7HA 5FKYA 1JVNA 1OSEA 2C8NA 5G4EA 2ACUA 4BK9A 3A6OA 3VX0A 1HIZA 1W8SA 1WBJA 3SUUA 4ENLA 3DFNA 2Z26A 2TAAA 4WDTA 1JRBA 3UNDA 9XIAA 4AX6A 5I09A 2HXUA 4HN8A 1HX0A 1L0PA 1JXJA 1ZY9A 2C16A 4MWAC 4EF9A 4LVBA 3REQA 4EPKA 2PDPA 1ZTVA 4HN4A 2PD9A 4RW5A 4NX5A 4DUVA 4AAJA 2Z2UA 4TIMA 5J8LA 2HVNA 3OOQA 1XG4A 1Q6FA 1BXBA 3PTMA 3TC3A 1G4PA 3T09A 2DW6A 1ZCCA 2X2YA 4GYPA 5AVNA 2A7RA 4ML4A 3NVDA 1FH8A 2VRKA 4AF0A 3VD5A 4MVAA 3ZVHB 1NF0A 3KHJA 1OF8A 1OZMA 1ONXA 3K8LA 2XFFA 3GG7A 1ECQA 3Q2DA 2GUUA 3H7RA 3APGA 3G1YA 3VK5A 2C0AA 1BG9A 4RZ6A 3VNKA 2PZNA 1XIFA 3BAIA 4ZSUA 2PDIA 3FJLA 3M64A 2NT0A 1BF6A 1P0DA 3CWNA 3QR0A 3VAVA 1JZ6A 3FLUA 1GUVA 3ZJ6A 1EF3A 2YFOA 1N82A 1H7XA 2QAFA 3RM9A 5DY3A 4AB4A 3MYOA 2WMIB 1AVAA 1YPXA 4WY0B 3LQGA 3W6LA 4PCFA 5BZAA 2YCIX 2WVVB 1CWYA 1TE1A 3VDCA 1YIXA 2XFRA 3NSMA 3IUIA 4KCTA 2QVHA 4GNVA 2D3LA 4MY9A 2J9ZA 1NDVA 1SJAA 4B3KA 5EPDA 2E4TA 3MI6A 3FS2A 2DJXA 1DJYA 5DY2A 4EANA 1W56A 4KKXA 5AYXA 1UD5A 4O1FA 1MZHA 5EMLA 1MWOA 1W8GA 3RM4A 3H54A 2W9MA 5M1TA 2QLYA 4Z17A 2R14A 4PR4A 4H9VA 3UG5A 3IJQA 4AX7A 3REQB 2VFEA 1YE6A 4ZENA 4Y9NA 2GYIA 1HKIA 1JULA 3WJZA 7TAAA 4QS5A 4W7WA 1UW9A 3A22A 3H4WA 1XLMA 2O4MA 1HJVA 1S5NA 4W7VA 1CW2A 1E9IA 1WDWA 3TR2A 1I2QA 3LYEA 4YU1A 1XSKA 4LUJA 2J7EA 2NSXA 3TKFA 4C6PA 1U1HA 2XIMA 3WDJA 3QQ1A 4XZWA 2CBUA 3CAWA 2DZUA 1H7OA 1X1OA 4UTTA 4BZYA 3QC0A 1L6FA 4LBSA 2OO6A 4GINA 4PMOA 1JYWA 4BR1A 1TUXA 3OG3A 3GH4A 4NY2A 1DYSA 1QOXA 1BRLB 3L4UA 1R5YA 4ZQRA 3L7RA 1GYLA 3TTQA 4EXBA 1TR1A 1REQB 3KBMA 3WH5A 3KS6A 1Z8AA 3NQCA 4FNTA 2Q01A 4Q4OA 2DZTA 1UZ1A 3AI0A 1AUSL 1ITXA 1UQYA 3H24A 4HCHA 3VI2A 2Y63A 3UJEA 1XLLA 2XUCA 1EO5A 3WUGA 2J7CA 2ZWZA 3UU0A 1RA0A 1DORA 2ZRVA 1OFBA 3UWQA 1EZ2A 1XSJA 3KP1A 1MMFA 3VYLA 4PUUA 3A24A 1JI2A 1PZ0A 3EPOA 1VFHA 3M47A 4ZO9A 3LXAA 3HMJG 3PUGA 4JN7A 3KWSA 5E9XA 4NUWA 4LV4A 3R8RA 1HGYA 2C15A 4CQ8A 4AD4A 4Y8FA 1IWAA 3E0FA 3W02A 2BNJA 1X1ZA 4PMJA 3UXIA 1GG0A 3NAVA 4GQQA 3AHVA 1JRCA 1UZDA 4LWWA 4N7QA 1T96A 4MB3A 3UR2A 1MNSA 5A8MA 3KOZA 3C0SA 4LQ1A 4QTGA 4G5DA 5LHEA 3P7YA 1LWJA 4O18A 3S46A 1I1WA 3N11A 4UBPC 1UH2A 5HJLA 3UF9A 1TPC1 2ZZ3A 3APYA 1YMYA 3HN3A 3GNOA 4GYFA 1XLIA 4GUFA 4KEVA 2VGIA 3BMWA 4IMEA 1TVNA 3C4UA 3UCCA 2YBVA 1JZ7A 3ERPA 1BGAA 4Q8NA 1YDVA 1TPWA 3PBGA 2FLIA 2FH6A 1XIMA 1EDTA 3AHYA 5K9DA 1DXIA 4F4RA 4P61A 2EPOA 2X7WA 2OWWA 1UP0A 4WDXA 4O50A 4XTIA 3PWGA 2PD5A 2QCHA 1FWRA 1LG2A 3AS1A 4F0SA 1CEOA 3ZVIA 4IFRA 2OTDA 5FEZA 3IV3A 4UQBA 2ISVA 3QGKC 9CGTA 2BY3A 3DG6A 5HJXA 2Z7KA 3NQVA 4D9PA 4RX0A 2B4GA 1LLWA 3GBEA 3O6AA 1VFUA 1H49A 2WYSA 4XBKA 4AW7A 1S2TA 4B5VA 4YTRA 2Q02A 4C7FA 1VBJA 4GJJA 4UTMA 4FX6M 4HMDA 1PIIA 2Y24A 5DLCA 5AC8A 2O0TA 4B3LA 1ZAJA 1TG7A 3QFWA 1TIMA 1YW1A 1TJ2A 2OSXA 4PB5A 4OKDA 3KCJA 1SFTA 1KGWA 4C6LA 3OGRA 5IHRA 4UFLA 4LVDA 5EMYA 4B5XA 1GOQA 2OWCA 1TWIA 4XG1A 3RRXA 2E1DA 4GI6A 2O7SA 2W62A 5FA5A 3R5EA 2PWUA 1WXZA 4O1EA 2PP1A 4NI8A 2TSYA 3SN4A 2DUAA 3TA6A 2WZMA 5LSMA 5BXTA 2GGHA 5HDRA 1ZBKA 4C1LA 4O11A 3AYTA 2F38A 3WBYA 4GX9A 1HP5A 3UP8A 3FAWA 3K8KA 4YLWA 4TX9A 4UZSA 1W2PA 4L7ZA 3FSUA 1M03A 1IZKA 1IEXA 5HJYA 7PTDA 4B5SA 2PMQA 4PMVA 1WB0A 3CB8A 5G1YA 3GUGA 1F7BA 3OZMA 3NG3A 3LHVA 3IACA 3VGGA 1FQ0A 3GRIA 3DERA 4AVOA 1DWFM 3G1RA 3VZYA 2HVMA 1SR0A 2DQXA 2JALA 4R9XA 3UWUA 4IGSA 3IEBA 1HVXA 4F9DA 1CI1A 4KERA 4H9MA 2HWGA 5FAJA 2X1UA 1JDDA 2WC4A 2X42A 3L68A 4O52A 1J2WA 3BJTA 3S2LA 3O16A 2ATMA 3TQVA 5LNSA 1Q6CA 3SR7A 1HKMA 1KFCA 2PSNA 1CXIA 1J18A 1Q65A 1OCNA 1G1YA 3UG3A 4JIEA 3TOYA 1EGVA 4NSBA 4AWEA 1OFQA 4BWLA 4CCDA 1S3HA 1J10A 1YE4A 5C9UA 3EKGA 2BVWA 1TX2A 4MHBA 1LWIA 3ZT6A 5KZ6A 1OADA 2J66A 4QDMA 1B3YA 1GOMA 3ICJA 3N34A 5CPSA 4E2BA 3OGSA 2J9YA 2I16A 3W71A 4P5UA 3TTOA 4WOQA 3W1MA 5HNUA 3DFOA 1RD5A 1XYZA 4FLRA 1HKVA 3E6EA 1QNOA 2WKJA 4L9XA 2X1SA 3GXIA 3R58A 4L1WA 2GPTA 2MANA 4JPGA 3AZRA 3M0JA 3RXZA 3VKAA 3QW4B 2QCEA 5DXXA 4DUWA 3B8VA 2PWHA 2WW5A 2ZRXA 2JGQA 1NWRA 5F1VA 4IM4A 4UC5A 4Z2HA 3MSGA 2CYGA 2R1PA 3N04A 2VDHA 1NDZA 4MWAE 4NAFA 4ZO6A 3L66A 5IOBA 3FJ6A 2O7QA 5TIMA 2I57A 3WQ4A 2R9RA 4FB7A 3L2IA 3GHUA 4A22A 3CAQA 5ECUA 2QT3A 1J4EA 2Z27A 5F4SA 4M6QA 3DHPA 1TJ0A 3P74A 4LAUA 2W63A 1VIWA 4ES4A 3BLLA 8RUCA 1SU5A 1NWUA 5HBFA 2WVUA 3GNXA 3HMCA 5I3JA 1ISXA 5CC6A 5CBIA 1EJWC 3RO6A 3GTIA 4FLOA 1FHDA 3WBXA 3M0HA 2FTYA 2H8XA 5I06A 3FIGA 4X60A 4EAMA 3QV9A 2IUZA 1EJ7L 1QNSA 4BQ4A 2VXNA 3CUFA 1WO2A 1LL7A 1MW2A 1K9FA 1LOLA 2PZ0A 1IWBA 1FKXA 1MFUA 3O0KA 3CAKA 3MV01 1KW1A 3QZAA 4GI4A 3S0CA 5AHIA 3G0SA 4KQNA 2A3CA 3W0KA 5KZEA 1J6OA 1UPMB 3QC3A 3TJ4A 3PZQA 1FWNA 3R0UA 4MAZA 4TX8A 1DTUA 2OMAA 5HR7A 3KRZA 1H60A 1MRAA 3R10A 2X1RA 1UP3A 4TV5A 2OEMA 3SIMA 3OZYA 4QDPA 4INFA 4RNFA 1RJPA 3N2TA 3O15A 3NQDA 4YPJA 1SW0A 1UR8A 2O55A 4O13A 5DBUA 1VIZA 4Z1CA 3P80A 5DMLA 1E6ZA 1WOBA 4GGBA 4CD6A 4KFOA 1GPWA 2ODOA 3Q37A 3A4AA 1QR7A 4HNVA 3G1AA 1ZB5A 4UR9A 3GY1A 1OCQA 3BSMA 4FLQA 3S4TA 3W25A 3LHYA 1TELA 3U4FA 4HVXA 4NX0A 2HSAA 4I6VA 1QUMA 4ZO7A 4D6EA 1VD6A 4CD8A 3HTWA 4H6RA 4I8DA 1XKYA 1PL9A 1QK2A 2J8TA 2VVNA 3DCPA 3W88A 1ZFJA 3KL0A 3O2LA 5D9NA 2QXWA 5MHBA 3R25A 3GIYA 2IQTA 3P67A 4CKQA 3QV6A 4DJFC 1XD0A 3NXLA 4BKNA 3N3TA 1CB7B 2V2DA 1MXSA 3UQNA 2FDSA 1H2JA 1W9DM 2CNCA 4BJHA 3GU9A 2WK2A 3A4XA 1PZ3A 1OFEA 3UA3A 1C93A 4H9YA 1PHQA 2C6QA 3OP2A 2QDHA 4HIBA 1GHSA 2SFPA 1GKQA 1ZQ5A 5M17A 1XXXA 4F2UA 5AB3A 3T2OA 1UBPC 2BMBA 1BYCA 1DJHA 1O4UA 1W37A 4AZCB 3WD1A 2IPWA 3WDQA 1V02A 3LX9A 3ENLA 3S1GA 1A5KC 1AZ2A 1M7PA 2P8CA 1U5JA 1S1PA 3S47A 2NX3A 3PBWA 4YJ5A 2ZKMX 4HT3A 4H00A 1K8CA 1NVMA 3K1DA 1THFD 1Y5XA 2PF8A 4Z2GA 3G1DA 4N0RA 2NQLA 1PKYA 1JF5A 1RSCA 5EMKA 4Z1DA 5ABTA 5CSSA 3ANUA 2G5WA 3NQAA 2EHHA 2EG6A 1BF2A 1XWYA 1WYIA 3WNPA 3OB8A 4D6CA 5KZMA 3N12A 4IT1A 3T44A 1GJUA 3GO2A 2VURA 5F7UA 2PI6A 3QPYA 4XO6A 3WENA 2OOGA 3BO9A 4C6FA 5CJ5A 1E70M 1JPMA 1NFPA 1Q66A 3CWHA 3U48A 3PZMA 2PDWA 2BVDA 3SJ3A 3R89A 3WEMA 4XZ9A 1F8IA 2PUZA 2ZXBA 1UB3A 3BW2A 3C3UA 1NP0A 3GZ3A 1I9CB 4REQB 3UXDA 3CWOX 1QVBA 2WHLA 1FTXA 1XPGA 1XJBA 4MZ1A 3VUPA 4AHOA 1J01A 4HPHA 3A5VA 2RDTA 4BI7A 2XGBA 3CV7A 5I02A 4MUPA 1JPIA 3M5XA 5LKYA 3UZYA 3UGVA 2FVLA 1U22A 3NOYA 3QKZA 3QMSA 1J8VA 3LPFA 3UR8A 4LX4A 4RZ4A 1TTQA 1Q6GA 1RLCL 3CHDA 9XIMA 2DFAA 2V2HA 4A21A 4DHGA 2GGJA 4GBDA 3DKJA 4W93A 1PPIA 3MP3A 1F4HA 1KR1A 4Y9OA 4IG2B 3HPXA 1Z41A 5LYRA 2OELA 1SW3A 4B5NA 3MZ2A 2GGGA 2IKHA 5CPQA 1P1MA 2XN0A 3QHMA 3FYOA 5D9OA 1TCDA 4AY8A 3RPMA 4H8NA 3B3DA 2VC9A 3PWAA 4MNJA 3MBDA 1V79A 3UZJA 2PCQA 4I6KA 2OYKA 3N13A 5LNRA 3N2MA 4DJEA 1XLEA 3BJFA 1AW2A 1XV8A 1IGWA 1XL9A 3D5HA 1Z3NA 1XDLA 2EG8A 2IXVA 1TZ9A 2BBFA 1KWKA 3B40A 3TDFA 2J9XA 1NQ6A 4NNAA 4UTLA 4C7DA 4YTSA 1KRBC 4HOZA 3F4NA 4AZGA 4M0XA 3G1SA 1VJZA 3HFTA 4V27A 3QTGA 1C3FA 3RYSA 4C6EA 3W1RA 4KWSA 3PFMA 4MMWA 5A6LA 1S5WA 4WKHA 4GD0A 4PUDA 3K5XA 1PKLA 3OVQA 3NQFA 1F9CA 4I9TA 3HPAA 2YYTA 3NQ2A 3GR8A 1VS1A 4AVFA 4CCEA 4AIOA 3SURA 5MKGB 1YDNA 3B05A 3T78A 1BFNA 3TMQA 4C7GA 4WGHA 4LAOA 2F2KA 1GVFA 2G3IA 2C1GA 2OGYA 1EJVC 4NJIA 3C2FA 1RQEA 1YBQB 2WXDM 2CU0A 3LPPA 2PU0A 4JYEA 4X2RA 1TKKA 4JTFA 4AWTA 1XIEA 2P5NA 3T0TA 3KVKA 4DF0A 1H1ZA 4HA0A 4Y90A 2JKEA 2A3AA 2XGIA 3S2NA 3KAOA 3VNLA 1A0DA 2IKIA 3RMEA 4AZHA 1YRRA 4A35A 1KBLA 1XUUA 1PZ1A 2OPJA 3LRMA 4FNSA 5I78A 4XIMA 1P0BA 3MW7A 3V5FA 4PUWA 3SI9A 3KBSA 1OX5A 3W1LA 3WN6A 2OZ8A 4GBUA 8A3HA 1WPCA 2QPSA 3ITCA 1F3TA 4GVGA 3S6DA 2A5HA 4LYQA 3GDRA 3U3HA 1ME7A 3B4YA 3OQ8A 4DM1A 2GSHA 1TJPA 3NWRA 3SM0A 2VOMA 3UBPC 4P7QA 1F2JA 1KCKA 1SFSA 1W3LA 1DP0A 1CXFA 3CZGA 4XD6A 2FHBA 3W2UA 4FXSA 5HMFA 1A47A 3P2VA 2W6RA 3BAYA 1UJPA 4FF5A 3AIVA 1RBOB 3K4WA 2VTFA 3IS4A 2OKTA 1B0IA 4WQ6A 1QNQA 3C8FA 3STPA 2JEQA 3GHRA 2VHLA 3AOFA 2Z24A 4Q4QA 3U5YA 3W74A 1KTNA 2EPKX 1AH4A 1NH6A 5EA9A 1A5NC 3KRSA 4QG9A 1E6XM 1AL8A 1S46A 1KM1A 1UP2A 5GJMA 1S2CA 1PX3A 4Z1YA 2W4XA 4D71A 4IXXA 1HKJA 1O95A 2QIIA 3EWDA 1A4LA 1WXYA 2CCRA 1B3XA 2OYMA 4X63A 2JIWA 1WX0A 2NX1A 3SGUA 3TAOA 3MCNA 1P1XA 4PUNA 3BANA 3NJ3A 3FGCA 2A85A 4JTSA 3AXXA 5CGQA 2XGZA 4H8HA 3N4EA 4S3EA 1PE1A 1O60A 2OO0A 2P76A 1OGSA 4CCZA 4GYPC 1FWJC 1DJNA 2AQVA 3T2QA 1R2SA 3SQMA 5A6JA 1LM1A 4HA4A 1V7AA 2PBOA 3U57A 2WWCA 3PJUA 3RCMA 4TTUA 3EB2A 2ZYFA 2IPFA 3D6NA 3VIJA 3OQEA 1CB2A 2NQHA 5HNNA 1QATA 4EOUA 1K6AA 2WNWA 4FOKA 5D4YA 2YA0A 4JTEA 4PTNA 2X7VA 4F2BA 3MDUA 4ZBCA 4H7CA 1S5MA 1O5RA 1U5HA 4I9JA 4NI3A 3W27A 4JQ2A 1HL9A 4JKMA 1QDSA 3TQ0A 3UVAA 3W86A 1B5TA 4I5RA 3ZYZA 2YLAA 3SZ8A 2YX0A 3WEOA 5A2AA 4OOUA 2ZC1A 3LI0A 1QW9A 2OQYA 4UNLA 2OB3A 1JDFA 1RALA 5HINA 1SUXA 3B0VC 2PRLA 4UUIA 1C8XA 1SFLA 2NVDA 3RHGA 3VIIA 4Z1AA 5KMYA 1M7OA 5IFPA 2Y2WA 2X0YA 3H2EA 4A3RA 3VCNA 4GMEA 2YCJA 3O0FA 2FPTA 4TVDA 2HEJA 4Z0JA 1VJIA 4IIEA 1VRXA 4H83A 5I3DA 1M1BA 4P8UA 1K4HA 3BUVA 4NL1A 1XW8A 1IT7A 3NSNA 1IGSA 1SZGA 1IEQA 1SZRA 4DI8A 5GPRA 4JTUA 3TP4A 3TSDA 1A3HA 5T91A 1FH7A 3H7UA 3AS2A 1IXOA 1ALDA 3R0KA 2QUUA 4HOXA 2QJJA 1YNYA 1LOSA 3PZUA 1NQKA 5A8PA 1AMKA 3B0XA 4J4KA 1AQHA 4ZOAA 4B5UA 4GK8A 1ZJIA 4YYFA 3B8WA 2HJPA 4M3PA 1LBFA 5EMJA 1Q63A 3PC0A 2X05A 1W3NA 5AC6A 3RUBL 5BOFA 1ISVA 1OK6A 5A3HA 1GVIA 2ZUVA 3E5BA 2CXEA 3G0XA 3QOKA 4Q6JA 1I60A 1K77A 1PCWA 3N6JA 3KOWA 8XIMA 1US2A 4HNOA 4DYKA 4LTSA 4A2RA 1UKSA 5IBXC 1V6WA 1A5LC 3H7VA 4PTDA 2DH3A 3IRSA 3I65A 3WQCA 4OWGA 2DQWA 1E51A 3N29A 1XLKA 1KWGA 3ZOAA 3E12A 1QPKA 1FHUA 3P14A 3UWVA 2ZE0A 3CMJA 4OBTA 1JI1A 4J3UA 4IMAA 1G94A 4TUFA 5AHNA 2DORA 4GKTA 2VFIA 3KOXA 2WZHA 1T99A 1YXDA 3MMWA 1LJYA 2Y7EA 4KRZA 3EDFA 3QV7A 1R3YA 3ZXWA 2C71A 3WLMA 2QJNA 3KRUA 1KFJA 3HPSA 1KM3A 4ATWA 1GEQA 3UYIA 2W92A 3GM8A 1DIDA 3R8HA 4GJIA 1KFLA 3A9BA 4DZHA 1TTIA 2V3FA 1E3XA 4QJ4B 5B7YA 1RZMA 1IEVA 3O6CA 2J27A 4M80A 2YZ5A 3WF4A 4JZ5A 4GUGA 1MW0A 1A5BA 3VILA 1VEMA 5CC5A 1PCKA 5IDIA 3PJTA 2NUXA 2YB4A 2UWFA 4GJ1A 4HTBA 1ZAHA 1IYXA 3NZQA 2VM8A 3ITTA 3VMNA 4FNUA 1VFSA 4LSBA 1JCTA 1OZQA 1TYGA 3OU8A 2BSLA 2D2JA 1BXNA 4JS3A 4I7WA 1W9UA 1V6VA 2HVOA 3GIPA 3JZEA 1F6PA 2BHUA 3W29A 5I00A 3WQWA 4L61A 4AZ7A 3TQKA 1N7KA 1LTDA 1J11A 2FPVA 3EX6A 4S38A 1W9VA 4RPQA 3S5SA 3KP0A 3ORWA 1QI4A 3VDAA 3VNIA 3H2AA 5DX7A 4HD5A 4PGLA 2A79A 1QWKA 3TR9A 2ZA2A 2VGBA 4W4QA 3I10A 5FACA 5BYWA 4K7VA 2BLEA 1Q8JA 4C6OA 3TJIA 5HWNA 1M04A 4O28A 2YYUA 3RPTA 3OIXA 3QTPA 2D2OA 5CPLA 1TMLA 4ICNA 1TVLA 5FD0A 3LCHA 5D32A 1FXPA 2CBJA 3IVUA 2X8RA 3TXZA 2FHCA 2J62A 2ZFAA 2Z1SA 4MDOA 4G1KA 1TJRA 4WVXA 5TAOA 5DCBA 5DMYA 2WKLA 5D09A 2QUTA 1L2QA 1Q2RA 4JX6A 2OX1A 2H3DA 3PTQA 1V3HA 1HP4A 1PX8A 3RRAA 2G0WA 7TIMA 4ZZ9A 2X2GA 3HPFA 2GJPA 1ONWA 3A4JA 2D0HA 3KWXA 3WFAA 2WMIA 5AC5A 2WOQA 1ZP3A 5BWAA 5AC7A 3RDKA 2V5DA 3VFLA 4F79A 5HQLA 5EMMA 3W2NA 4GI8A 1AQFA 3BV7A 2VL4A 2GFTA 3FDKA 3NL6A 1XIDA 2H90A 3WMLA 1HL8A 3CZEA 3MY9A 3RX4A 3UXAA 2ISFA 3KEHA 5F2IA 3S2JA 3WSUA 2YDAA 1W3KA 3R11A 4AFYA 5CAKA 4C5ZA 5C7VA 5JUVA 4IX0A 3CV1A 3VNMA 1AW1A 3PS7A 4JTDA 5DRIA 3NGJA 4A05A 4MNKA 3STCA 3IUHA 3QMTA 2E77A 1GYNA 3WK2A 4GA8A 1TE6A 1I0BA 3PJWA 2C7FA 1XBXA 1RY0A 4ZXOA 1H1YA 3VNJA 4CD4A 1OFAA 3RK8A 4AEOA 2DUXA 2BGQA 3U2OA 5TF0A 1KM6A 2QCFA 5D33A 3ZLFA 5DCDA 1TJ1A 4NJHA 4MB5A 4V1YA 4PC8A 4NYUA 4DRSA 3W81A 2UZ9A 1UWAA 4FAMA 2NUWA 3URNA 2GJXB 4EXAA 1QI3A 1A5UA 4U28A 1OX6A 2OZTA 3AJXA 3URBA 2RH9A 2XIOA 3H55A 3N4AA 1TPEA 5DCEA 3CC1A 2YXXA 1PB0A 2OVLA 1Y8BA 3RITA 1ECEA 4ORMA 2FZNA 1TPH1 7REQB 3CT2A 2V82A 2QCDA 5FEWA 3PHAA 1XYAA 2D0GA 4JD4A 5CC7A 5BOOA 3ZMRA 1B90A 3G77A 1TV7A 4UCFA 2HMCA 4H9TA 4FSAA 5HK4A 4ILSA 4HSNA 1D8CA 3NPXA 1T41A 1GCYA 3NM3A 3PM6A 4MWAD 3NIYA 3QY7A 3UWZA 3L9CA 3LTSA 1FWFC 4D8ZA 4K6AA 2P10A 4U2ZA 4G56A 1QI0A 3E38A 4QBXA 3LTYA 3QXBA 4FF7A 1OIFA 2YB1A 2Q3RA 2ZOXA 1K02A 2DZPA 4RE0A 1U1UA 2PWFA 4FNPA 3N9SA 2HPIA 4AQLA 3H8AA 4Y9AA 4KWOA 4Q8UA 3L5MA 4QAIA 4D6IA 3HBLA 7ENLA 1OB0A 4CUCA 2PTXA 2G3NA 3ZWTA 4MZ8A 3JS3A 4HMEA 3ELFA 1OBAA 4R7JA 3K13A 5DO8A 3VTRA 1EPVA 3M44A 4BF9A 4OIFA 5BRPA 1VPXA 3W53A 4PTXA 4AYGA 3LLXA 1ADDA 2GQ3A 4XKYA 3JRKA 4J35A 4BA0A 5IFTA 4YVVA 2CLEA 4WCJA 4YTQA 1BD0A 1OX4A 2QNEA 2WJFA 1R3QA 4UTWC 1UD2A 1AQ0A 1NJJA 3EPMA 3L0KA 3RGTA 1AW5A 4O0QA 1HUVA 2VEFA 2VFGA 3ALGA 3MB9A 2NV9A 3C52A 3CO8A 2QMKA 2XVGA 4GKLA 2RDWA 2YCKX 1KTCA 3GK0A 4JX4A 1CGVA 4LUSB 3QPZA 2CKRA 3OZOA 3O63A 3UCQA 5CSRA 3RMJA 1FVPA 4LUTB 4JBRA 2ZBTA 3BVJA 3WLKX 4LS1A 1OD8A 3W26A 4WLCA 4UQCA 4GACA 4AU0A 2XN2A 2RUSA 1B3OA 3M0LA 2Y7FA 1QWGA 3B03A 4B16A 4PMNA 1S1RA 2B0MA 3B4UA 4W85A 1AODA 1Q6QA 2VVSA 1I4NA 1F3EA 3COTA 2ZX8A 1ZALA 1OFPA 4Y9PA 3UG8A 3LCGA 3I6EA 4AUBA 2ABBA 3VDGA 5IHSA 3HJEA 1WZMA 2BVTA 2B7QA 2QS8A 3IIZA 1UROA 4IF2A 3I6TA 4ZQPA 1QO5A 2MUCA 1RQHA 3OW1A 1ADOA 2BGNE 2Y62A 5REQB 1UASA 1BGGA 4WR3A 3VIKA 1ZJAA 5C0QA 3WMBA 1MDLA 1WXJA 4PUJA 4XZNX 1ZAIA 4R7OA 2QCGA 3F2DA 2D3NA 1SR9A 1RV8A 3S5NA 4UTHA 5KITA 4H41A 4DNMA 3THQA 4RLIA 4I5XA 4IX2A 2XH7A 3ARPA 3P5YA 3AAMA 2WHKA 2R24A 1N8WA 2XZ7A 5I79A 3S2CA 3DFYA 3UPBA 3CHCA 4JFSA 1VFMA 2A3LA 2BFGA 1GJWA 1EUAA 1XH2A 5EYWA 1FKWA 3SUVA 1DJQA 3MSYA 5DEZA 1M9HA 4JY9A 2OEKA 4KIEA 1MRQA 3PBUA 3ES7A 4X0VA 1T40A 1GJPA 1J5SA 1I1XA 4K37A 1WA3A 5XINA 4LAZA 1L6SA 2MNRA 3W2LA 3RCNA 2J78A 3JUGA 3HA1A 4JGDA 2O4QA 4B9YA 1T8QA 4U2YA 1LL4A 3TN5A 4C60A 5CPTA 4ZO8A 3C0LA 4P7RA 2E6DA 1FWDC 4TVUA 3UXKA 1UR9A 4RDZA 4LANA 2CESA 4FOJA 1ICQA 4RR4A 3GYEA 4AZCA 1QCWA 4E4PA 1KLZA 1C9DA 3CUGA 1BG4A 4UNKA 1L6YA 2OU4A 3EAUA 3NZ1A 3VMPA 4CD7A 4H1ZA 4DJDD 4MFEA 3UESA 3B8DA 3BSGA 2GLKA 2FGLA 5FF0A 1E55A 3MVIA 3NDOA 3MV11 4KRTA 4RZBA 4DWDA 4NAEA 1EC9A 1Y0EA 1DJIA 3DYOA 1W3JA 3LGEA 1QHOA 3VOHA 3MKCA 1QI5A 4EPDC 4HGXA 4DJDC 2CWNA 5T8GA 4CN6A 4D1IA 3VD4A 1OF6A 2WPGA 3RR4A 3VGFA 1I8JA 5TNVA 4L4OA 4UQ9A 4U5KA 2HRWA 1EHAA 3BG3A 1KXQA 2WZTA 4RXFA 5LGXA 1GORA 1YXCA 4US5A 5CZKA 1TFVA 1DWGM 1UR3M 1GEHA 2QCMA 5A6BA 2ISWA 4IJBA 3BLKA 4HK6A 1UBSA 1IF2A 4S3GA 3AXIA 5TD4A 3CPRA 3TTEA 2UBPC 2PB1A 3NPWA 5JBDA 4NZ1A 4CU8A 5AYYA 4WXYA 3EA3A 4ZQMA 1MNZA 1ZUAX 3L4YA 1F76A 3ITGA 3T1GA 4PL2A 3I3EA 4LVAA 5CLWA 3R8GA 3Q4DA 1ZGDA 1XYFA 1I75A 4X9YA 3GLCA 4HTYA 1A5CA 1UR1A 1S2VA 3B8UA 2QV4A 2QEZA 4ZOCA 4HJFA 2V0TA 1UKPA 3AXKA 3BLEA 3DZ1A 4CLMA 5CBJA 5FOOA 3VGBA 3LBCA 3DYPA 5F1UA 1KBIA 3GVWA 2RHGA 4QCFA 2DZBA 4GABA 3TYCA 3WQDA 3MVTA 1OINA 2E67A 4AVNA 4LY4A 2NQ9A 1C29A 1LORA 1SO6A 2RDXA 5GJNA 3WUFA 1PO9A 3O07A 5IRPA 4HU8A 1QU4A 1JXKA 3HO8A 1FWBC 3BC9A 1N55A 3G8EA 4DPPA 3C3NA 1XBVA 1I6NA 4ALDA 5C9XA 1J0ZA 4UTKA 4MLRA 1QK0A 3W82A 4NG3A 5E0FA 1MDRA 3ONBA 3VDHA 1CXEA 4FIRA 3ZJKA 4Q22A 4LF2A 4IPNB 1LG1A 2OX4A 2PDCA 3P84A 4S23A 3U5UA 2I5QA 4QX4A 4NZ3A 5I77A 3CK5A 4D6HA 5MF5A 2XWEA 4CCCA 1U1JA 1EBHA 3MPGA 3S1VA 3DN5A 4LUTA 1EJUC 4QJ1A 2BS9A 3ABXA 1E0TA 3L21A 2I7GA 5G4HC 3KVLA 1UIOA 2RDUA 3VABA 3S9YA 2PF0A 1DE6A 2ASHA 4GGHA 3T2PA 1KFWA 3ZT5A 4IH3A 9RUBA 4X2PA 3SW6A 1EA0A 4DELA 3AYSA 2EKGA 1NFBA 2EAWA 3F4DA 4IIDA 1LRTA 1DJXA 5FL0A 4Z2KA 1UIPA 2Z7GA 4TV6A 3D3FA 4GXWA 5IXEA 3UJFA 5L9FA 3RPDA 5HOSA 4ZQNA 3WNKA 2V68A 3UWWA 4IPIA 2GQ8A 1E1CA 2YDRA 3L65A 5CLTA 6XIAA 1GOIA 3E2SA 1HJWA 1E71M 1AFSA 4L4MA 3II1A 4U3CA 1TUFA 4JFUA 4CN4A 2J8GA 4I5UA 3ZS4A 1VYRA 3KVMA 1VYSX 4Q33A 4BCEA 1IWPA 2GZXA 1GTHA 4G6CA 2WZIA 1KC7A 4ZMGA 2VNCA 3NO1A 4LGXA 4GI9A 1R87A 1T5AA 3PPCA 4MWAB 2HROA 1OJXA 1VH7A 3WLTA 3WQ5A 1F8MA 2CLIA 1MEIA 1QRQA 1P7TA 5CKSA 2PLJA 1M7XA 5FSDC 1KD0A 3YPIA 3WD2A 7XIMA 2TMDA 4PUMA 1ME9A 3TCSA 2ZRUA 1Q7MA 4NU7A 4HNTA 1WUEA 6XIMA 1GZJA 3U4AA 4C6NA 3EX1A 4HCDA 3G3MA 4EKJA 2ISDA 4OT7A 4JTRA 2INEA 4Q3MA 2FTWA 3SGGA 3PUDA 1POKA 3EDKA 4OFCA 4Q4MA 3AMCA 1G4SA 4AG0A 2WC7A 3FA4A 1A80A 2R1NA 1GVOA 2DZVA 2ALDA 2W91A 1VQTA 1TA3A 3AIWA 2HK0A 2AKZA 2RAGA 2ZVRA 2ISSA 3STGA 3PVFA 2F7FA 5BXRA 2C13A 3QQWA 4ICMA 4D8LA 2GK1A 1GWJA 1UWUA 3EOOA 3R6IA 5FF7A 1VEPA 1BXCA 2GQ9A 2WVTA 3ATYA 2J74A 3GYCA 1EP2A 4GH3A 3CBWA 3BLOA 3WK3A 3PNUA 2WMFA 4WZHA 3PJXA 3UGRA 5C9ZA 2E9MA 3GNDA 4RE4A 1CLKA 4RNIA 1V0MA 4E4FA 2ESCA 4A3YA 1R9YA 1RVGA 1B4KA 5JIWA 5CCZA 1OCJA 4RK8A 3L4VA 4UTIA 4JTHA 2FZBA 4NZCA 3USBA 4JOMA 3DGRA 3CUHA 2TYSA 3BAXA 2J13A 2QDDA 1X39A 3THDA 1GQKA 2J47A 3GW3A 5HUOA 3O06A 4DXXA 1HO1A 3QGAC 3A23A 4UTWA 4IQLA 3PUEA 4K68A 1HNYA 1KLYA 3M0KA 5I3IA 5CQ1A 5T9BG 2A21A 4YVXA 1GVRA 3ZFHA 5H6HA 3CMFA 2PWVA 2ZICA 3V5CA 2FDMA 1FHVA 3OVRA 4DUXA 1SJDA 3W6YA 4Q4SA 2WVVA 3DDMA 1V03A 1BQGA 2YIHA 4KT2A 2W66A 2PA6A 3B8SA 3NPVA 2QCLA 3HG5A 3WF3A 1IT8A 4HMCA 4MWAA 1ITUA 2H3BA 3WDRA 5U4NA 3PTKA 4DM2A 4E8DA 1EEPA 3W7IA 4YMZA 4ZFMA 3EDDA 2RJHA 1BVNP 1XQKA 4UFHA 4PSPA 4AXNA 1ODZA 4PN2A 3ARYA 1I0DA 2OJPA 4U4MA 5BU6A 4ZQOA 2QCNA 1UKQA 4AMAA 1CNVA 2PGFA 3POHA 4UR8A 3WH7A 2NW0A 4M1BA 1RR2A 1GVSA 2BY1A 5AZ1A 2QGHA 4WOZA 5A95A 1L2UA 3LLFA 1GONA 1JFXA 1DL3A 1XRSA 3L2MA 2OR2A 3LMYA 1Q4NX 3H23A 1NM9A 2D1ZA 1L9WA 3F2BA 1OYBA 1UYQA 2G50A 3H6OA 3IUDA 2E09A 4DZ5A 4A8LA 2PTWA 4M1RA 4NXSA 1CXKA 4RCXA 3BZGA 1YXYA 6ALDA 4QLLA 1TX0A 1E72M 1KRCC 4Q4RA 4NKCA 3VGEA 1AL7A 4DQWA 3WDIA 4J7RA 1V6UA 4LB4A 2Z2BA 3DKLA 3L4WA 3BLFA 1IQ8A 3V0UA 3W28A 5C54A 1EFZA 3FEMA 2WMHA 3WLSA 2WBGA 1PIFA 3WFZA 4O0KA 2X16A 4GYKA 2G95A 1QW8A 4XSMA 5F2MA 5LNVA 1R38A 2BXYA 1R85A 4AHQA 4I90A 4JCLA 4UFKA 3OA3A 1XP3A 2PWEA 3DOPA 4AEEA 4KESA 4LALA 3AWNA 3QVQA 3PAOA 4W8BA 1H7NA 2PFHA 2ZQ0A 3QKEA 4GX8A 2W27A 3BCJA 5HWMA 2EJ1A 5C2GA 3I3BA 3B0YA 3K8MA 4H2CA 5D2TA 3LENA 1E6RA 1AH3A 1PUDA 2XDFA 5LA0A 5KETA 1C9WA 4ERGA 3ES8A 3MUCA 5EY5A 3SQSA 1EKOA 1X98A 3GTFA 1GOKA 2P0IA 2CERA 4BHYA 1X1NA 1RD6A 1Q8AA 1E56A 3DX5A 3WO8A 2BXVA 1KR0A 4RDWA 4JQAA 3VNYA 4QSHA 3STFA 3T8LA 3WJYA 3O6DA 4KEMA 2Q71A 4XBJA 4GY0A 3IJ7A 1F6YA 3M0ZA 4AH7A 3CQIA 3A12A 3VA8A 3V36A 5C9WA 4B2DD 1OEPA 3N9RA 1A3WA 2WSQA 4I7UA 5EU9A 2OLHA 5CSYA 2AAAA 2EPMX 1FWCC 1AA1B 1E0WA 3SCOA 3W00A 3QY8A 4JYDA 4D72A 1EJSC 1JUEA 3PUOA 3N2XA 4Z2LA 4XTDA 2R1LA 3AMDA 1EA9C 1S5VA 3BE7A 5E1QA 3G22A 3QYSA 3DFTA 1Q85A 1FWTA 3PSVA 3W2KA 5PTDA 2D2HA 1H51A 4XAGA 4ZE5A 3T42A 4J3XA 1XH1A 4WXZA 5I3HA 4H7ZA 3KM8A 4ERIA 1OQFA 1FOBA 3H2NA 4Y7EA 1JD9A 2Z00A 1P5BA 4CNNA 1EYEA 4M24A 3FAXA 3MZNA 1CGUA 4BQ3A 5HMEA 3GHSA 1UC5A 1XCFA 4DBSA 2BGSA 4QNEA 4U3AA 3URAA 1RA5A 2FKPA 3UWEA 2EPNA 3S2MA 2O9OA 1HGWA 4DXVA 3HGRA 3W9ZA 3FHAA 3VOIA 3S5OA 2R1KA 2A0NA 1TWWA 3PWIA 4W8LA 4F66A 3LS9A 3QHNA 3ZLGA 2CLOA 2PPGA 2VC6A 1EXBA 4ACZA 5AZ0A 4C65A 2NV2A 1ZNNA 3AICA 1AMYA 3ZR5A 3MDWA 1TPDA 3M0XA 4UMCA 4CD5A 4XZBA 4HP5A 1EDGA 4A8NA 2IKJA 3WNNA 5SWUA 3WKZA 4O57A 3ZSTA 3WLIA 3CNYA 3F4VA 3AU6A 4DLFA 2VD9A 3BCFA 4JTCA 4XBSA 2V5JA 1LP6A 4MDPA 3OO2A 4DI9A 4FEZA 3ZJ7A 5D03A 1LWHA 1K7XA 1Y65A 1PSCA 3T05A 1DBTA 1C8YA 3MUXA 4HPNA 2FVMA 2PRMA 3GIQA 3VE9A 3AWOA 3GXNA 3LD5A 1T6MA 2YCEA 4GIYA 2I5GA 1JCYA 1Q6LA 3UY7A 1NOFA 3G8RA 4G7FA 1V7YA 3DFQA 5D38A 3CAVA 1QAPA 3W70A 2J75A 2CFFA 1HT6A 2F6KA 5J5RA 2J8FA 3W72A 1V6YA 3K30A 2PDXA 2C79A 1ICPA 4DYJA 4N6FA 3NL5A 1F61A 3IJIA 1HFBA 3OLEA 2FTPA 4RZ5A 1K03A 2WCSA 3ZO9A 3NQGA 2OGJA 2P1FA 3B9EA 2PTYA 1T0OA 1ENUA 3VIHA 4K1WA 2ZUWA 1XR2A 1JPHA 3IJLA 2ZRYA 2QJMA 3MU7A 1REQA 4I9AA 2H9AB 4HHMA 1WKEA 2GDVA 3EMQA 5EKYA 1LLOA 2BHZA 3PF3A 4JCMA 3VKJA 2BV9A 1ISWA 1PTGA 4JIHA 4F0LA 3DHDA 2XVPA 4O4WA 2X1IA 3BV4A 4QR6A 2VP8A 4O54A 3CEUA 1NU5A 5T26A 4PA8A 3S5YA 4R27A 4TMCA 2XSAA 2HPMA 5E9AA 1E4IA 4GIRA 3V0TA 3KW3A 1UCWA 2IXUA 4KPLA 4RUBA 3WUEA 2CZ5A 2QYGA 2NQ5A 1K9TA 1U33A 2JFEX 3IRDA 3KXQA 1RBAA 3W3OA 4KCWA 4WKAA 1SQ7A 3ZT7A 4FR1A 3IJDA 1YTEA 3NZRA 4Y2WA 3FA5A 4PRWA 1LRNA 1MUMA 1R86A 3W22A 3ABOA 3TSBA 4JQ4A 3B8IA 2FMOA 4PMRA 4QRNA 3C2RA 4TVCA 2CPUA 3ARRA 4JHMA 4KGLA 4K1GA 1JGIA 5XIAA 3RJYA 3TN4A 3SRFA 1XKJA 1EQCA 1OFOA 3W23A 3JZUA 4LV9A 1UD3A 4PTVA 1XSIA 5KZDA 3VUSA 5I24A 1PEZA 3GVQA 3EWYA 4RKAA 1KQZA 2P3EA 4JHOA 1YPIA 1V0KA 1BWKA