2A3HA

Cellobiose complex of the endoglucanase cel5a from bacillus agaradherans at 2.0 a resolution
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Structure of the Bacillus agaradherans family 5 endoglucanase at 1.6 A and its cellobiose complex at 2.0 A resolution
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Endoglucanase
total genus 117
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2a3hA00
1NP2A 2PBGA 2D3LA 1Y7VA 4PRWA 1WDPA 1GOKA 2VX6A 5DFAA 1BYAA 1OD0A 1JL8A 2CBUA 2BV9A 4B3KA 5ABHA 4ZXLA 5BCAA 1KFWA 2GVYA 4X9YA 2J4GA 3U5UA 1HF6A 4AIEA 4W8AA 4PMZA 3F5KA 3EMZA 2HVMA 2DH3A 4LYPA 1W1TA 2TAAA 3WL1A 1FA2A 1WZKA 2PBOA 3W27A 4UOZA 1TUXA 4IISA 1J01A 3WEOA 2J47A 1E40A 4HU8A 4JCMA 4M82A 1JXJA 1H0GA 2UY5A 4ZENA 3LPOA 2VVNA 3T08A 3VD3A 3AHYA 1WDQA 5LA1A 1W3KA 2VQTA 1B1YA 4PUDA 2E8ZA 2GDUA 1K9DA 1KWGA 5E0FA 1DWIM 5DEZA 3VDCA 3VD9A 2FH8A 2ZUVA 3W4RA 3BAJA 2XYLA 1C90A 3AIBA 1O7AA 3THCA 4J28A 5CZKA 3GXMA 2A3BA 4TVUA 4DM2A 2XWDA 5IXEA 1UUQA 1E4LA 1UR1A 4X0VA 3T0DA 1UKOA 4D72A 4KH2A 5BRPA 1PAMA 5FIPA 1ISZA 2BY0A 3O9NA 3VGEA 1V3IA 1OIFA 2YJQA 3BAIA 4YPJA 3LPFA 3AS2A 1MFVA 3QGVA 3F4VA 4MB1A 5CQ1A 4MNMA 3WH6A 1V3MA 1GJUA 5GNXA 5ABFB 3S6TA 4ZE5A 2VZOA 2ZUSA 3VIFA 3WF3A 4AXNA 2XVKA 4D6CA 3N18A 3AMLA 2PC8A 1J0IA 1QNPA 4QLKA 4H04A 3AICA 3WH8A 4AYSA 4BQ5A 1MFUA 1Z32X 3VKKA 2OSWA 5A8QA 5A8OA 1B30A 5HDRA 3MUIA 4D1IA 3KL5A 3D5HA 1E0VA 2CBJA 3QOMA 3JUGA 5BYWA 3BC9A 3WN6A 4E8DA 2BXYA 3WH7A 4L4PA 4XZWA 4F9JA 1KXHA 4DWSB 2VZVA 4PTMA 4RE4A 1O6IA 4H7VA 1JYWA 1ZU8A 4PMQA 1UWRA 4AZHA 1EDQA 3RM8A 3CZ8A 2VURA 2OWCA 1LF1A 3BAYA 1E3XA 1Q6EA 2WVSA 4HMDA 1BG9A 1GQIA 3ARXA 4H8UA 5A69A 3F5LA 4URIA 3ZR6A 2PB1A 3BMWA 1ITCA 1CBGA 1OD8A 1G0CA 4GXPA 1FFRA 2YDRA 2Y2WA 3ARPA 2VX7A 1EHAA 1ZBWA 4P8WA 1V6UA 1WZLA 3CHDA 2Y5EA 1MW1A 4OKDA 3QHOA 5AC5A 1HKJA 9CGTA 5HXMA 4IUGA 4U3AA 4UFHA 1BVZA 5D8WA 2DGAA 1CXLA 4DWSD 2F8QA 1XRVA 1C93A 1QBBA 1JDDA 3WBAA 2J77A 1F4AA 1CXHA 5FCZA 4Q7NA 1WAWA 5HPOA 4V2XA 1OGBA 4UCFA 4AY1A 1WZMA 1UZ4A 3WMSA 3GYCA 1NWRA 4D6DA 3IAPA 1ZJAA 3VGGA 2VR4A 1XHGA 1GOQA 1OBAA 1V02A 1XSIA 4HPHA 4MPKA 2V5DA 3NSNA 3T2QA 1C8QA 2W62A 3N1AA 1BTCA 3VIGA 1JIBA 4W8LA 3WF4A 1K6AA 1JXKA 3OZPA 1KGXA 3A3HA 1Q6DA 4BCEA 3W28A 5BROA 1G9HA 3MU7A 3MKKA 1NWSA 3VMPA 1GPFA 4W7WA 3TA9A 1FHDA 1ZJBA 3IANA 3KZSA 4K68A 3QHNA 1PX8A 4B16A 1UD8A 4UNIA 1KR0A 2ZICA 4QAWA 1QNOA 1GOMA 3VIPA 4NSBA 5EFDA 3WUBA 4GI9A 1QI5A 2E4TA 1QW9A 1W9PA 2VRKA 1JG9A 3NJ3A 1B9ZA 2A3EA 4V27A 4CN4A 3AMKA 3BLPX 4P7RA 1UWUA 3VGDA 4A3HA 3I3BA 1VJSA 3CZEA 1US3A 3WDPP 3U7VA 5ABFA 4F79A 4J3UA 2VX4A 1E4MM 3IJ8A 4D6EA 3WNOA 1J0KA 4LYRA 3ZSSA 1DWGM 1QHZA 3PBGA 4R5EA 1ZL1A 1HVQA 2J7EA 2E0PA 3ZR5A 1QPKA 3UESA 2UY4A 1EDTA 2J62A 1UH4A 5IHSA 3WL0A 1WNOA 1CLXA 1Q4NX 3VM7A 3RILA 3W37A 3WNNA 1L8NA 1SR0A 1G94A 1W1VA 3RJYA 4A3YA 3WQ6A 4NZCA 3I3EA 1K9TA 3T09A 3VMNA 5M03A 1FH7A 3PZNA 2VZUA 4DWSA 4BF7A 2X0YA 4BQ3A 1H09A 4EK7A 3WD2A 2W91A 1DWAM 1EO5A 3OB8A 1RP9A 5A95A 1TZ7A 3VDAA 2JE8A 3WKZA 3WNKA 2VO5A 2VOTA 3LPGA 2ZXBA 3WUGA 2VL4A 3PZUA 1AQMA 3L4UA 1HJSA 2X2YA 8CGTA 4HZ6A 3PZTA 2GUYA 2V3GA 4OIFA 1CTNA 2WLYA 4Y7EA 4TTGA 1UD5A 2J75A 2XG9A 4B15A 1CXFA 1B3XA 3OGRA 4C7FA 1KCLA 1H1NA 5EFFA 4CU6A 3OLDA 2IXVA 5CPTA 4J3TA 5A1AA 2D22A 3WFZA 4PTXA 1E6PA 1PX4A 2JALA 1JNEA 1C8XA 1KXTA 4MADA 5FD0A 4U31A 2XFRA 1UWSA 3TONA 4CD7A 2J25A 1QHOA 3L4TA 4W93A 1CZ1A 3WQ5A 2ZIDA 1OB0A 5A94A 1U2YA 3UR7A 3SCVA 2EPOA 3OG2A 3WBEA 2W5FA 4KGJA 5BXPA 3PTMA 4B9ZA 3MUZ1 4MNJA 4TXEA 1R8LA 2VCCA 1A3HA 1E9LA 3WDJA 2WM0A 1BPLB 2PF0A 2OSXA 3AHXA 2WHKA 4AZCB 1FFQA 3CUGA 1JD7A 4QCEA 1NP0A 1LWJA 2QMJA 3A4AA 3AISA 2Y8KA 3L2LA 4GI8A 5CG0A 2J7BA 1OCQA 1CXIA 1XCXA 5GQBA 4D71A 7A3HA 1JDAA 1GVYA 3AMCA 5JIWA 4WK9A 3W24A 4GKLA 3GDBA 1JZ5A 3GNPA 5A2BA 3I3DA 5IDIA 3PN8A 3QOKA 1JZ4A 1MWOA 5CSUA 3MSGA 3AQUA 2WMHA 3VIOA 3QR3A 4GZJA 3VNYA 5HBFA 4HTYA 6CGTA 2XVPA 1V0NA 1W2PA 3U57A 1HJWA 2OLHA 1GNXA 3AMGA 1DEDA 3MS8A 3RDKA 2WVVB 4WLCA 1BG4A 2WBKA 2YBUA 1Q6CA 1V3KA 4J3XA 2VI0A 2XUCA 4A4AA 1R7OA 1UWIA 3PHAA 4JL2A 1HT6A 1TVNA 3AHZA 4UOJA 2DQXA 3ZJ8A 5CPQA 4JFVA 3PTKA 4M56A 5A6AA 3K4AA 5BRQA 4JKLA 4PMYA 3NSMA 4Z2GA 1K9EA 4U2ZA 1KB3A 5I23A 1K9FA 1DTUA 4WF7A 4MNLA 3POCA 4YN5A 3K8MA 1N82A 1WDSA 3TTQA 2YL8A 1W9VA 3AIVA 2CEQA 3SUWA 2VCAA 4B3LA 1GUVA 3MUY1 1W3LA 3IJ7A 2WVUA 1ZBCA 1CNVA 1UQZA 1UHVA 1FHLA 3UCQA 1M03A 2CHNA 2NT0A 1JF6A 3ALFA 1UQYA 4UFKA 4AD0A 3BH4A 1W3HA 1NARA 2BY3A 1E55A 5CGTA 2WAGA 1X1NA 2VTFA 2D23A 3KWXA 3VNZA 2DSKA 4WSKA 1QBAA 2J8FA 3WF1A 5BXTA 4JFSA 1XSKA 2J79A 3AIRA 3ZIZA 3ZJ6A 4ACYA 3BGAA 1EQCA 1E6QM 1UH2A 3RJXA 1W1YA 2JIEA 1PX3A 1GCYA 3PZIA 4CUCA 1W91A 2JIWA 2VQUA 3SUTA 3KL0A 3WY1A 4TX8A 2X1IA 1B3WA 2WNWA 2VRJA 2YDQA 7TAAA 3NDYA 3OLIA 3BSGA 4W8BA 4KGLA 1QHPA 3ZSTA 2BY1A 1UH3A 3L4XA 1C91A 2ZXDA 3VIHA 3M07A 2VUYA 1XH0A 1EGZA 2WB5A 3CUJA 4PMUA 4AD5A 3CBWA 1J9YA 1V6YA 1WKYA 4TUFA 2BHZA 3W26A 1QW8A 3T2PA 4JFTA 3VGFA 2YLLA 4FF5A 1UWTA 4AZCA 1LQ0A 1JFXA 2XVGA 2ZXAA 3IAQA 4YHEA 2YKKA 1CYGA 1TA3B 4GINA 5C8BB 5A6MA 3TTYA 1ZBKA 2G41A 2WWCA 5DT7A 1CGTA 2WMFA 1J0ZA 1KCKA 2WC4A 3RMEA 1NH6A 3GBDA 4D1JA 1KBBA 3WNMA 4MJ4A 1CGUA 3RO8A 1HP4A 2E3ZA 1CGXA 5AYBA 1JYVA 3FHQA 3GTNA 2J7GA 4W5UA 3VTRA 4MDPA 4XUYA 1JD9A 3WSUA 1G1YA 3W53A 2WZIA 4GZIA 4CCEA 2GK1B 4W7VA 2WVVA 2DH2A 2G3JA 4PYSA 2BXZA 3D3AA 1AQHA 3VOCA 1D2KA 3POHA 2D0HA 1V02E 1V0MA 1QNRA 4AIUA 2WMIA 2Y4SA 3WH5A 4GQRA 3VU2A 3BAWA 4M24A 5AY7A 4P8VA 1IV8A 4TTUA 1CIUA 3VD7A 4H8HA 3CZGA 5BXRA 3N15A 2VT0A 7CGTA 3M46A 1DHKA 3W0KA 3S2CA 4ZXOA 2OWXA 4CN1A 2WANA 1UZ1A 2DSVA 4JIEA 3OZOA 3AFBA 2FGZA 3QHMA 3GZAA 3SUSA 2WHMA 4BQ4A 4TX6A 3PZMA 1VFUA 3IK2A 2Z1SA 4LGXA 3ARRA 2C8NA 4XX6A 2BS9A 2G4FA 2GJXB 1MW2A 4CCDA 1W2VA 3VD5A 2QV4A 3CUIA 1ZBVA 4MAVA 5IHRA 5JBFA 3WFLA 3EDEA 3PZVA 1H49A 2PWDA 1NWUA 3VGBA 3BMVA 2DIJA 3WNPA 3CH9A 4QP0A 4H8VA 1PIFA 1NOFA 3KE0A 1J0JA 4U3CA 4Q22A 4UFLA 1ZS2A 5DT5A 2WC7A 2Q8XA 4PTWA 2E8YA 1W9UA 1OM0A 2CITA 4W89A 4F66A 2ZWYA 2VR5A 1CXEA 1CPUA 3AI0A 5A6SA 4TVCA 1WP6A 3ECQA 4U2YA 3EMCA 3MO4A 3VPLA 2WMJA 1JZ3A 1JZ7A 1NOUA 2JEQA 4IM4A 2DT2A 1RH9A 3TP4A 2WPGA 2V5CA 4Z2KA 3VMOA 1C7TA 4F9DA 3ARZA 2OWWA 3HJEA 1E73M 5FKYA 4RE2A 2XVLA 1VAHA 2O9PA 5C70A 4N42A 4PMNA 2XPKA 5E6YA 3DYOA 5CLTA 1CECA 2YA1A 1EA9C 1EOMA 2D3NA 4UQ9A 3B9EA 2DT3A 1LL4A 3NCOA 2XIBA 5D8ZA 4BA0A 5ABEA 3AIUA 5AYIA 1NWTA 3VIKA 3OGVA 1MXDA 4PMRA 1QVBA 1M01A 1VB9A 1XYZA 1LG1A 4DUVA 4AMCA 1I75A 4EKJA 2VC9A 3OLEA 1OT1A 4AZBA 1DWHM 5GPRA 4R27A 4U5IA 3EBVA 1WDRA 2WBGA 2PWGA 1C92A 1GZJA 3K4DA 5C71A 1PZ2A 4JAWA 5CXPA 1TA3A 4CN6A 2W66A 3VX1A 4IPLA 1E5JA 5DO8A 3SCWA 2IXUA 1IZKA 2EQDA 3CGTA 1E72M 1UR0A 3CHEA 4MB3A 4KMQA 3GNOA 3AMDA 1Q6GA 4MJ2A 5D4YA 2WSPA 4U33A 3VIIA 3II1A 4PMDA 5A6LA 3DYPA 1CEOA 2O92A 3DHUA 4NRRA 1OIMA 4C7GA 1RD6A 4UQBA 3GXFA 4AD2A 3BAXA 2WCSA 3FNDA 3MV01 2WKGA 2E9BA 4WKHA 1E1EA 3WNLA 3A4WA 2WVTA 3BSHA 6TAAA 1D7FA 5HPCA 4E4PA 2BY2A 4FLRA 5HOSA 2YDSA 3GH7A 1BAGA 4CD6A 2EPKX 3AYRA 2GSJA 1E15A 2EPNA 3EDKA 3WQ4A 3K1DA 1CGWA 3WMBA 2CIPA 1UR8A 3WEMA 3ARSA 4HU0A 2DSWA 3BCDA 1KXQA 4M8UA 1J18A 1XSJA 3AROA 1J12A 3WIJA 3VGHA 3SCPA 2O9OA 3AJ7A 4NI3A 2VNCA 4Z2HA 3DECA 3MMWA 1U33A 4JFUA 2CPUA 3ARWA 5A8MA 1EHNA 2CXGA 4QLJA 1VENA 3AIWA 4GIAA 3N9KA 1GQLA 2GJXA 1VRXA 1V6XA 1QNQA 1ISYA 1PIGA 1HX0A 3WDRA 2VZSA 3AHTA 2W63A 3J7HA 5E6ZA 1KWKA 4UZSA 4YHGA 3VDBA 1UG6A 3CO4A 4UFJA 5FOOA 1LWHA 3MMDA 4OUEA 4X0NA 1UD2A 4CVWA 1V0KA 2WC3A 2CYGA 5DF0A 1LLOA 3DHPA 3ARUA 3N11A 4HA1A 1B3YA 3VIMA 1BQCA 5ECUA 2OYLA 2CETA 1VFFA 2EXOA 5A2AA 1OGGA 3AS3A 1A47A 1GOWA 4PMXA 4P8XA 1VEOA 3EDFA 3AHVA 3WDHA 2YBTA 4UR9A 1ECEA 2F2HA 1ESWA 4HZ7A 4J3VA 5E0CA 1SMDA 4PEEA 2J8GA 4F8XA 4AIOA 4M29A 3FXYA 3AS0A 4UQDA 3ARVA 2X8RA 3GNRA 4MDOA 4BZYA 1F4HA 3VINA 4OBSA 5M3WA 1QI0A 1NM9A 1R7AA 1EO7A 4XV0A 3AOFA 4H41A 1HXJA 5HNNA 1B3ZA 4MB4A 3SCNA 3SCSA 3A6OA 4C7DA 3WEZA 1E6XM 3F5JA 3UERA 4NF7A 4CVUA 2HISA 1UYQA 3A4XA 2EBNA 1UA7A 3VIJA 5D9NA 1GVIA 3CZKA 1NOWA 5JBEA 4RE3A 1XH1A 4AZIA 3T0BA 2O9RA 1XD0A 1W9BM 4PMVA 5A6JA 1DWJM 2DEPA 1X6NA 1MQPA 3GH4A 2JFEX 4WIWA 1BHGA 4AWEA 1JFHA 2ZE0A 3ZMRA 4PSRA 1JZ2A 2EPLX 5BWFA 4W88A 1H3GA 1KXVA 1OINA 3VDHA 2D1ZA 3MSDA 2DSUA 4JL1A 1HKMA 4UOQA 5JBDA 2GJRA 1B3VA 5I24A 4LQ1A 2WMGA 2CKSA 3ARQA 4CU7A 1C7SA 3AZTA 3WD1A 3HU7A 4PUEA 3CLWA 1HIZA 4GI6A 4OBRA 1J0HA 1KQYA 4MB5A 3PTQA 1E1FA 2ZUTA 3ZOAA 2GFTA 2W4XA 1OWQA 1SFSA 4ACZB 1FH8A 4E2OA 1PZ3A 3RIKA 5I5RA 1H0IA 1BGGA 3OA5A 1G01A 2XFYA 4AZ7A 1QI2A 2BVDA 4CU8A 3SURA 5D9MA 4UFIA 1ITXA 1C8YA 3ZM8A 1HJVA 3CMJA 5F7UA 3BAKA 1JDCA 2BHYA 4ML4A 3M7SA 4KRUA 2J7CA 2V38A 1GONA 3VVGA 5I77A 3L4WA 5A6BD 1BVNP 3FAXA 1OT2A 1HJQA 3CMGA 1YHTA 3OIHA 5EMYA 3CHFA 4DWSC 2QPUA 4IPNB 2J7FA 5EBAA 4D6HA 5E9AA 1QOXA 4GQQA 4HOWA 2C0HA 2V3DA 4CD5A 3RCNA 4AISA 3CTTA 1TFVA 2ZX7A 1E6NA 3LPPA 5AC4A 1GW1A 2XGBA 4QCFA 3WQ8A 2XGIA 4AD3A 1W1PA 2UY3A 4D6GA 1E6ZA 5A6KA 4J7RA 5CPSA 1VIWA 3NIYA 1R87A 1V3LA 1B31A 3FW6A 4RL3A 2CKRA 2WZEA 3AIQA 3A47A 5EB8A 5I78A 1WZAA 2YLAA 1UD6A 1VEMA 4AW7A 1V08A 1JZ6A 1QNSA 4LX4A 3WF2A 2CESA 2CNCA 5CSYA 4Z2JA 1UKPA 4MAZA 4J3WA 1VFOA 2W61A 4UZUA 1R86A 2A3AA 2XIIA 5A3HA 2QMKA 3CZLA 4KRTA 1JF5A 5LA2A 4WKFA 3CZJA 3WH9A 3WF0A 3AYSA 4CGTA 1XD1A 2QHAA 1HJXA 1YQ2A 2ZX5A 3L4ZA 1FP8A 1HJUA 1H4PA 2AAAA 1WO2A 1E0XA 3PZ9A 4U5KA 3UG4A 1I1XA 1CGVA 2WMKA 2ZUMA 3B8SA 4W85A 4AD1A 4Z2IA 4FMVA 1E71M 3M6DA 1TMQA 4JFWA 1B0IA 5ABGA 1B90A 3MMUA 1V0LA 4PSPA 4JHOA 1BYBA 3UG5A 2UWFA 4JCLA 4D6FA 2JF6A 4OJYA 1TG7A 1SMAA 1BFNA 3ZJKA 1AQ0A 4WKAA 5DMYA 2VMFA 4H2CA 1E6SM 1JI2A 5A6BA 2ZWZA 1OGSA 1BLIA 5M17A 3RM9A 2FHFA 3AZSA 4ATWA 5GNZA 2WXDM 1CLVA 2UY2A 4HOXA 2WCAA 1CENA 1WE5A 4J27A 3W82A 5IFTA 5M5DA 1P6WA 4PCSA 2G3IA 4E8CA 2IUZA 1H41A 3UETA 1UOKA 1J11A 4DUWA 4FLSA 3SCOA 1XGZA 3OGSA 2CERA 2GDVA 4ACZA 2FHBA 4CD8A 2CBIA 2O9TA 2AMGA 1E4IA 4P7NA 1FP9A 4TVDA 4GO9A 3G6MA 1EOKA 4W5ZA 3L4YA 2XFFA 5KEZA 1DWFM 1VEPA 4ZEPA 4W84A 2VVSA 1ZB5A 1X6LA 3DYMA 3GXDA 3MV11 3UEQA 5I2UA 5JIPA 3O6AA 8A3HA 1HNYA 3PZQA 2WZHA 2ESCA 3B9AA 5CLWA 2MANA 1MYRA 4JZ5A 4ZFMA 1V6VA 1HN1A 4ATDA 3B9DA 4OZOA 1US2A 4WJXA 3UG3A 4MTVA 4M80A 4WSJA 4XB3A 2VX5A 4M1RA 3CUFA 1B2YA 2XSAA 1LJYA 3KL3A 1J0YA 1KR1A 2OYKA 2EEXA 3T2OA 4FK9A 3L4VA 1R85A 1PBGA 2J7HA 2E40A 1E70M 4P7LA 1CXKA 3AXIA 4AD4A 4P8UA 3HN3A 3CUHA 1GOIA 2XWEA 3ARTA 2D2OA 3CIVA 2DDXA 4P7OA 1W9DM 5FL1A 3W25A 1XV8A 1BGAA 2J78A 3SEPA 4PCTA 3L2MA 3DC0A 4DM1A 1ISVA 4W7UA 1E5NA 1EQPA 1RP8A 1UKTA 3W29A 4D6JA 2XM2A 2Z1KA 4TOQA 4AZGA 2JF7A 4EANA 4UQEA 1G5AA 4N0RA 5A2CA 4LPCA 3AS1A 4GPNA 1W32A 4XZBA 1JNDA 3EYPA 3BXWA 3GXIA 4AEEA 2WK2A 4LXFA 3SUVA 2J74A 1H11A 1VFMA 2WLZA 5A8NA 2PWFA 1BF2A 2X05A 4PMOA 3WD3A 4AEFA 4AZ6A 1E6RA 4QLLA 3NYDA 3PZOA 2Y24A 3EDDA 3EMQA 1LL7A 1MQRA 1M04A 2WWDA 1VBRA 4OOUA 1QI4A 5GNYA 4GZEA 1XH2A 1DP0A 2YOCA 4J3SA 4Z2LA 1I1WA 1D3CA 1JZ8A 1OSEA 3W6MA 1MW0A 2ZX6A 3ZT5A 2J7DA 1WPCA 3KEHA 4UQAA 2PI6A 4HPGA 2DT1A 3N12A 2XM1A 1JGIA 4P7QA 1HVXA 1EXPA 3FHAA 2ZUWA 1PPIA 3VILA 3K8LA 3VO0A 2YL5A 2WHJA 2YL6A 1FH9A 1KGWA 1EIBA 1M7XA 3WUFA 1HL9A 4CD4A 4KWUA 2VJXA 4B9YA 1TE1A 3VX0A 3SCRA 1GHSA 5I3DA 2YA0A 1JAEA 2GK1A 3N04A 3THDA 2BVYA 3SUUA 3LMYA 1W9XA 5D9PA 3NSXA 4UQCA 3WD4A 2D0FA 1PJ9A 5KZ6A 1GQJA 2G3NA 3N17A 2PWHA 2C7FA 4UTFA 3WENA 3AXHA 2CBVA 3AIEA 2G8ZA 1CGYA 2CHOA 1UA3A 5FL0A 1LL6A 1U30A 4BS0A 2FGLA 3AXXA 2NW0A 4FLOA 4QFUA 6A3HA 1ISWA 1MQQA 1EDGA 1MW3A 3ZO9A 1ODUA 2DSZA 3WD0A 2E9MA 3ZJ7A 3HMCA 1C3FA 1UR9A 1TCMA 3T0AA 4NRSA 2RGMA 3G6LA 2YIHA 1L0PA 4S3KA 4PN2A 2WW5A 1UD3A 1KQZA 1GOOA 2XJ7A 1XYFA 4CCCA 4JKKA 4JHZA 4DUXA 2ZX8A 2PWEA 3VD4A 4W86A 1VBUA 3PZGA 1HP5A 1H2JA 2QLYA 1JYNA 1RPKA 1VF8A 5IFPA 2FHCA 4CKQA 2XHYA 1IT0A 3O2LA 1E0WA 2E9LA 4HP5A 3SIMA 3IJ9A 2VRQA 4V28A 3SCTA 1CWYA 3N13A 3GH5A 1GORA 1UKSA 3K46A 3W38A 1WB0A 4LYQA 1UWQA 3U7BA 4BQ2A 1MVYA 2VCBA 1E4NA 3TOPA 1H5VA 1V3HA 3NUKA 4ZE4A 1NQ6A 1E43A 1UKQA 5CJ5A 3W6LA 1UR4A 3UR8A 3MUAA 1HL8A 3WDQA 4HOZA 2BFGA 2WCGA 3U5YA 2ZOXA 2A3HA 3WELA 3FY1A 2NSXA 2X09A 3ZT6A 1GQKA 4UFMA 1XCWA 1ODZA 2ZUUA 3GBEA 1M53A 4D6IA 4M81A 2FDMA 2DIEA 2F61A 4QDMA 3WUEA 5CGMA 1JYXA 2W92A 1GHRA 3ZT7A 1AMYA 3E1F1 4ATLA 3EDJA 2EO7A 3WDIA 3W81A 3RM4A 2FH6A 2V3FA 1IZJA 3RPMA 3OLGA 2BVTA 5E70A 2YA2A 1KGUA 3WMCA 4PTVA 1S46A 1CDGA 2G3MA 4HA4A 2QF8A 4AC1X 2XTKA 4HZ8A 2WKLA 2OYMA 1J10A 2DPEA 4S3JA 4HMEA 3APGA 4HA3A 2OSYA 2ZUNA 1MXGA 3FAWA 3ZQ9A 2D0GA 5E09A 2ZX9A 5I0DA 4JKMA 3BCFA 5I6SA 3SCQA 5D9OA 1BYDA 2Y8VA 5JUVA 2XSBA 1E56A 2NT1A 2RGLA 2DT0A 3MANA 3CPUA 4PBGA 2BNJA 1BSIA 4FLQA 3SCUA 3ARYA 1HKKA 3ALGA 4HMCA 1WCGA 1XC6A 2B31A 4OOZA 1KBKA 2JEPA 1V3JA 2QPSA 1VJZA 3WQWA 2V3EA 4W87A 4AZ5A 2WMIB 5LA0A 5TD4A 3NDZA 4L4OA 4GO8A 2EPMX 1FOBA 1HKIA 5BXSA 3TTOA 5LYRA 1LG2A 2A3CA 2ZXQA 2WYSA 3FN9A 1TVPA 1SYTA 1W3JA 1JI1A 2WSKA 2W67A 1E3ZA 3CHCA 5I79A 1ISXA 1QI3A 1V6WA 2BHUA 4MNKA 3OBAA 3VM5A 2WHLA 2GJPA 1EH9A 2EJ1A 4EAMA 1V03A 2XVNA 1GJWA 4EE9A 2D20A 3BLKA 2AOSA 2X0HA 3VUPA 2YL9A 3K8KA 1BYCA 2D24A 3AZRA 3WQVA 1JAKA 3TTSA 5A8PA 1TR1A 3GM8A 1Q6FA 1UR2A 1AVAA 1PEZA 2CCRA 1UD4A 2VZTA
chains in the Genus database with same CATH superfamily
3PWAA 4LBUA 4FA3A 3UJRA 2PBGA 4I5RA 2VEFA 1OYAA 3LEPA 2VX6A 3DFQA 5DFAA 1BYAA 4HNUA 3MI2A 3UWVA 1QPQA 3VKBA 4ZXLA 1ZY9A 4X9YA 4H9TA 9XIAA 1Z7AA 2ACQA 2VGIA 4AIEA 3KW3A 4W8AA 5K4XA 3KRUA 4Q8VA 1W56A 3MBFA 2OZ3A 3OPSA 1TUXA 3AXKA 4ZZ9A 3QMRA 3NQDA 3W87A 2D2JA 3IRDA 3GUWA 4NU7A 2UY5A 4ZENA 2VVNA 4HA0A 3T08A 1AQFA 5LA1A 2E8ZA 1TPB1 1KWGA 1PB0A 4JQ2A 3UZXA 4NXSA 3MTWA 3W4RA 3THCA 4G56A 2GYIA 4J28A 4YTRA 3LSBA 5C2XA 1I0BA 3CB3A 4RDWA 1E4LA 1UR1A 4X0VA 3UXKA 4EXAA 4L6OA 2QEZA 4QTGA 1W37A 2E09A 1RK6A 1PAMA 3O9NA 1V3IA 1OIFA 1YIXA 2ZQ0A 3BL3A 1QO2A 2ABBA 1MFVA 1QTWA 4KQNA 3LGDA 1VP5A 1AW5A 3ERPA 5GNXA 3FA5A 3OU8A 3S2LA 3UGRA 1G7VA 2P5NA 3VIFA 3N18A 4NI8A 3ID7A 3R89A 4J9JA 4QLKA 4H04A 4AYSA 3WH8A 1DKWA 3M0MA 1XQLA 1Z32X 2OZ8A 1OX5A 3CQKA 3VKKA 1R9XA 2P0IA 1TTIA 5HDRA 1XJBA 3MUIA 3UJSA 3NVDA 4DJED 2WZTA 2BXVA 5DXXA 2NUWA 3FYYA 4N9CA 2V63A 3WN6A 4XZWA 4F9JA 1KXHA 4GY1A 4PTMA 1Q65A 3WJSA 1F3XA 4H7VA 1I60A 3USZA 3C0SA 3I6RA 2OWCA 4UTWA 1LOQA 1E3XA 3O06A 3QC0A 4Q8MA 1ZNNA 3RPDA 1Z41A 4O0QA 1BG9A 2PDMA 4NJHA 3HG2A 3K4WA 2FZDA 3F5LA 2HEJA 3G1VA 2PB1A 4JS3A 1FFRA 2RHGA 2YDRA 2V30A 4NHVA 1NF0A 2HXUA 4UTJA 2VX7A 1AW2A 4XZ9A 1UPMB 2EF9A 3BANA 3WLKX 5AC5A 3TFCA 2CW6A 1P43A 1H7NA 5HXMA 4U3AA 1R2TA 2CLPA 4Q4PA 1PIIA 1CXLA 1NY1A 1E51A 4JBRA 2VD8A 4S3AA 1XUUA 4EPBC 1XPYA 4AWUA 5GVJA 2YSWA 2C1GA 1K4GA 3L0NA 4AY1A 2DORA 4FP1A 1UZ4A 3WMSA 3GYCA 1JCMP 1EKOA 3N4AA 3VGGA 2VR4A 1RSCA 3GLCA 2RH9A 4WJ8A 3NSNA 4RW5A 2W62A 1XLBA 4BF5A 4A2SA 4O1AA 3CIXA 1KGXA 3QY7A 2PDWA 1BKSA 1Q6DA 2CWXA 4BCEA 3GQYA 1GG1A 2FZNA 3MU7A 2UV8G 2X30A 2NZLA 4L65A 4LRSA 2XINA 4CNOA 4BI5A 4LY4A 4K68A 1TV4A 4GX8A 1PX8A 8XIAA 4C6CA 5I3FA 1QNOA 3VIPA 4NSBA 1IR1A 1U5JA 5AVHA 2E4TA 2GVGA 3W75A 3FGCB 1JG9A 3DKJA 1UWUA 1SFTA 3U7VA 3M0ZA 3TEVA 3BV4A 4RDZA 1J0KA 3TDFA 2P0OA 4KESA 7ENLA 2J24A 1DWGM 3NURA 1ZL1A 4CQ9A 1IE7C 5F4WA 1N7KA 1VCGA 1TRDA 2AL1A 1WNOA 1QDSA 1V8EA 3RILA 3IIVA 3W37A 3H8AA 1QXLA 4A3YA 4HU3A 4MLJA 3SIZA 2XIOA 4NZCA 1FWDC 1TX0A 1RHCA 5M03A 3SGZA 4DWSA 3OZMA 4XZIA 4BQ3A 4GJJA 4EK7A 2QCDB 3WD2A 2OO6A 1W17A 2FZBA 2W91A 5KZMA 3ZS4A 3WNKA 1EC9A 3NL3A 2ZXBA 1VHCA 4HK6A 3RLGA 3PAJA 3JW7A 1HJSA 3FJNA 4WVXA 1OG0A 2ZTJA 5CPMA 2V3GA 4OIFA 4TTGA 1UD5A 4B15A 4BEUA 2GL5A 4KFNA 4CU6A 1V5XA 5DCDA 1DXFA 3T4WA 4GUIA 4RX0A 3T0TA 3V35A 2C1IA 1I2QA 5C2GA 3UZZA 4MADA 1VLIA 1REQB 1KV8A 1RVKA 5A94A 3SCVA 4DLFA 2PWUA 3R0KA 5F2LA 2GWGA 3PTMA 3T42A 4MNJA 1A3HA 4GE8A 1E9LA 3LBCA 3AHXA 2WHKA 4AZCB 1FFQA 1EJRC 1JD7A 1H7WA 1UBSA 1NP0A 3W1MA 2Y8KA 1P0EA 1XKJA 2HE5A 3L2LA 3RITA 4O16A 4AXKA 4ZQNA 1CXIA 1XCXA 1SO4A 2JKEA 4EWJA 1GVYA 3AMCA 3UG8A 3VKAA 4PRTA 1YNPA 3GDBA 1OK4A 1R5YA 3PN8A 4PL1A 3QOKA 1JZ4A 3VIOA 1LQ2A 5HBFA 1JJKA 6CGTA 1UC5A 3U57A 4NAFB 1GNXA 4UR8A 3RDKA 1OCBA 2WVVB 3ZWSA 2VELA 3UPWA 5FEZA 2WBKA 2YBUA 2XUCA 4A4AA 4ZTXA 4Q4SA 2DQXA 4JFVA 3M44A 3PTKA 5BRQA 4JKLA 3BW3A 5DQPA 3V36A 1V4YA 5I3KA 2PP3A 4YN5A 4JD4A 3R0DA 3TTQA 2YL8A 4BR1A 4DNMA 3L12A 4WEVX 5CC6A 3SUWA 4B3LA 1GUVA 5K2ZA 1W3LA 4AMAA 3E2VA 3UCCA 4O28A 3W01A 1F6YA 2CHNA 1OZMA 4K8GA 4LOCA 3ALFA 1UQYA 2ZA3A 3BARA 4AD0A 3EB4A 2BY3A 4AY7A 2V9DA 4PB3A 4MF4A 3UWYA 1VPXA 2VTFA 5D09A 4ZB2A 2D23A 3DG6A 3KWXA 2J8FA 4JFSA 1XSKA 3AIRA 1E6QM 3SADA 1KCZA 1BRLA 1M68A 1RQHA 4MFEA 1EJTC 4X61A 3TYCA 4R88A 2R24A 3EWCA 1GCYA 1SW7A 1IXPA 4XAZA 2GOUA 3WY1A 3C2OA 1B3WA 4V1YA 5LNWA 3UVAA 5DBTA 1W8SA 1XLGA 4W8BA 4KGLA 2EG8A 1ECQA 3DAQA 2O0TA 2ZXDA 2I14A 2TSYA 4YL2A 3WK1A 1JQVA 1EGZA 1A49A 3CUJA 1H1ZA 3UA4A 4BEQA 4PMUA 3CBWA 1J9YA 1GJPA 3TYBA 4OFCA 2X7WA 4LF2A 3T8LA 4JOMA 3RUBL 4L1GA 3BLEA 4IXXA 1LQ0A 1UMYA 1XDJA 2XVGA 1TJ0A 4YHEA 4O52A 2YKKA 4DY1A 1RALA 3FDGA 1UB3A 5C8BB 4I8DA 2VDGA 1TWWA 4UMCA 3C8FA 2WMFA 1KCKA 3EXSA 3HQOA 3RMEA 3GBDA 3GAKA 3S6OA 1KBBA 3WNMA 1XINA 5JH1A 1R3TA 1WX0A 1CGUA 3GHRA 4HNOA 2I7GA 3GTNA 2J7GA 4HD5A 2CLHA 4GX9A 4W5UA 4MPQA 4MDPA 3DFNA 3CH0A 5DX7A 4ZB5A 3WSUA 1S2WA 4XZHA 4BK9A 4CCEA 1VC4A 2EAWA 4W7VA 3PM6A 4IT1A 2G3JA 4PYSA 3VOCA 1D2KA 2ZZ6A 1IEQA 3PJXA 3Q94A 1QNRA 4ZOAA 5FEPA 3VU2A 4K3ZA 4M24A 1IEXA 4P8VA 3CZGA 2HPIA 3P93A 3WBXA 7CGTA 4B3ZA 4C6IA 3M46A 4DPQA 1TIWA 2OWXA 1NEYA 2DSVA 3NZGA 2Y89A 4JIEA 4ZQMA 3SUSA 3C86A 4BQ4A 4C6PA 3ARRA 4HPJA 2C8NA 1F73A 2E77A 4NILA 1OFOA 1SW3A 4KWSA 3IWPA 5HWJA 3MZ2A 5JBFA 3IGUA 1V6TA 1H49A 4J35A 3N2MA 3CH9A 4H8VA 3QY6A 3QN3A 4Q22A 5FF4A 5CC5A 1OM0A 3H2MA 2ISFA 1CPUA 4YIWA 2VDIA 2GQ3A 3CWHA 1WP6A 1HG3A 4LCRA 4ERGA 4U2YA 3GC5A 3MO4A 1JZ3A 3V0UA 4PH6A 1JZ7A 3FFSA 3KBVA 4IM4A 3NGFA 3IUIA 3MWCA 1KBIA 3U2CA 1X6UA 4Z2KA 3UGVA 3QEZA 3VMOA 4F9DA 3ARZA 2GVJA 1OY0A 1RVGA 3HJEA 1QT1A 4OBTA 4RE2A 3JVAA 3QTPA 1XPGA 4JPGA 3NWRA 3S47A 2QXWA 1A4LA 1CECA 3LM3A 1EOMA 3MHFA 4WY0A 1LL4A 1KV5A 1O68A 3B0XA 2XIBA 5D8ZA 5ABEA 1MXDA 1TSIA 3PPHA 4PCPA 1QVBA 1M01A 5LNUA 1XYZA 1GG0A 2P8BA 1LG1A 3I7SA 3MDWA 4AMCA 3IUDA 4DZAA 2VC9A 4Z1AA 2RJGA 4RJEA 1DWHM 1WDRA 1GZJA 3K4DA 2ZZ4A 3VX1A 2VP8A 2ZDRA 4C6DA 4E3TA 3U2OA 2IW0A 2EQDA 1AODA 4LC8A 1HO4A 3WQFA 4L6DA 1HL2A 2V5BA 5LGZA 4OV4A 3T81A 2ISSA 4M1BA 1CEOA 2O92A 4NRRA 1OIMA 3CQ0A 1RD6A 3WLHA 4CQ8A 3H7VA 3LBMA 4YTTA 2WKGA 4WKHA 3NNTA 3N6HA 5HPCA 3T05A 2BY2A 1O5KA 4EF9A 4OGZA 1SU5A 2GGHA 3HURA 2GSJA 2EGZA 2EPNA 3EDKA 3E5BA 4H2HA 2CIPA 1Y0EA 4QDPA 1UR8A 2R8WA 3WEMA 3NQMA 4Z1BA 2E5CA 2E6YA 1UP3A 3JZUA 4BF9A 4JDBA 3BCDA 4WXZA 3CL6A 3C61A 4M8UA 1XSJA 3RFAA 4EOUA 4JNMA 3HQ1A 2VFFA 3SCPA 2O9OA 3AJ7A 3MMWA 2BOEX 1DPMA 2CPUA 3ARWA 3L5LA 3N9KA 4ZMGA 3TSDA 4JYEA 3W2UA 1V6XA 4H6QA 4UTWC 5E9XA 1XBYA 4FIQA 5LGXA 4Q7IA 2RDUA 1OHLA 4MFDA 3GWQA 4DRSA 1UG6A 4UFJA 1GYLA 1JVNA 1AK5A 1LROA 3GU9A 3R0UA 2PDBA 4CVWA 2ZRWA 5DF0A 3TNOA 1H62A 3U4AA 3PULA 3IGHX 4IX2A 4ZO9A 3TR2A 3W1UA 4NASA 3W7CA 5IDZA 4DI8A 4H3DA 5H91A 1L6FA 5C55A 4DWDA 3RU6A 4K6AA 2ZCGA 4PMXA 1GPWA 2YBTA 4UR9A 3VOHA 1NQKA 5AECA 3BWWA 3L65A 2J8GA 3P5ZA 1H7PA 2QJMA 1I6NA 3AS0A 4R9XA 2X8RA 3V5OA 4MDOA 4BZYA 3QXBA 4RZ6A 3R8GA 5M3WA 1EO7A 4OVXA 3PBVA 2IQ0A 4S2CA 4H41A 3SCNA 2IKHA 2Z7KA 3SCSA 3A6OA 1F07A 1E0TA 3PUDA 3UERA 4Y9AA 2VC5A 4HB7A 4FOJA 3CM4A 2WJFA 2PSNA 1GVIA 1VFSA 1NOWA 3B8WA 5JBEA 3WLQA 1F05A 1DWJM 3NYZA 3AU6A 5FJRA 1JFHA 2ZE0A 3ZMRA 1ZCCA 5JMUA 1PV8A 4I9TA 1MZRA 1KXVA 5FEXA 3BG5A 4Z17A 1OINA 3VDHA 4ZL1A 2D1ZA 1JUBA 4MZYA 2Z1XA 2BLEA 1HW6A 1I0DA 3WD1A 3HU7A 4GISA 2WJZA 1HIZA 4GI6A 1VQTA 4IL2A 3F4DA 3HGSA 2GJNA 4MB5A 5H1WA 1G69A 2ZUTA 2GFTA 2W4XA 1A3XA 1X1OA 1OWQA 2ISVA 1Q6LA 2ALRA 3CB8A 1L9WA 1AZ2A 4ACZB 3N29A 4S2BA 4E2OA 4YCOA 1M6JA 2XFYA 1QI2A 1W5OA 3FA3A 4CU8A 5D9MA 3H53A 5D02A 1C8YA 1HJVA 2ZRYA 1JDCA 3QBUA 4KRUA 5F1UA 4TMCA 3VVGA 4XBKA 5A6BD 3L23A 4L5ZA 3W23A 3W7MA 1HJQA 1J8VA 3OIHA 5EMYA 4HMNA 4LANA 4ZBCA 4DWSC 4F0HA 4AUBA 3B03A 3I6EA 1HZYA 1TPH1 1YPXA 1L6SA 5EBAA 4D6HA 1FHVA 3HPSA 1QOXA 3VDGA 2C0HA 1DYSA 4JNZA 7ODCA 1E6NA 4R3UA 2DZVA 3N34A 5HR7A 2H9AA 1Q7MA 5G1TA 1CB7B 1WOBA 2XGIA 4AD3A 1W1PA 4DAFA 4E5TA 3P5YA 3QGKC 4C5ZA 3N2BA 4JIRA 4P2VA 1V3LA 4TV5A 1B31A 5IOBA 1OG6A 4HSNA 5T9CE 5EB8A 1WZAA 3ZFHA 2Q8LA 4HJFA 1DOSA 1VEMA 1D3HA 3IJLA 1GEQA 4LUJA 3M7WA 5CSYA 4Z2JA 4MAZA 1VFOA 2W61A 3E74A 4XG1A 3R2GA 3I65A 3UWEA 4FNPA 3CAKA 5EPDA 4QAIA 2QMKA 1NJJA 3IEBA 4I6KA 1WKDA 1X7FA 3IGSA 4HBKA 2FJUB 1K1DA 1J6PA 4WKFA 3WF0A 1O94A 3AYSA 4CGTA 4GYPA 2INZA 3IVSA 4GVHA 3SFKA 3KCLA 1GYMA 2Y1HA 3UYIA 1US0A 3CC1A 3H6OA 5CBJA 2YCKX 3BQ6A 3M0XA 4U5KA 3C2FA 1CGVA 3W74A 3ZVIA 2V2CA 4Z2IA 3MJYA 3SM0A 4HCLA 4B5WA 4JFWA 4J5NA 3CU2A 4XZLX 5GJMA 1AL8A 2J9XA 1VJIA 3UZ5A 1JPKA 3P61A 3UY7A 1B57A 5LIKX 2F7FA 1BYBA 3VOGA 1PHQA 2UWFA 1DXEA 3D6NA 2QCHA 2JF6A 2VDHA 1TG7A 1SMAA 1VBGA 1BFNA 5J5RA 1E6SM 3EOSA 3V0SA 4D2JA 3WQCA 3ITLA 1XLLA 1ZENA 4IJRA 3RR4A 4HOXA 2WCAA 3EEZA 3HPAA 3G22A 4GVGA 3T6CA 4PCSA 4E8CA 3V4BA 3U2ZA 1H60A 2NXHA 3QMTA 4GXMA 1J11A 2GGJA 3OTRA 3DGRA 4FLSA 3O8AA 2FLIA 2CERA 1XLCA 2AMGA 1E4IA 4P7NA 2TMDA 5C5YA 4YTQA 1JPIA 4W5ZA 5KEZA 1DWFM 1PKYA 4ZVJA 1PWMA 4XKMA 5AHLA 1Z8AA 2QV5A 3GK0A 1EBHA 1X6LA 3DYMA 3O6YX 3HQNA 4NYUA 4DYEA 4AVNA 3S2MA 2A2IA 3CASA 3MV11 3UEQA 5I2UA 5JIPA 3W7EA 2DZXA 4LC6A 3K5XA 2ESCA 3B9AA 1SSGA 3A24A 5E93A 4A3UA 4JZ5A 4WRHA 3V5FA 5DMNA 4ZFMA 1RJRA 3R43A 4WJXA 4KEMA 3N3MA 3TAKA 3BV7A 2VX5A 4M1RA 2XSAA 3B4YA 1SQ7A 1LJYA 1J0YA 3DX5A 3G0XA 1DJNA 1KFEA 2EEXA 3YPIA 3GNNA 2QUMA 4IIDA 3W6YA 1PBGA 4GVIA 1E70M 3NQEA 3AXIA 3HN3A 4GNJA 2WZMA 4H6KA 3CIWA 3S9ZA 4P7OA 3MC5A 9XIMA 1W9DM 5CZJA 1EFZA 3MDUA 2NVCA 5J8LA 3DC0A 3DCPA 4KT2A 1EQPA 7REQB 3W29A 2Z1KA 3CV7A 3G1DA 4EANA 1KLYA 4OWGA 5A2CA 4E2DA 3HFYA 1W32A 4XZBA 3MKVA 2HVNA 5FA5A 3BXWA 1ZSXA 2PDIA 4AEEA 3W1QA 4LXFA 5A8NA 1ONEA 2PWFA 4PMOA 3NYDA 2Y24A 4B2DD 3EMQA 1LL7A 1GW9A 4A2RA 1L2UA 2WWDA 4R7JA 1R3VA 3KFTA 3GAYA 3OVGA 4INFA 2R1LA 2YOCA 3FYOA 1I1WA 3ABRA 1WXYA 1LLWA 1JZ8A 2VYOA 1H63A 1FBAA 3U6WA 4N9BA 4DZHA 3ZVHB 4GFIA 4B5VA 4ADTA 4LUTA 1JGIA 2ABAA 4XTDA 2ICSA 4YXGA 2ZUWA 1RAKA 3LCHA 3K8LA 5AYZA 2PDYA 1RJQA 3VO0A 1LRQA 4GI4A 5T26A 1SZFA 3NO3A 4EWND 4CD4A 5HQLA 3PUGA 4AU0A 3A23A 4B9YA 1TE1A 5I07A 5F2MA 3VX0A 3SY1A 3WLSA 1O5RA 2HPMA 1Q8AA 3N04A 3HG5A 7PTDA 3TQ0A 2ZRUA 1YE4A 1R2SA 5D9PA 3TMQA 2QJHA 2PTDA 1PJ9A 2PZNA 4YWIA 5CSSA 5KZ6A 3PTDA 2GDQA 2PDHA 2GSHA 3MCNA 4PA8A 4DX3A 2PWHA 4Q3MA 1Z69A 2C7FA 3LHWA 3AXHA 1CGYA 3G3DA 6REQA 3SSZA 3TZNA 1LL6A 4BS0A 2REQA 4RV3A 3QZAA 1PKNA 5AC8A 6A3HA 4ROQA 1UZDA 1RV8A 1YLVA 1YX1A 4LVAA 1Q4WA 4JDYA 2DSZA 2E9MA 3ZJ7A 4JTTA 2Q8ZA 2YZ5A 4Q8QA 5HINA 1N55A 3WQDA 3T0AA 5F4SA 3RCMA 1XR2A 3ORWA 1EXBA 3MW7A 3HV8A 2ZZ2A 1KRMA 1NDWA 1RJPA 5FF7A 4JHZA 1VCFA 4DUXA 2ZX8A 1HP5A 4RZBA 3WLIA 4EXBA 2QLYA 2GWNA 2FHCA 3QPZA 4KRZA 3HA1A 4I9MA 2HNHA 1S5MA 2E9LA 4GUFA 2ZDSA 3KTCA 1ZRQA 1LUCB 1XYAA 4WHBA 3ABQA 4EP8C 1FWGC 2VRQA 3GH5A 3QQWA 1WB0A 2F9RA 1KW1A 2YFNA 3GFXA 5RUBA 1KM2A 2CLMA 1MVYA 2VCBA 3B4UA 4I9AA 3TOPA 2ATMA 1H5VA 5AOUA 2BGQA 1S5VA 5C9ZA 1GT8A 2V2DA 4KF1A 2GQAA 1NFGA 4EIVA 5DY3A 2YR1A 4MZ1A 2A3HA 2Q3OA 3FY1A 1LRTA 2NSXA 1XLHA 3FSUA 3PBMA 1TUFA 4UFMA 1XCWA 1ODZA 2BOGX 2CFFA 1A5MC 3LA4A 4FS9A 2HTMA 4M81A 5KTLA 4NNBA 3CHVA 3GXNA 1P0BA 5CGMA 1C8VA 2ZADA 2W92A 3UBPC 3E1F1 1P5BA 1IXQA 1YEYA 3FXGA 4ATLA 3EDJA 4P5UA 4O50A 3RM4A 3KVKA 2R14A 4R7OA 4AG0A 3RPMA 3OLGA 3M41A 2V0TA 4JTLA 5D38A 3SQMA 4HA4A 2QF8A 3BCJA 2OYMA 5HMEA 3OVPA 4ZOBA 3APGA 4HA3A 4I7VA 2ZUNA 3ZQ9A 3MVTA 3BCFA 5I6SA 1BYDA 1DQWA 2Y8VA 3UZJA 5JUVA 3QLLA 1XFCA 1IIHA 4KWOA 2FIQA 2DT0A 3OYXA 3JU2A 4POCA 5M2FX 3LNPA 3SCUA 9RUBA 5CGQA 3F7JA 3LI1A 3KCJA 1EP2A 1WCGA 2B31A 4OOZA 1S3TC 5LIYX 1V3JA 3KBNA 3WQWA 4HU4A 4LFYA 2WMIB 5A8GA 5TD4A 4GA8A 2J8TA 4L4OA 2YGYA 4GO8A 2VFIA 3H4XA 4OV9A 1HKIA 3TJLA 3LXAA 4WZHA 5FACA 3ITOA 2A3CA 3H2NA 2ZRXA 5AC6A 2WSRA 3FN9A 4H7ZA 1SYTA 3M47A 2C15A 2WSKA 3SQSA 1EIXA 3NQBA 4JTUA 3IACA 5H6HA 4AFYA 4US5A 3CHCA 5I79A 2FDSA 3N9SA 1QI3A 3VM5A 2WHLA 1EJ7L 1S2UA 3NL5A 2G4JA 2P8CA 1FXQA 4Y9NA 4DB7A 2NLYA 2D20A 4EE9A 2AOSA 4B92A 2D24A 2PGRA 5AYXA 2NV9A 3TTSA 1YTKA 2PTZA 2OX1A 2X41A 3C3UA 1Q6RA 2O7QA 4ZQCA 1CCWB 1OF8A 3G5EA 1JDFA 2D3LA 1Y7VA 3MI3A 3SBFA 2B0MA 2C16A 3MYPA 3EEGA 4DN1A 2VENA 4IFOA 1JL8A 1GGOA 1Q13A 1E9IA 2CBUA 3U9IA 5BCAA 2J4GA 1KCXA 3F5KA 3EMZA 3R13A 1FA2A 4KWWA 1ZALA 3W27A 3U3HA 3ZLGA 5F2IA 1XIDA 3CXOA 3B3DA 2A85A 1GQNA 4IISA 2J47A 4NX0A 1E40A 5K4ZA 2E67A 4IPJA 4M0XA 3NA8A 1RCQA 1OFAA 3LPOA 4YTSA 1EP1A 2WO5A 3EZ4A 2VQTA 4PUDA 3AJXA 2D2HA 1FWCC 1DWIM 2V82A 5DEZA 2VEMA 2FVKA 3Q4DA 4LVFA 2OCZA 3DG7A 3GXMA 1EL3A 2OR2A 2A3BA 2DUAA 5DANA 5IXEA 3GR7A 1UUQA 1UKOA 4D72A 1XYBA 2CLFA 4KH2A 4DJDA 5FIPA 3VGEA 1YE6A 3BAIA 4YPJA 3TVAA 3LPFA 4GK8A 3QGVA 3QFWA 2HQAA 3F4VA 1I2RA 3GVRA 3IJDA 1C9DA 1V3MA 1EJWC 2QIWA 2PCEA 3WF3A 3W3OA 2BGSA 3I68A 2UBPC 4LYKA 1J0IA 1QNPA 1LTDA 1RCXB 1X8CA 1EPVA 3TW6A 2VKZG 1NIUA 3MWAA 1HKWA 5A8QA 5A8OA 2E6DA 4ECLA 3IJ6A 5EL1A 4ZSTA 5U4NA 4DEFA 5HNTA 5FESA 5BYWA 4NIRA 3BC9A 4E8DA 3WH7A 2ZRVA 3B8DA 4L4PA 4JR5A 4NG3A 4DWSB 2X42A 3HPFA 3WLRA 3VA8A 4OQVA 1JYWA 4NZ3A 3BJFA 3W73A 4JHMA 1UWRA 4X2RA 3UWUA 1PYMA 2HBVA 3CZ8A 4PUNA 3WLTA 1X8FA 1Q6EA 5EU9A 2WVSA 3H4WA 4GG9A 4C5YA 4H8UA 5FSDC 4OECA 1IF2A 2PTYA 2DZUA 3BMXA 4FNTA 1ITCA 4QX4A 1CBGA 4GXPA 4GYPC 2G50A 3F4WA 4YVPA 1VFLA 2HJPA 4XISA 5IM51 3N4EA 5G2HA 4Q8PA 1WZLA 2Y5EA 5AZ1A 1AL7A 4OKDA 3QHOA 1HKJA 4ZOEA 4F3HA 4IUGA 3FA4A 4UFHA 1JPMA 2Y5JA 5FAGA 2F8QA 1C93A 1QBBA 1JDDA 3M9YA 3NFUA 1HGWA 3GVGA 4DNHA 5HPOA 1RA0A 1OGBA 2EG6A 2Z6JA 4AYGA 1NWRA 3UZWA 3QF0A 2Q01A 2GPTA 1XHGA 2R6OA 1GOQA 2VC6A 1EJSC 1MUWA 1XSIA 2PS2A 1S1PA 4ES4A 3T2QA 3N1AA 4AHQA 3PC0A 5D33A 4QNWA 2XFWA 4HYWA 1G6CA 1G9HA 1NWSA 3GG7A 4W7WA 1HGYA 1FHDA 1ZJBA 1J93A 3XINA 3OVQA 4XZNX 3GHUA 1TTPA 2DP3A 3RLUA 3UXIA 1KR0A 2ZICA 2PDFA 3CMFA 5G1YA 4DJEA 5EFDA 4L4MA 5C54A 4GI9A 1R3RA 1P4CA 1QI5A 1TPDA 1JUKA 3PAOA 2FJKA 3VE7A 1KKRA 3W76A 1K6WA 4DJFD 1W9PA 2VRKA 1O5QA 3UCDA 3BLPX 7TIMA 1R3SA 3VGDA 3TTEA 3CZEA 1US3A 1N8FA 3WDPP 3WQOA 2XN1A 3N2CA 4J3UA 3GTFA 4AVFA 2C3ZA 4D6EA 4UUIA 4WD0A 1RQEA 4BWLA 3G0SA 5EMUA 3B06A 1QHZA 3PBGA 1HVQA 1VBHA 2E0PA 3OHIA 3ZR5A 1QPKA 1KM0A 4KEUA 3UESA 4JXCA 1KM6A 2UY4A 4M6PA 5HJYA 5IHSA 2QF7A 1QFEA 3DIPA 3FIGA 4KERA 3WNNA 1L8NA 3E6EA 1G94A 3RLVA 4XIMA 1WV2A 3WQ6A 5BOFA 2OELA 3T09A 2Z26A 2VZUA 1H09A 5CZ0A 1XXXA 1TIMA 8XIMA 1LOLA 4F2BA 1EO5A 1TJPA 1QPOA 2VFEA 1TZ7A 2VO5A 2WOQA 4MMWA 4C1LA 3LPGA 3L68A 3MCMA 5C7HA 4K36A 3L4UA 1O5XA 1GVFA 2X2YA 8CGTA 1W6TA 4HZ6A 3PY2A 2DZSA 2J75A 2XG9A 4LS0A 4WQ6A 4UTLA 1BRLB 5CBBA 3C56A 1P0NA 3GTHA 3GG0A 1IWAA 1E6PA 4DZ5A 2PDKA 3N2OA 2PGFA 3IVUA 5FD0A 1KM3A 4U31A 3SR7A 2V68A 4GJIA 3TONA 3TJIA 2R94A 4W93A 3NAVA 1W3TA 1E9ZB 2ZIDA 2GQ8A 4K39A 3NG3A 3ES8A 1ADSA 2XN2A 1RZMA 2OQHA 1S2AA 1TVLA 2FPTA 1ITQA 3LTYA 2EKCA 3OG2A 2Y8UA 4Z0SA 2I5IA 4KGJA 1KFKA 4TXEA 3S2NA 3LQLA 5TNVA 3FOKA 2PF0A 2OSXA 4DBDA 1N8WA 2YPIA 4JTCA 3R94A 4QCEA 2QMJA 3AISA 3ME3A 4Q8UA 1U5HA 4GI8A 2OG9A 5JH2A 1VPQA 5GQBA 1RBAA 1Q66A 5JIWA 2OJPA 4WK9A 1B3OA 4GKLA 1JZ5A 1Q6OA 3GNPA 4XO7A 3B8UA 1T96A 1TTQA 1XIMA 1MWOA 5I7GA 3GDLA 1JQXA 2PP1A 3HM7A 3KVMA 3VNYA 4HTYA 1IWPA 2XVPA 3RNDA 1VGAA 1YPIA 2TRSA 1BWLA 1LT8A 5HAOA 4Q4RA 3TC7A 2BBFA 2ZC1A 4GQBA 1AW1A 4G5DA 4H00A 2R1NA 3DG3A 4CNTA 4JL2A 1HT6A 2YZRA 3AHZA 1MXSA 5C7VA 3QPEA 4M56A 2PDCA 4Z1DA 4ADSA 3NSMA 4V33A 1BQGA 2QUNA 1XDMA 1K9EA 2VEPA 3QR1A 2QVHA 4WF7A 3POCA 1N82A 1VFHA 1Q3NA 2OO0A 1VFTA 1EWEA 3PVFA 3AIVA 4UCGA 5EMLA 3NQ6A 1XIEA 1ZBCA 1UHVA 3CPRA 4L9XA 3MUCA 1JF6A 3P74A 3S5OA 1FQ0A 4UFKA 2QCCA 1LBFA 1ZJIA 1HTIA 3V5CA 3KUMA 3A64A 1R9YA 3EA1A 1FWFC 4DZIA 3RYSA 2KZHA 2IPJA 4XVEA 1QBAA 3WF1A 3NPVA 4RR4A 4KIEA 4ACYA 1EQCA 1EEXA 1TX2A 4JTSA 1W1YA 2WPBA 4FZIA 5HMDA 3PZIA 4O1EA 3TXVA 4PGLA 4O4VA 4H6EA 4TX8A 2X1IA 1AMKA 2VRJA 4LUYA 7TAAA 3T4CA 3JR2A 3OLIA 3INPA 1YNQA 1QHPA 1ME9A 3ZSTA 1TJ2A 1UH3A 2VC7A 4GGBA 1XIHA 3SJNA 3LSCA 3VOJA 5D04C 2CLOA 4WY0B 4M7TA 1V6YA 4NP7A 1WKYA 2NUXA 3PK7A 4A8LA 3W26A 1W5NA 4JTDA 5DXYA 3TR9A 3HGOA 4ZQPA 1DJZA 4MYAA 4JFTA 2YLLA 4WY0F 1UWTA 4RXGA 3DXIA 3V75A 4DO7A 1A0CA 2ZXAA 3LK6A 1CYGA 4LVGA 4NNAA 4GINA 3TTYA 4KS0A 1S3HA 2WWCA 3UVIA 3O0FA 1W1IE 2PDGA 1J0ZA 1Q6QA 2V6AA 1T40A 4KIRA 1NH6A 2GJLA 1H7RA 1FTXA 3M0HA 2QNEA 3QMSA 3K30A 3SN4A 1HP4A 2E3ZA 4ROPA 5AYBA 3MPGA 3FHQA 4J1OA 4XBJA 3FLUA 1Q45A 3VTRA 1YDOA 3OVRA 4DELA 1L2QA 4PUWA 2PD5A 3D3AA 1T99A 4LUIA 3POHA 4A8RA 2D0HA 3B05A 2NVDA 4RLIA 4AIUA 4FX7A 4UR7A 3PWGA 3BAWA 2DJXA 1IV8A 1GTHA 3TFXA 5TF0A 4TTUA 1CIUA 3VKJA 3N15A 1OZQA 2VT0A 3KAOA 5DELA 3W0KA 3KRSA 4FIRA 4ZXOA 1ITUA 4DYKA 4JX4A 1FUYA 1GWJA 3GZAA 2XH2A 4TX6A 3PZMA 1C29A 3STFA 2Z1SA 4XX6A 4GYFA 1MW2A 2AL2A 1NVMA 4CCDA 4NZFA 4GQ0A 3MY9A 4LWWA 3U4FA 4MAVA 4WDXA 3LCLA 1AJ0A 3PZVA 1MDLA 2PWDA 1NWUA 4TMBA 3VGBA 3S4TA 4C6OA 3BMVA 1NSJA 3S9YA 4N4QA 4UFLA 2D2GA 5DT5A 2Q8XA 4PTWA 4W89A 2ZWYA 5TIMA 2ACRA 1VYPX 3ITGA 1YTEA 4KETA 3EMCA 3VPLA 1NOUA 2JEQA 4Q4MA 3LRKA 3UPMA 2WPGA 2V5CA 4DPPA 3HG3A 1A5AA 5JU6A 2OWWA 1E73M 5FKYA 3LCWA 7XIMA 1E0UA 1BVWA 2O9PA 1F9CA 4PMNA 2XPKA 4DF1A 2WKJA 3DYOA 3H2EA 1QOPA 1QPNA 4BI6A 2VHLA 4FB7A 2D3NA 1XLFA 3NGJA 1MEIA 3SRKA 4BA0A 3PANA 3AIUA 1F8IA 1QMLA 1SVDA 4LAUA 5H8PA 3A22A 4L1WA 4KCWA 5CEWA 3S6DA 2VWTA 4AC7C 4LSBA 2QPXA 4EKJA 4NZ4A 4R27A 1W3IA 4U5IA 4ZO8A 3WX7A 2DIKA 1RXOB 1PZ2A 3LHUA 1TA3A 3TK7A 3ZXWA 5DO8A 1Q5MA 2IXUA 1A0DA 3N19B 2PZ0A 2WSQA 3DH7A 2BTMA 4PR4A 3W7NA 4DJDC 4A6GA 2YW4A 4MB3A 1SJDA 1NAL1 4MJ2A 3URAA 5D4YA 2WSPA 4U33A 4O17A 4AX6A 1MMFA 3II1A 4PMDA 1PDZA 5A6LA 1OQFA 3ABSA 5J04A 4C7GA 4H83A 4AD2A 3BAXA 3STCA 4ORIA 5G4WA 2E9BA 5XINA 1E1EA 3G1AA 1ICQA 3QR0A 5DCEA 4GY7A 6TAAA 3S5ZA 2Z1WA 3KVJA 4E4PA 5HOSA 1BAGA 4REQA 3H22A 1DE5A 1E15A 3WQ4A 4LCQA 2ACUA 1ZFJA 1GZGA 3QY8A 3IJIA 4XD3A 4HU0A 3OJGA 4MG4A 5EY5A 1XIBA 2VEIA 4AY8A 3FS2A 2BOFX 2NXIA 1TZZA 5BOOA 1UASA 1MDRA 1RQBA 4Z2HA 2VFHA 3DECA 3BZJA 4JFUA 1TRIA 3M4HA 4QLJA 4Y2WA 2PGEA 3V1HA 1YPFA 2GJXA 1VRXA 4PTDA 1QNQA 4XUGA 1ISYA 1HX0A 3APTA 3WDRA 3A13A 4QSHA 3J7HA 5E6ZA 4HN8A 1TWDA 2H9AB 3ITXA 4O15A 3WLJA 4UZSA 5AKQA 1XLEA 3PNUA 3S1XA 3T9PA 5FOOA 3MMDA 4OUEA 4IIEA 4X0NA 3C5QA 2FQIA 3GR4A 1V0KA 4D8AA 3ARUA 4QIUA 4PTNA 4XSMA 2OOFA 2OYLA 2R1PA 3GVWA 4K8HA 3RGTA 2HRWA 1OGGA 2C19A 3L5AA 1A47A 1QWKA 3CV6A 3EDFA 3AHVA 1E9YB 2MNRA 5KZDA 1J96A 1SMDA 1AA1B 3LG3A 4F8XA 3K2GA 2B81A 3FXYA 3QSTA 4RKAA 4UQDA 5CG7A 1OC6A 4HK5A 1L6WA 1LQAA 1A3WA 3MI6A 4LU0A 3TROA 4UB9A 1RD5A 5ECVA 1B3ZA 4MB4A 4HYVA 1P6BA 4C7DA 1DVJA 1E6XM 2QR6A 3F5JA 5HNUA 3UNDA 5CAHA 3OG3A 4NF7A 4CVUA 1UYQA 3PFMA 1G4EA 3W1LA 5BMXA 1UA7A 3EOOA 4LAZA 2PDPA 5D9NA 3CZKA 2PD9A 1A0EA 2D73A 3QV7A 2YCIX 1XH1A 5CAKA 4CEXC 4XD4A 2Q02A 1W9BM 4PMVA 3RPTA 4E0CA 1JR1A 2ZTKA 2DEPA 3NR0A 3GH4A 3KVLA 4PSRA 2QCMA 1TPVA 5BWFA 5LZLA 4XQ6A 4LBRA 4DJEC 1A5BA 4HHLA 2H6RA 1H3GA 4H9ZA 2NQZA 4GCXA 3W2LA 4IJBA 2NVAA 1N8IA 3MSDA 4JL1A 4UOQA 2GJRA 1ME7A 5I24A 1X1ZA 1C7SA 3AZTA 3ITCA 4UBPC 1XUZA 3K13A 5XIAA 3LRMA 3O63A 1X7IA 1FCBA 3ZOAA 1SFSA 4GKTA 4BWLC 4UTMA 1FH8A 1PZ3A 3RIKA 5I5RA 3SQLA 3HGRA 4AEOA 1TKKA 2BVDA 1FRBA 4UFIA 4QITA 3SB0A 2VGGA 4ML4A 2V38A 3L4WA 3W2NA 1BVNP 4C6NA 5LNRA 1TPC1 2EJAA 5KETA 4RNJA 3I7RA 3IS4A 3CHFA 2QPUA 1ZP4A 2GUBA 2KX9A 3P14A 5E9AA 4HOWA 1SZGA 1GKRA 5C6MA 1W0MA 2V3DA 3H7RA 1OCJA 2YB1A 4AISA 3G1FA 1TFVA 3IPWA 1PE1A 2BDQA 3KM8A 2XGBA 1VZWA 3OW1A 1POJA 3KTXA 1FDYA 4J7RA 5C9RA 3I6TA 3NIYA 3FW6A 3OEXA 2WZEA 3PF3A 4QR6A 2YX0A 1PS9A 3TYEA 5G4HC 1TV8A 2A0NA 4UNLA 1QNSA 3LYEA 3HQPA 5T9BG 4WCJA 3P82A 4XD6A 5LXEA 3KZPA 4JYFA 3G1YA 3LOTA 4LW7A 1EJVC 4UZUA 1R86A 2PF8A 3G1HA 4GIEA 5A3HA 3S8HA 1JULA 3EB2A 2FPVA 1QWGA 4KRTA 1JF5A 4RE0A 3GW3A 1B54A 4JTHA 1REQA 3S1VA 3CZJA 1H5YA 4UNKA 2QHAA 1HJXA 2ZX5A 1JCNA 3O6DA 4TU1A 4ICMA 1WO2A 1VYSX 4O0KA 2R82A 3UG4A 1I1XA 1TPEA 2WMKA 2ZUMA 3HO8A 2JQXA 1OFRA 4JICA 1DJYA 5CC7A 1TMQA 1UR3M 4WOQA 4OU1A 1B0IA 2TODA 1U5VA 1B90A 2A6LA 2QDEA 1TV7A 3SY5A 3UG5A 2J6XA 3E38A 1T8XA 4OJYA 2OLAA 1AQ0A 4WKAA 5FEWA 5DMYA 2VMFA 4LUTB 5A6BA 2ZWZA 1OGSA 1BLIA 5M17A 3DFYA 1IQ8A 5GNZA 1DE6A 1KLZA 5I3HA 1W5PA 1CENA 3I4KA 1DJHA 4PULA 3TX9A 2IKGA 4EACA 4EPEC 1DV7A 2E6AA 2J27A 2XIMA 2AQVA 1XGZA 2OOGA 4QE1A 5CSRA 1PDYA 4IX0A 1XF0A 5G4EA 3OA3A 3VKDA 2Z7GA 4BKNA 1T7LA 3EWYA 4PMJA 4IIBA 2XU2A 2XFFA 1K03A 4ZEPA 5ABTA 1SO3A 1PTDA 1ZB5A 3GXDA 3PPGA 1SPQA 4RZ4A 1EGMA 3O6AA 1OX6A 3A5FA 1AH0A 2Z25A 5D2TA 1HNYA 3FEMA 4DHGA 4Q33A 1CW2A 4CNUA 5CLWA 6REQB 4DIAA 2REQB 3B9DA 4MZ8A 1US2A 1BF6A 3UG3A 4DBSA 3NVTA 5H8MA 3WLLA 2PU1A 2OYKA 3WJXA 1U1UA 2A7NA 1VPYA 4AB4A 2CZ5A 1ENUA 3L4VA 4MHBA 2J7HA 4P7LA 4RNHA 3S1GA 3R5EA 4US6A 3T7VA 4R9OA 3L0GA 4P8UA 3F2BA 1GOIA 1S1RA 3GNXA 1XIGA 1ZJHA 2DDXA 5FL1A 4IF2A 3W25A 1XV8A 1V77A 1LP6A 2VOMA 4JTQA 1U1JA 4QS5A 4K2SA 4W7UA 3RCYA 5REQB 2XM2A 1DJIA 2PDNA 2JF7A 3HGJA 3S1WA 2Y7GA 5CBIA 2ATSA 3C0JA 4A21A 1DQXA 3EYPA 2CLEA 3T1GA 4GFSA 2WK2A 4GMEA 2J74A 2WLZA 1WAUA 3UY8A 1BF2A 1F7BA 1XLDA 1NF7A 4AZ6A 4QLLA 4JTRA 1FHUA 3KXQA 3PBWA 3EPMA 1MQRA 4A05A 1M04A 3W7RA 1DP0A 5CH9A 1YDVA 3CK5A 1K70A 4YU1A 1D3CA 1OSEA 1PZ0A 3DKLA 3W6MA 4MWAD 3S2JA 1MW0A 3ZT5A 4QJ5B 4LY8A 3EOLA 4HPGA 2E6FA 1DHPA 4P7QA 1EXPA 2OLSA 2GOKA 4QXIA 3W84A 1D9EA 5CCZA 4H9YA 1FH9A 1QNVA 2DZBA 3AYTA 4IGMA 1MNZA 2FTYA 3W1NA 4FR1A 4LAOA 4Q4OA 5D2XA 4JNYA 3NQAA 5I3DA 2YA0A 3TU9A 4PUUA 1GVEA 1F74A 4PZVA 3SUUA 3VKCA 3WD4A 3RHGA 3WCZA 2FFCA 1GQJA 4HPNA 3NQVA 4L56A 3N17A 3WYZA 6XIMA 4GUJA 4NZ1A 1AFSA 3WENA 1A5NC 4PEKA 5E0KA 3NO5A 5FL0A 1F5ZA 1TB3A 4IGSA 3WG6A 3E0FA 3AXXA 4FLOA 4QFUA 3GNDA 5D2YA 4KWVA 1EX5A 1MQQA 3ZO9A 1B4KA 4F48A 5D03A 4O1DA 3WD0A 6ALDA 3BSMA 4RV8A 1R2RA 2WSYA 3ATZA 2RKXA 4J2MA 3N9RA 2PDUA 2RGMA 4PN2A 3NOYA 4I3GA 3UZYA 2XJ7A 4B2DA 1CLKA 3GIQA 5C0QA 3VD4A 3IVTA 4L6HA 3Q65A 1RPKA 2POZA 5IFPA 2A79A 3DI0A 4GBUA 3S5SA 1F8MA 1V79A 3O2LA 3THUA 4QJ1A 3EXTA 1YNYA 3IJ9A 3WK3A 2BODX 2NX9A 2RDXA 4WDWA 1CWYA 3SI9A 1UKSA 5DCBA 4WXYA 4CQDA 3T44A 2FZMA 8RUCA 2NWSA 1KFJA 4QG8A 5AZ0A 3GUGA 3NUKA 4ZE4A 4RNFA 1UKQA 5CJ5A 2FTWA 3W6LA 4HHPA 3UR8A 4RPQA 2PTWA 4M3PA 2HWGA 1RBLA 1TCDA 3BLDA 3ZT6A 1GQKA 4O12A 3CT7A 4I7WA 4IQJA 3EA2A 3O07A 4D6IA 2FZ9A 3L5MA 1Q8JA 1XDLA 2O4QA 3NQCA 2DFAA 3ABZA 3LDVA 3ZT7A 1OYBA 2RUSA 2V5LA 4Y8FA 2AKZA 3RX3A 1SO5A 3BJTA 3WDIA 2GGEA 4IJCA 3W88A 3DHFA 1P0KA 2FH6A 4N4PA 3DFSA 3TQPA 3H54A 5E70A 1F3TA 1UOZA 2YA2A 4PTVA 2OX4A 1CDGA 3R1ZA 4HNCA 1Z48A 3GE7A 2B7QA 2OSYA 1U1HA 1MXGA 3DOPA 1I8JA 3FAWA 4B4HA 5E09A 4HCDA 1IT8A 3G2GA 2XSBA 3LX9A 3CPUA 4IP5A 5AHMA 4K38A 1X98A 1GVRA 3IIXA 1HKKA 1XC6A 1WBHA 5FSEC 2QPSA 1VJZA 4W87A 2OEMA 1CI1A 4RZ5A 2L5HA 4ZCWA 4LTSA 4WGHA 2CWNA 2OQYA 3R10A 3TZFA 3Q37A 3QH2A 1F6PA 3NZQA 3GFYA 3DFOA 3TTOA 2ZC8A 1JPHA 3KP0A 5LYRA 1LG2A 3ONCA 1TVPA 1QASA 1ZLPA 3TQKA 4WJEA 1JI1A 1XBVA 2BHUA 3VOFA 1GJWA 4L4LA 1M7JA 2YL9A 4PC8A 5BWAA 3XIMA 4FNSA 1XIFA 2V5KA 3R6IA 5A8PA 1IHIA 2X1TA 5BZAA 1AVAA 3W9ZA 3UJEA 1XLMA 4PFHA 3N6QA 4CQCA 1OF6A 1WDWA 3N14A 4FR6A 4PRWA 1WDPA 1GOKA 4YVVA 1QR7A 1WKFA 2Z2BA 1PYFA 4DXXA 3SN1A 4B3KA 1KFWA 3U5UA 2E1WA 1HF6A 3C2RA 2I56A 2GGGA 2DW6A 3W1AA 3F2CA 4G1KA 1TYGA 4LYPA 2TAAA 3WL1A 2ISWA 1Y5VA 2PBOA 3SW6A 2VR2A 4MLRA 4GIRA 1J01A 3FKRA 4HU8A 4JCMA 2G95A 4M82A 1FWAC 3D0CA 1JXJA 1KD0A 5KZEA 4ZSUA 4FOUA 4ZO6A 3VD3A 4FXFA 2X2GA 1W3KA 1B1YA 2ONEA 2GDUA 1OFBA 2R91A 4F0SA 5E0FA 2ISDA 1XYLA 3VDCA 5HQEA 3QFEA 1D8WA 3BAJA 2XYLA 1C90A 4FI4A 1O7AA 3QW3A 1JEZA 2B7PA 4MY1A 4TVUA 4DM2A 1ZP3A 5G5IA 2XWDA 2Z6IA 4S23A 5AB3A 3NQ7A 3T0DA 3KBWA 2YB4A 4IIGA 2IPWA 1EYEA 4HNNA 3N4FA 2BY0A 2IMRA 4IXHA 3QZEA 2I1OA 3KTSA 4RCXA 2YJQA 4JTEA 2QAFA 3AS2A 4GOAA 4HCHA 3MP4A 4MB1A 1HQTA 3G77A 1EEPA 3WH6A 3CL7A 3O16A 1MI3A 1J2WA 3WQEA 4ZE5A 2VZOA 2ZUSA 2XVKA 1Z3NA 1RK5A 4BQ5A 3KDOA 4FAMA 3TV8A 2F38A 1PKMA 4QDWA 4G7FA 5CZSA 4X63A 1RY0A 3UQNA 4Q32A 2MUCA 3MSYA 4D1IA 1UIPA 4M6VA 3E49A 3QOMA 3JUGA 3SN0A 3KOZA 2BXYA 3HB9A 2QULA 2DU2A 4RPPA 4L64A 1O6IA 1GK8A 4B4FA 4QG6A 3TE9A 4FPSA 1ZUAX 3NL2A 3L66A 5EKYA 1EDQA 4L9ZA 1H1YA 1LF1A 3P81A 3QSRA 3AUOA 5A69A 2YBVA 5FJTA 3BMWA 4LS1A 1G0CA 5K3VA 1XBXA 4Q4KA 1EHAA 1AH4A 1ZBWA 1V6UA 3GDRA 3CHDA 3HOJA 2V81A 3W7PA 2PLMA 4R34A 2DY3A 9CGTA 1TTJA 2DGAA 2ALDA 3WBAA 2J77A 4GUGA 5FCZA 1ONXA 3GX9A 3PSVA 4R33A 4FSAA 3CQIA 4S3CA 4D6DA 4IOTA 3H2AA 1EPXA 3QQ1A 3IAPA 1ZJAA 1OBAA 1M1BA 1H50A 3CAWA 4MPKA 2Z28A 4IG2A 3CQJA 1M3UA 2V5DA 3TC6A 4PB4A 4LT9A 3KCOA 1BTCA 3CQHA 1JIBA 3WF4A 1SFLA 1K6AA 3OZPA 5HATA 1XYCA 5B80A 4B91A 3F03K 5CPOA 1FWRA 2YXOA 5BROA 1NU5A 3MKKA 1C9WA 3DESA 2G3FA 4G6CA 4ZB0A 4V15A 2XH7A 1O12A 5IBXA 1IXNA 1YDYA 2QUUA 4B16A 2X1RA 3QV6A 3B0YA 1PXGA 4QAWA 2ZZ7A 1GOMA 2PEVA 3LTSA 2YW3A 4EF8A 2OMAA 5I3IA 4W4QA 1QW9A 1B9ZA 3CT2A 3PJTA 4YMZA 1S5TA 2A3EA 3MZNA 3P0WA 3AMKA 4P7RA 1XRTA 4A3HA 1SZRA 2QUVA 1VJSA 2J9YA 1HO1A 2NQ9A 1PCKA 2H3DA 4KEZA 5ABFA 4F79A 4QJ3B 1W1B1 3RXZA 1U22A 4CCZA 3WNOA 1XIIA 3ZSSA 3GC2A 4IMFA 1K7XA 2BGNE 2J7EA 2AQWA 1IGWA 1XICA 4JY8A 3B8TA 2C14A 4GCAA 3KBSA 2J62A 3WL0A 1BXCA 1CLXA 3GKFA 1A5CA 1Q4NX 3VM7A 3T78A 3RJYA 1EUNA 1K9TA 3GW0A 3OQEA 3PZNA 3RN6A 2IS7A 4O8RA 3ISIX 1FWSA 2HROA 1DWAM 1RP9A 3VDAA 1EF3A 3WKZA 2VOTA 2VFGA 3H12A 3CAVA 2CZDA 2VL4A 1EWDA 3BDKA 3QKZA 1AQMA 2W6RA 3RO6A 1VD6A 2AKMA 2Y6ZA 2GUYA 4O11A 1CTNA 4Y7EA 2BB0A 3FK4A 4HSHA 3KWSA 3OGRA 1KCLA 1H1NA 3QW4B 2PPGA 5EFFA 3W07A 3OLDA 4GYKA 5CPTA 2D22A 3C3NA 4PTXA 2JALA 1XX1A 3A9IA 2IPFA 1YXCA 3M16A 3GIYA 1XI3A 3BGJA 1PCWA 1UWSA 2XFRA 4CD7A 2J25A 3MYOA 3P62A 1F61A 3EB3A 1FY6A 3WQ5A 1VYRA 3MMTA 4DJFA 1UC4A 1OB0A 2P53A 3TQVA 1U2YA 2QW5A 2PRMA 3CTLA 2P10A 1XQKA 4LAKA 4Y8EA 3WBEA 1HFBA 2W5FA 1IXOA 4GC4A 3MUZ1 2VCCA 5K9CA 3BVJA 2OTDA 4DO4A 6XIAA 1BPLB 4Y96A 1XW8A 4F40A 4PCFA 3GHSA 1XKYA 1SGJA 2DVXA 3P67A 3PG9A 2J7BA 5DY2A 5K7JA 4D71A 1JDAA 2I16A 4MKNA 3TN6A 3W1RA 3I3DA 3K1GA 4P61A 4YS1A 3B97A 3V0TA 4G1NA 2GQ9A 4YNGA 3QV9A 3MSGA 1YMYA 1UIOA 3AQUA 1RY8A 1WBJA 3LHYA 2DZWA 3QR3A 4GZJA 1L6GA 4ZQRA 3UJ2A 5LNSA 3S9IA 3GO2A 2QCFA 1ICPA 3V7PA 1HJWA 3PG8A 3N2TA 3G3MA 4Y9PA 4WLCA 1BG4A 1DTNA 1KC7A 1Q6CA 1V3KA 4J3XA 3PBUA 2VI0A 1M65A 1UWIA 3PHAA 1I4NA 3ZJ8A 1KFBA 5CPQA 4LS2A 3ANUA 5I06A 4Z2GA 3HBLA 1CT5A 2XIQA 2PFHA 3AUJA 4MNLA 4BHYA 3KLKA 4NKCA 3L21A 1WDSA 2BZNA 3KOFA 5L9FA 4IIHA 2HZGA 1W9VA 1V7YA 4O10A 1WYIA 1TR9A 4NUWA 5HUPA 4HQVA 3ABOA 4KCVA 2CZEA 3MUY1 2G5WA 2QJGA 2AL2B 3RR1A 1FHLA 3UCQA 2NQ5A 2NT0A 2GZXA 3E12A 2QCLA 3D47A 3MP3A 4XWUA 3BH4A 4IFKB 2CLLA 1NARA 3V1PA 1TPWA 3DHDA 5CGTA 3OIXA 1X38A 2HK0A 4MKSA 3HFTA 2DSKA 1D8CA 2HBXA 1EC8A 2J79A 3R79A 3ZJ6A 4S3EA 3MB9A 2OB3A 1KO0A 1UH2A 4V1XA 4LVBA 3C52A 4CUCA 1W91A 1PO9A 3RLHA 2HE8A 2VQUA 3KL0A 3TNBA 1UMLA 1YBQA 1RR2A 2FVMA 2WNWA 2AMXA 3BSGA 3HMJG 2PAJA 4JQ1A 4LVDA 1UUOA 5GJPA 1O4UA 2BY1A 1TZ9A 3L4XA 1C91A 3VIHA 3H2FA 3M07A 3P6LA 3W72A 4HIBA 3NPUA 1XH0A 2WB5A 3M5ZA 1BWVA 3LCXA 2R9RA 3H23A 4DXKA 1DL3A 4LALA 1YADA 3T2PA 5TAOA 1PTAA 3NDOA 4JX5A 4UTTA 1H61A 3AYVA 4HJWA 4ADUA 1TA3B 4IL0A 4CNSA 5A6MA 3PBYA 2XISA 2I9EA 4X3ZA 3NZPA 1FDZA 4NJKA 4AHOA 4H7CA 4D1JA 4OTKA 4FEZA 3AAMA 1LORA 4IMCA 2FMOA 1CGXA 1JYVA 1ZPTA 1Y8BA 1JD9A 3EX6A 1G1YA 4YVXA 2WZIA 1DJWA 4GZIA 2GK1B 5LIUX 3OP2A 1AQHA 4REQB 4ML9A 2E5DA 3QTGA 5C2CA 2WMIA 2Y4SA 3GG8A 3NM3A 3M0VA 5T91A 4NJJA 1PKLA 5AY7A 1SFJA 3VD7A 3UA3A 5BXRA 4JIHA 3KS5A 2PLKA 5L6UA 4CN1A 4CQBA 2WANA 1UZ1A 4C6MA 1GTEA 3OZOA 3AFBA 3VZZA 3FX4A 1VFUA 2Z24A 2GJXB 5K9XA 3C2YA 2QUTA 3TN4A 1W2VA 2C13A 3VD5A 2QV4A 3CUIA 3GYEA 5IHRA 3WFLA 4EX4A 3TJ4A 3EDEA 2F6UA 1Q2SA 2Y61A 2DIJA 4G2DA 4JIQA 3WNPA 1NOFA 3RF9A 3N73A 2Y85A 3AO0A 1ZS2A 1A5OC 2IPGA 5XIMA 2WC7A 1I2OA 2E8YA 1W9UA 3W86A 4J2PA 1E1CA 2VEGA 2VR5A 3C2VA 3URQA 5A6SA 5HWMA 3ECQA 2VFDA 3UWZA 2DT2A 4XBSA 3TP4A 5HWNA 2DQWA 3OYZA 1C7TA 3EWUA 1W1ZA 3H70A 1FKWA 2PRHA 4KKXA 2XVLA 4E2BA 1VAHA 4N42A 2QVNA 5D32A 5E6YA 1QRQA 2ZZ5A 1FCVA 2YA1A 4JTAA 1EA9C 3ENLA 3P7YA 4UQ9A 3DFHA 3GFZA 4R85A 1TWZA 4JTGA 4F2UA 3NZRA 5AYIA 1K02A 4PMRA 4LH8A 2VGBA 4DUVA 2AAMA 3HIJA 5D05A 2X7VA 2QCGA 1OK6A 1I75A 3LHVA 3OLEA 3WQGA 5GPRA 1FWWA 3EBVA 5C71A 1C92A 5CXPA 4CN6A 2W66A 4JQ4A 1E5JA 4GUHA 3SCWA 1IZKA 1E72M 2A4AA 4KW2A 2OEKA 1WXJA 1UR0A 4K1WA 5M1TA 4I6VA 1W31A 2R1MA 4XKYA 5BW6A 3DHUA 1YYAA 1RLCL 3TLLA 2WCSA 2R1KA 3FNDA 3MV01 5DMLA 3WNLA 4NX5A 1M9HA 3BSHA 4HGXA 3GDKA 4FHAA 5KMYA 3GH7A 4CD6A 2EPKX 3AYRA 5LNVA 3PSWA 2ANUA 3WMBA 1OEPA 1P6CA 2B7OA 1EJUC 2DSWA 4GY0A 3SSJA 2FB3A 3WFAA 2A3LA 2DZPA 4Q8TA 3ABXA 4DBEA 1XGEA 3TCSA 1J12A 3VGHA 1EBGA 3HPZA 4NI3A 4I5UA 2PLCA 3M43A 3U2EA 1U33A 2CXGA 1L6YA 4GIAA 4QSFA 5IRPA 3NPXA 3AHTA 1UWAA 1KWKA 3CV2A 4YHGA 4PODA 4O13A 3CO4A 1LWHA 3UR2A 4JTFA 1L8PA 2VXNA 3DZ1A 1UD2A 1TJ1A 3ITTA 2C1HA 3LQGA 2CYGA 1W5QA 1DORA 1U83A 2QDHA 4HA1A 4A3RA 2J66A 2F2KA 4ZTYA 3W7JA 4B5XA 1VKFA 2CETA 1VFFA 2EXOA 5A2AA 1MSSA 3AS3A 4GC3A 1GOWA 3P8IA 1SO6A 1VEOA 1ECEA 3CYVA 4J3VA 3GU1A 4PEEA 5DRCA 1Z6KA 4AIOA 1FCQA 3ANYA 1SZEA 1R47A 1YDNA 2QS8A 3EKGA 3GNRA