2A3HA

Cellobiose complex of the endoglucanase cel5a from bacillus agaradherans at 2.0 a resolution
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bacillus agaradherans family 5 endoglucanase at 1.6 A and its cellobiose complex at 2.0 A resolution
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Endoglucanase
molecule keywords ENDOGLUCANASE
total genus 117
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2a3hA00
3NDZA 1FP8A 1GQJA 2D24A 4ZXOA 4B9YA 3AS2A 2W61A 5DT7A 1MFVA 4OBSA 5HPOA 2DIEA 3BSHA 4Z2HA 4B16A 3GZAA 2XPKA 3W4RA 5EMYA 3OLIA 3HMCA 1O7AA 1BFNA 3AHYA 5D9MA 4J3WA 2J7EA 4F66A 1KCKA 1ISYA 2DIJA 3PZIA 5E70A 5DT5A 5JBEA 3EDDA 2GDVA 4Z2LA 3KL3A 4ACZB 2A3BA 1R87A 1PAMA 2WC3A 3I3EA 5BROA 4ZENA 3I3BA 4V28A 2MANA 3WQWA 1E6QM 2UY2A 3WMSA 6TAAA 2WHKA 3VTRA 2E3ZA 3VD5A 2ESCA 3VILA 1JZ8A 2WMIB 1HT6A 1V6YA 2A3HA 1A3HA 5HDRA 1V02A 1KR0A 3WMCA 4BQ5A 1MQPA 3UR8A 2QLYA 4KRTA 3BLKA 1XCWA 3K1DA 4B3KA 1WZKA 1KFWA 3EMCA 4PTVA 3EDFA 2ZE0A 1B3VA 2VRKA 5TD4A 3SUUA 2OYMA 1TA3A 3W53A 3T0AA 3CLWA 2BHYA 1W9DM 4RE4A 1UHVA 1C90A 3WH5A 3DC0A 2YL6A 3NSMA 3WSUA 4PMZA 2CETA 1E5NA 4UTFA 2E8ZA 1UD6A 5CPSA 1DHKA 5AC4A 3CGTA 3WF4A 1ZL1A 1E72M 4GPNA 2NW0A 2WKGA 3FY1A 3GH4A 1M03A 2X0YA 3PHAA 4XX6A 3VMPA 1KQYA 1V6VA 5C8BB 3ECQA 4HP5A 4AD1A 4X9YA 2X8RA 3U57A 5JUVA 4AZHA 4D1JA 3QHNA 1CLXA 2F61A 1J18A 2WWCA 3DYOA 3QOMA 1G0CA 4P7QA 1TVNA 5EB8A 1HVQA 1V0LA 5GNZA 2WZIA 3VIIA 3DHPA 2YL9A 1EXPA 5GNXA 2ZICA 4AW7A 3UESA 1WZLA 3N12A 2JEQA 4D6FA 1F4HA 3K46A 2WCAA 1JNDA 2BHUA 4D6GA 4LPCA 5A6SA 1EO5A 5FIPA 4OJYA 1XSIA 2O9PA 4GZIA 4Z2JA 2VUYA 1SR0A 5BRQA 5E6ZA 3OLGA 1LL4A 3AMKA 4QP0A 1GOKA 1UH4A 2D0HA 4H8VA 1B0IA 1IZJA 5A1AA 2FDMA 3WBEA 1UR4A 1HKMA 2CEQA 4CN6A 3DYPA 3WQ8A 4M8UA 3U5YA 1H4PA 2IXVA 1UOKA 5AC5A 3AS0A 1DWIM 1G94A 3WF0A 4OBRA 2Z1SA 4AISA 2J7GA 2HVMA 5CLTA 2B31A 4ZFMA 4OOZA 4PMRA 2V3DA 4E4PA 3CHEA 5I2UA 2YKKA 2X1IA 4MDPA 3E1F1 3WD0A 3BXWA 4MAVA 3EBVA 3VIKA 3CTTA 4JFUA 1XYFA 4NF7A 2XVPA 1CNVA 3I3DA 1J0IA 1J0KA 4CCEA 5BXTA 3LMYA 2OYKA 1C8XA 4FK9A 4CUCA 3TONA 2JF7A 4NRSA 2HISA 1W3HA 1W91A 2JFEX 2UY4A 1CGYA 1BYCA 2PWDA 2CERA 2BXYA 1VEPA 1ISWA 2VCAA 4ZXLA 1W9XA 5AYBA 1QBBA 2QPUA 3WEOA 2ZUVA 2E40A 4QLJA 1MQQA 3WELA 4JFTA 1FH9A 2WMJA 2TAAA 3AS1A 1JZ4A 1E4MM 7A3HA 2E9LA 1UYQA 2XIBA 4WKAA 1JFXA 4PMOA 1OSEA 4FLRA 1E6ZA 1JXKA 1W3LA 5D9NA 4NI3A 1H41A 1WAWA 1LJYA 1Z32X 2YJQA 1SFSA 1HX0A 2YDRA 1BVNP 5JIWA 1H0IA 3KZSA 3MMDA 4D6CA 4AZCB 2AAAA 3VU2A 3DYMA 1XSKA 2X0HA 1XV8A 2EPKX 3LPGA 1PBGA 3KWXA 1RP8A 4W8LA 5IXEA 1X6LA 1NP0A 1TCMA 2VJXA 4H41A 4YPJA 1XYZA 2DDXA 4BS0A 1UA3A 2XFYA 3CBWA 1E40A 2CIPA 3BSGA 3VD9A 1UH3A 2IXUA 1W1PA 3NCOA 1GOIA 3GDBA 1UWQA 1Q6CA 4H04A 1CTNA 4BQ2A 3RM9A 4AZCA 3AIRA 1E6XM 3AIEA 1HF6A 1E1EA 4H7VA 4UQEA 1Q6DA 3VVGA 4LYQA 1EQCA 4W5UA 1EOKA 1C93A 1UD5A 4WK9A 1F4AA 1E6PA 4PRWA 1KBKA 2WLZA 1TR1A 3OGSA 1UQZA 4E8CA 2WXDM 5A6KA 2CNCA 2XYLA 2XFFA 5A2AA 1TFVA 3OLDA 1E3ZA 1MW1A 2YBUA 3AYSA 1ZJBA 4PMVA 1UKPA 2DEPA 7TAAA 3F5KA 2YIHA 1GHRA 4JHOA 4HMDA 3MKKA 3SCTA 2WMHA 5GPRA 3WDPP 4DM2A 1KXTA 1GQIA 5E0CA 3CUGA 1JD7A 5IFTA 1XD0A 4URIA 1KQZA 4AEEA 4J3VA 2G4FA 1VFFA 3WBAA 2JIEA 2WM0A 4R5EA 3K8KA 1HJWA 1EQPA 3BAJA 5E09A 2RGMA 5BXRA 5FOOA 1MQRA 2XTKA 5EFFA 3ZJ8A 1HJUA 2PWGA 5CSYA 1TMQA 1FP9A 5LYRA 1CGUA 1QI5A 3CMGA 1V6UA 4BF7A 1HVXA 2PWEA 1BHGA 1JZ6A 3IAQA 4JFVA 2VQTA 2VZVA 3L4WA 2J25A 4P8XA 4F9JA 1EHNA 4OKDA 3L4YA 3EDJA 2G8ZA 4J3UA 3F5JA 4UQAA 1SMDA 4UFMA 3WDHA 3SCQA 2GJRA 3UG5A 4D6IA 4BQ4A 2YBTA 3LPFA 3AZSA 1PZ2A 1ZBVA 3SCWA 2WSPA 4KRUA 4DUWA 1LG2A 5BYWA 1GOQA 2VTFA 4W84A 1C92A 1FH7A 3W27A 2WVTA 2J75A 3WMBA 4U2ZA 4AWEA 1V3JA 3CUIA 2VCBA 2W63A 3FXYA 2EQDA 2AMGA 2CCRA 1JGIA 4X0NA 1VBUA 3VDHA 3WQVA 5FL0A 2WBGA 1NP2A 3AMLA 3N18A 4AIUA 3N1AA 1ZB5A 1WDSA 3POCA 2EPNA 3WH6A 4CD4A 5M3WA 5A95A 2W67A 3WNNA 1VFOA 1X6NA 3SCOA 4HOXA 1HIZA 2XVGA 1E0XA 1OWQA 2YDSA 5GNYA 2D20A 4P8VA 2C7FA 2CHNA 1N82A 5I78A 3SUTA 3T09A 1VFUA 2FH8A 3NSNA 3MSDA 1EH9A 4N42A 4NRRA 2EPOA 1GQKA 2ZUTA 1GHSA 1H09A 2DT1A 3BAYA 1RD6A 4J3XA 3GH5A 4QFUA 4LQ1A 1E73M 4X0VA 1R7OA 5FL1A 2PB1A 2W66A 1OINA 3MU7A 3THDA 3OGRA 2D0FA 1JYVA 1BG4A 4J3SA 2YOCA 4UQCA 4XZWA 2GVYA 2J47A 1UKOA 3VIFA 3GXMA 3PTKA 2VX5A 1H2JA 1IV8A 2W91A 5I23A 3GNRA 1WB0A 1LG1A 3W6LA 4EE9A 1EIBA 3ZIZA 5D4YA 3VD3A 2W4XA 4A3YA 3U7BA 2FHBA 1E56A 2WC4A 1OT1A 1WCGA 2DH3A 1W2PA 1NWRA 2G3IA 1ESWA 3BCDA 1ISXA 2BS9A 1H11A 4GQQA 3B9DA 3SCVA 4W88A 3W29A 4JL2A 4OIFA 5C70A 1PJ9A 1ZJAA 1AQHA 3AI0A 5I79A 5JBFA 1XGZA 3CZ8A 1VEMA 1JYNA 3D3AA 2XM2A 4PMYA 2VR5A 3ARQA 4W86A 1OGBA 4XV0A 1V3IA 2O92A 4GIAA 5DEZA 3OA5A 3AHXA 2FGZA 1QNSA 2ZIDA 2XSAA 1E9LA 4D71A 5EFDA 1E15A 3OIHA 1J10A 1VJSA 3CZEA 1V0MA 1EDGA 1CGVA 1DWJM 3II1A 5I5RA 4DM1A 3RM8A 1M7XA 2E4TA 2V38A 1FFRA 1IZKA 1H1NA 4A3HA 1PX3A 2WCSA 4BA0A 1CXIA 3MMUA 3UG4A 3T2PA 3BC9A 1C3FA 1V0NA 1CXLA 2RGLA 1QHPA 3GTNA 3WF3A 4ATDA 1QBAA 1JF6A 3VGGA 3VNZA 1UUQA 2JEPA 4ACYA 3G6LA 4UOZA 2WW5A 4JL1A 4UZSA 1EA9C 1KGXA 1K9FA 1V6WA 1QNPA 1UR1A 4HA4A 3AIUA 3ZMRA 3VGDA 4CD7A 2CBIA 3A4AA 1JXJA 4YN5A 3WUFA 1GOWA 1MFUA 1QI4A 2JALA 3CZLA 4UCFA 3SUVA 3CZJA 4XUYA 1WZAA 4WSJA 2CHOA 1NWSA 1NOUA 2VT0A 1G5AA 3AOFA 5M03A 2WMIA 5IHRA 2EPLX 4PUEA 3K4DA 3BAXA 3PZMA 4UFLA 1KXHA 2EJ1A 1DWGM 4IUGA 1Q6GA 3L4TA 2WHLA 2PF0A 3WY1A 1HP4A 1TE1A 1EDTA 3ARRA 5CJ5A 1W1VA 3F4VA 2C0HA 3ZSTA 3RO8A 3FNDA 2ZOXA 1OT2A 2E8YA 1JDDA 2YA2A 1ZBCA 2CKSA 1VFMA 3WDJA 1DP0A 1WO2A 4JIEA 4W7UA 1ZBKA 3TOPA 4HA3A 2X05A 1GONA 1JNEA 4LGXA 2D23A 2F2HA 1GNXA 4W7WA 2CKRA 4XZBA 2G3NA 1E0WA 5A94A 2OSWA 1LWJA 5D8WA 1QNQA 4UQDA 4P7NA 3ARZA 1B3XA 3WEZA 3WQ5A 1UQYA 4QLLA 2WYSA 1CDGA 5GQBA 2F8QA 3OB8A 1XH1A 1UD8A 4P7RA 4WIWA 4J3TA 1PX4A 3GNOA 1K6AA 5ABHA 3ZT5A 4WF7A 1JDCA 1QW9A 1J01A 2XSBA 1MWOA 2ZUNA 3ZM8A 4MPKA 1QPKA 1ECEA 5A8MA 2W92A 5A6MA 2O9TA 5CLWA 5JIPA 5FCZA 3MMWA 4UOJA 3ZJ6A 4W89A 2FGLA 3DHUA 3ZT6A 1M04A 3HJEA 4GXPA 5ABFA 1JZ7A 3EDKA 4D6DA 4QAWA 4FF5A 4PTWA 4W87A 5LA0A 3WD3A 2CBUA 3ZQ9A 1J9YA 3WNOA 3VGBA 1HP5A 2PWHA 3VD4A 4MB3A 4U5IA 2XGBA 1K9DA 4NZCA 5JBDA 1E4LA 3AROA 1S46A 4DWSD 4J28A 1H5VA 4JCLA 2ZX9A 5ECUA 4JFSA 4AD3A 4ZEPA 2YL8A 3WD4A 4AZIA 1U2YA 3MANA 3UETA 3VGEA 3WNLA 2J7FA 2WZHA 1E70M 1PPIA 2XVKA 3VD7A 3KL0A 2DSWA 4MTVA 2A3AA 1V08A 4P8UA 4AXNA 4HA1A 1E55A 1B2YA 4R27A 4D1IA 3VX0A 3W38A 2ZX5A 3LPPA 1XHGA 2XWEA 1D3CA 2BV9A 1BF2A 4QDMA 4GZJA 4W85A 5BRPA 1FOBA 1BG9A 3GXDA 5HNNA 1ITCA 4CCDA 1FA2A 1QHZA 4PSPA 2J7DA 2QMJA 3WN6A 5HOSA 1DWFM 5I0DA 3W25A 2XJ7A 5A2BA 4AD4A 4JKLA 2ZWZA 2ZXAA 1ISZA 4AYSA 3VDCA 1CXKA 4Z2GA 3NJ3A 1GOOA 1E4NA 3AZRA 3AJ7A 4XB3A 4V27A 1D2KA 1UKTA 1XH2A 4GI6A 3AICA 4QCFA 1M01A 3VGFA 2VX4A 3VGHA 1CENA 4AZGA 3ZSSA 1QI3A 1KB3A 2GSJA 6A3HA 2YA0A 1Q6EA 2J74A 2VRQA 3LPOA 3MO4A 2J8FA 2YL5A 3A4WA 1JG9A 1E71M 2VNCA 1XC6A 3ARTA 1FH8A 1EGZA 5BXPA 1E5JA 3NDYA 4CU8A 1HNYA 2AOSA 1E43A 1C7SA 3CO4A 7CGTA 2CXGA 2Y8KA 4GI9A 1UG6A 2D0GA 3PZOA 1BYBA 2D3LA 3MUZ1 2DT0A 1AQ0A 2XVLA 2YDQA 3WD1A 1ODUA 2WK2A 1HL9A 4CU7A 4MAZA 3CZKA 2Q8XA 4WLCA 5FKYA 3NUKA 3CUJA 1Q6FA 4M1RA 2ZXQA 1MXGA 3OLEA 1E6NA 3J7HA 2OWXA 5ABGA 3VUPA 2IUZA 5I77A 3VIHA 2A3EA 3WUBA 2Y8VA 1WNOA 3WFZA 2DSUA 3A3HA 4UR9A 1W9PA 1JFHA 5CGTA 2NT0A 2OLHA 3UG3A 4U2YA 3NSXA 2WHMA 3VO0A 3W6MA 3A47A 2ZX8A 1K9EA 1JZ2A 4GINA 1AMYA 3G6MA 3BAWA 1UWUA 3WDIA 1CECA 3MV11 1MYRA 1NWUA 3GXFA 3W37A 2VZUA 2Y4SA 3WH9A 3FHQA 2JIWA 1CPUA 3O6AA 3SCSA 2GJXA 1GQLA 3BAIA 4Z2IA 2BY2A 1J0YA 3BMWA 4N0RA 3O2LA 2VVSA 4H2CA 4UFJA 4HU8A 4EK7A 3IANA 3AHTA 4E8DA 1LLOA 2CESA 4D6JA 1E0VA 3VOCA 1KXQA 1JF5A 4CCCA 4MB1A 2GJXB 1U33A 2VX6A 4ML4A 3KEHA 1X1NA 3W82A 1GUVA 3VPLA 1LWHA 1JYWA 1NWTA 1UWTA 2O9RA 3RJXA 3L4VA 5E6YA 1HJVA 3PZNA 4CVUA 2XIIA 4PEEA 1NOFA 2WBKA 4CN1A 1CYGA 1V3LA 3U7VA 3VM5A 4MNJA 1QVBA 1BSIA 1I1WA 3JUGA 3WF1A 3VIGA 3BMVA 1ZBWA 2PBOA 2D1ZA 1GZJA 2JF6A 5IFPA 4U5KA 3N11A 2QV4A 4DWSA 4M29A 4IM4A 4MADA 1C7TA 2WKLA 2EPMX 1NOWA 2J8GA 1KWKA 5A2CA 4YHGA 3ARYA 3S6TA 1WE5A 3UR7A 1H3GA 2DPEA 2D22A 1UWSA 4S3KA 1TG7A 4KWUA 1LF1A 2PC8A 3T0DA 3M07A 1J0HA 1HKIA 3SUWA 1QNOA 3PZVA 2UY3A 3WH8A 4CD6A 3FHAA 3AIWA 3T2QA 1ZS2A 5DO8A 3N15A 4B3LA 4GKLA 5ABEA 5A8NA 4K68A 3AMCA 4FMVA 4HMEA 5A6JA 3B9EA 3AZTA 3AHZA 2EBNA 4WJXA 1DWHM 3ARXA 4L4PA 1W1TA 4UFHA 3SCRA 8CGTA 4U3AA 1B3WA 2VURA 2DQXA 3PN8A 1QNRA 4WKFA 5HPCA 3ARSA 3W28A 3BGAA 4PMDA 4RE2A 4D6EA 1CLVA 2FHCA 4BCEA 2ZUUA 5CSUA 3AMDA 2Z1KA 4AC1X 1AVAA 1P6WA 1W32A 4U31A 3WL1A 3L2LA 1KGUA 3NIYA 3WKZA 1CWYA 3IJ8A 3MUIA 4AZ6A 1BQCA 1XCXA 4IISA 2ZX6A 3VM7A 2ZUWA 1CIUA 3ZJKA 4TX6A 1RP9A 2O9OA 4PBGA 1XH0A 4M56A 1R7AA 1HKKA 4Q7NA 1GW1A 3UERA 1J12A 4TXEA 3ARVA 5CG0A 3W81A 1EHAA 4FLSA 2A3CA 3EMQA 1BVZA 3PTMA 4M81A 3KE0A 3RJYA 2WVVA 1KBBA 4GI8A 2FHFA 3TP4A 1UH2A 1OD8A 3RMEA 3MSGA 5DMYA 3FN9A 4KH2A 2G3MA 2EEXA 2J62A 4J7RA 3ZOAA 3ALFA 3AYRA 1CGWA 4MNLA 3MUAA 3VKKA 1ISVA 4UOQA 3UEQA 3CHCA 3ZR5A 1HJXA 3PZ9A 2DT2A 3AIBA 1XRVA 1NM9A 2Y2WA 4Z2KA 1UD4A 1YQ2A 3OZPA 4QLKA 3PZTA 4CVWA 1O6IA 1UKSA 2VCCA 1BPLB 3BLPX 1WDRA 1SMAA 4LXFA 2GDUA 2GUYA 1BLIA 1WPCA 5A6BD 4UZUA 3PZGA 1UD3A 4PCTA 1RPKA 3VIOA 1JDAA 1GJWA 3L4ZA 3VDBA 2D3NA 3EDEA 3IK2A 1AQMA 2WVVB 3GXIA 3WUEA 3GH7A 3CHFA 5IHSA 3EYPA 4Y7EA 1H0GA 4HOWA 3VIPA 4IPNB 5A8PA 1GVIA 1GJUA 1BGGA 1B9ZA 4LYPA 1W9UA 3BAKA 2OSYA 2ZX7A 1VEOA 3PBGA 1DTUA 4S3JA 3QR3A 1G9HA 1UR2A 2VQUA 2G41A 1G01A 3WNKA 3L4XA 4DWSB 2VI0A 4DUXA 4OZOA 4CKQA 1US3A 1OGSA 2WANA 1E6SM 3ARUA 3CUFA 4HPHA 3OZOA 5CXPA 1B30A 2J7CA 1K9TA 4PN2A 4DWSC 1NARA 1EOMA 2JE8A 1A47A 2W62A 4Q22A 3N13A 2YLLA 1HN1A 1PEZA 2VZTA 3T0BA 4AD5A 2D2OA 1DEDA 4CU6A 4WKHA 1LL6A 1WDQA 4NSBA 5D8ZA 2GK1B 3WUGA 4BZYA 1CXFA 5A6AA 1HL8A 3N04A 3AXIA 3F5LA 4W5ZA 1VAHA 4PSRA 2X09A 6CGTA 4HOZA 3WDQA 1HJSA 3L4UA 4D72A 3ZT7A 4CD5A 1VENA 1VIWA 1QHOA 2J78A 5E0FA 2E9BA 3PZUA 2VMFA 1UZ1A 1HKJA 4LX4A 3WENA 2QF8A 3M7SA 1OB0A 1BYDA 4F8XA 4KMQA 4GO9A 2VVNA 5LA2A 5F7UA 1MW3A 4ZE5A 1UR8A 3SURA 1KXVA 3A6OA 2WMFA 4AD0A 2QMKA 1GCYA 2J79A 3CPUA 4C7GA 1E3XA 1OGGA 3SCUA 2V3GA 1WP6A 3RILA 2XWDA 3FW6A 2EO7A 1PIFA 3FAXA 4GQRA 4A4AA 1CEOA 2WMGA 3SUSA 3RCNA 1KWGA 2CYGA 4HPGA 2VO5A 3FAWA 2J7BA 2DGAA 4PYSA 1TVPA 1OCQA 2BVDA 4H8HA 3BCFA 4F79A 1OBAA 4TVUA 1EO7A 2BVYA 4MJ2A 2XUCA 1JAKA 5CQ1A 3AIVA 1VB9A 5M17A 1E1FA 2ZWYA 2WVSA 3K8MA 1I75A 1KCLA 3HN3A 1GOMA 3RPMA 3TTOA 1QI2A 3VX1A 1DWAM 4JAWA 3VDAA 1NQ6A 2BY0A 1JL8A 5BCAA 1HJQA 2Y24A 5HBFA 1NH6A 3B9AA 3OGVA 2GFTA 3ALGA 2DSZA 2ZXDA 1C8QA 1J0JA 1I1XA 1R85A 3DECA 3U5UA 3TTYA 2VRJA 4HZ6A 4P7LA 4MNMA 5A8QA 1JI2A 1OIMA 4RE3A 3SCPA 3AFBA 3OG2A 3MUY1 4FLOA 4UQ9A 1JAEA 4CGTA 1OM0A 5KZ6A 3HU7A 2VC9A 4B15A 4F9DA 1PX8A 2WB5A 5I3DA 1UKQA 3WF2A 4AZ5A 4ZE4A 5DFAA 1J11A 2WMKA 3RM4A 4C7DA 2CPUA 1J0ZA 5BWFA 4U3CA 5DF0A 3KL5A 3M6DA 4L4OA 2DT3A 5A8OA 4MDOA 4M82A 2ZUSA 3QOKA 2C8NA 1BYAA 4HZ8A 1B3ZA 1D7FA 2NT1A 3TTSA 4PMXA 3WNMA 4UFKA 2BNJA 1CXHA 3W26A 2E0PA 3S2CA 1GPFA 4E2OA 1V3MA 4FLQA 1VF8A 4PUDA 1QW8A 1W9VA 1Y7VA 2WVUA 3AISA 1UR0A 4HTYA 4OOUA 1V3HA 4PMNA 4AZ7A 5A69A 4UFIA 5A6LA 1Q4NX 4D6HA 3IAPA 1YHTA 1CBGA 2UWFA 5A6BA 1U30A 1V6XA 3AMGA 3WD2A 2OYLA 3ZO9A 4AMCA 3K8LA 4GZEA 4TTGA 2BHZA 3BH4A 2PWFA 5IDIA 5FD0A 1GVYA 3M46A 2OWCA 3TTQA 2XFRA 2Y5EA 5ABFB 2WNWA 1XSJA 3N9KA 2FH6A 1L0PA 2VZOA 1TA3B 2BXZA 1CXEA 2BFGA 4MJ4A 1UD2A 1JZ3A 4PCSA 2WHJA 3UCQA 5BXSA 1M53A 4AIEA 3TA9A 1PIGA 5AYIA 3A4XA 1W9BM 1R86A 2YLAA 3WQ6A 1WKYA 5D9PA 3CHDA 4PMQA 2PI6A 4HZ7A 4HMCA 5EBAA 1TZ7A 2GJPA 5M5DA 2ZXBA 1LQ0A 1ITXA 1C8YA 4AD2A 3WH7A 5I24A 1CGTA 1UR9A 3AXXA 1LL7A 1W1YA 1W3KA 3N17A 9CGTA 4M80A 4TTUA 1EDQA 4CD8A 3EMZA 1V0KA 4JHZA 4JFWA 1PZ3A 1H49A 2BY3A 3GYCA 5A3HA 1QOXA 1W3JA 1VJZA 1JI1A 3GBDA 4UNIA 1OIFA 2WC7A 4PTMA 3WDRA 5CGMA 4WSKA 4M24A 3GBEA 4EANA 2J7HA 1UA7A 1FFQA 2OSXA 4AZBA 5I6SA 5KEZA 2VOTA 3CUHA 1KR1A 2XGIA 4GO8A 4TX8A 5C71A 3AHVA 3QHOA 1G1YA 2V5DA 4QCEA 2DSVA 3VINA 2XVNA 4HU0A 4JKKA 5CPTA 3D5HA 3ZR6A 2QHAA 3ARPA 2VX7A 1E4IA 5E9AA 2WPGA 2WZEA 3ZJ7A 4JCMA 2XHYA 4MB4A 4C7FA 1HXJA 2VR4A 3ARWA 4ACZA 1OD0A 3CZGA 4PTXA 1ODZA 1ZU8A 2WAGA 5CPQA 1XD1A 1CGXA 3QHMA 4MNKA 4ATWA 1JIBA 3QGVA 3L2MA 3APGA 4B9ZA 3WFLA 1BTCA 4EAMA 1BAGA 4W8BA 4W8AA 3WEMA 2X2YA 2J4GA 2XG9A 1IT0A 4LYRA 3THCA 4JKMA 1MXDA 4ATLA 3W0KA 3PTQA 1KGWA 4RL3A 2EXOA 3GNPA 4EKJA 3CMJA 1B31A 2G3JA 1MW0A 4IPLA 3CIVA 3RDKA 3AIQA 3WQ4A 1B90A 2V3FA 4J27A 5D9OA 2UY5A 2V3EA 1GORA 4KGJA 2WLYA 1CZ1A 3PZQA 3RIKA 5HXMA 4TUFA 2J77A 4KGLA 1UWIA 3WIJA 8A3HA 1R8LA 4W7VA 2PBGA 4TVCA 3CH9A 1V03A 2XM1A 2CBJA 2WSKA 1TUXA 3IJ7A 1RH9A 4H8UA 1V02E 1VRXA 3SEPA 2E9MA 1E6RA 4OUEA 4UQBA 4U33A 3OBAA 1BGAA 5AY7A 2W5FA 3SCNA 2V5CA 3SIMA 4P7OA 1WZMA 3AXHA 1B3YA 3B8SA 4DUVA 2CITA 3VIMA 1FHLA 1US2A 1MVYA 4TOQA 4AIOA 2WCGA 3WNPA 1W2VA 3GM8A 2NSXA 1MW2A 1C91A 3O9NA 4PMUA 1JZ5A 2QPSA 5CZKA 2DH2A 3W24A 3K4AA 3MV01 4BQ3A 5LA1A 2VZSA 2BVTA 1V3KA 3T08A 4YHEA 4W93A 3VMNA 3VIJA 1VBRA 2YA1A 1SYTA 4TVDA 4AEFA 1QI0A 3NYDA 1B1YA 2VL4A 1UZ4A 3POHA 4V2XA 4P8WA 1WDPA 3T2OA 4CN4A 4JZ5A 1UWRA 2WWDA 4MB5A 2OWWA 1JYXA 3IJ9A 3VNYA 4AY1A 2ZUMA 2DSKA 2BY1A 2GK1A 3MS8A 3AQUA 2CBVA 3WL0A 3AS3A 1L8NA 3VMOA 1FHDA 1JD9A
chains in the Genus database with same CATH superfamily
1E1CB 4ZXOA 1YXDA 3AS2A 5DT7A 1ICPA 4XZLX 4LSBA 1VBJA 2DIEA 4G7FA 3MDWA 2YB1A 4ORIA 3FJLA 4Z2HA 2R1PA 4B16A 2XPKA 2AL2B 2YCJA 3NPWA 1NF0A 4A3QA 5EMYA 3OLIA 1M7PA 4B4HA 4I9AA 1JPMA 3IGSA 3USZA 1L2UA 3W1PA 1H7OA 1F6YA 3QFWA 5DT5A 5JBEA 2GDVA 3UXAA 3LBCA 2G0WA 2XN0A 1PAMA 4NNCA 5BROA 4ZENA 3I3BA 2EKCA 3W2JA 3WQWA 2I57A 5D03A 3T81A 2WHKA 1DKWA 5D32A 2E3ZA 2ESCA 3M0JA 3VILA 3M0VA 1OFRA 3R12A 2E6DA 4CLMA 4XUGA 1IIGA 1V02A 3WMCA 1OK6A 2Z2BA 2QXWA 3BOLA 3AUOA 6TIMA 3K1DA 4B3KA 3HQOA 3S5SA 2ZE0A 3V0UA 1OEPA 4ICCX 4ZA0A 2PDBA 3LMZA 1XIHA 3V0TA 5I00A 3A13A 3W53A 4DYEA 5CC5A 3DC0A 4ZBCA 3MI3A 3VNMA 1Q4WA 2KZHA 5HAOA 2CETA 2E8ZA 2PLMA 2E1DA 2C3ZA 1XYMA 4DZ5A 2V2DA 4JTRA 2OOGA 1UP2A 3OVQA 4GPNA 4PC8A 3FY1A 4I7UA 1FKXA 3KVJA 2OO0A 3EXTA 5T9CE 1GEHA 2X0YA 3PHAA 4XX6A 1V6VA 2PGEA 3B04A 4UR8A 3NGJA 4NXKA 4AD1A 5CG7A 2X8RA 3U57A 4IUOA 1ALDA 5JUVA 3PJTA 3CV2A 4KWVA 4GY1A 5HUPA 3QHNA 3UBPC 2F61A 3DYOA 4ERAA 3WLIA 4KERA 3CYVA 3VAVA 1F61A 5EB8A 1UCWA 1ADOA 1HVQA 3TYUA 3VIIA 3KRUA 2V67A 2P88A 2XIJA 4A21A 3P5YA 3TOYA 2ANUA 1A5LC 4D6FA 1F4HA 1SW0A 3K46A 3KTXA 2VFEA 1JNDA 4PB5A 4DO5A 3PG8A 4QNEA 1V93A 1ZPTA 3GX9A 5FIPA 3TAKA 1FCBA 1X6UA 2O9PA 3OQEA 4A8RA 2FZDA 3LTYA 5CAHA 4QGCA 5I3HA 3K13A 3R5EA 1GOKA 3OJGA 1B0IA 5A1AA 3VUSA 2GUBA 1UR4A 3IGHX 2O0TA 4Y9NA 1H4PA 2IXVA 1P1MA 1UOKA 5AC5A 1X96A 1LUCB 1LBLA 2J13A 3WF0A 2HEJA 2Z1SA 3MDUA 1XG4A 4AISA 2J7GA 2B31A 2C16A 3GHRA 5CBIA 3Q65A 1F5ZA 3P2VA 3CHEA 2PDHA 3FJ4A 4RZBA 5TIMA 1REQA 2V81A 4DEFA 3CTTA 1XUZA 1L6YA 1SJBA 1FTXA 3CAVA 4DBEA 1KFJA 4LY4A 4CCEA 3LHWA 4ZO7A 3LMYA 2OYKA 1Z48A 3W88A 2XZ9A 1C8XA 3TONA 4KWWA 3BOFA 5JVLA 5AZ1A 3SRFA 1W3HA 5HMSA 3B40A 3QLLA 5CEWA 2JFEX 5MKGA 2CZVA 2BXYA 2NX9A 3HURA 1W9XA 5AYBA 1G7UA 3WEOA 4MGGA 4MG4A 3P5ZA 4JN6A 1WA3A 4JFTA 4JQ3A 3H2CA 1SO5A 2TAAA 3D3FA 7A3HA 2YXXA 1JVNA 2XIBA 3H2EA 3LNMA 1S2UA 4HYRA 3TFCA 2EG8A 2DIKA 4S3DA 1H41A 1LJYA 2YDRA 1QPNA 1H0IA 3KZSA 4GOAA 3MMDA 3W7QA 1K6WA 1XSKA 2REQB 1XV8A 2EPKX 2Z1BA 1J5SA 1TWSA 5IXEA 2W6RA 4JTFA 2Y7EA 3HPSA 2FPYA 2HVNA 3LM7A 5HNUA 1PHWA 1H1ZA 1UUOA 4Q8WA 4L65A 4MUPA 4JQ4A 1EWEA 5D38A 5K4ZA 1XDJA 5D2YA 3S3GA 3IIPA 1IIHA 3NCOA 1XUUA 3EPNA 4LEFA 1X98A 3W7JA 1UWQA 2NVDA 3AYTA 4YYCA 3GIYA 3RX4A 3AIRA 1E6XM 3HGOA 5D2WA 3QV8A 1ZQ5A 1HF6A 2B7QA 4H7VA 2B0MA 4NY2A 1DQUA 4RDZA 4LYQA 4WK9A 1TELA 1SM9A 4E4UA 2RDUA 4PRWA 4ENLA 3M5VA 3N2CA 2Y7GA 4ZL1A 2ZRXA 5A6KA 1FWCC 2XU2A 2XYLA 4MYAA 2XFFA 5A2AA 1A5KC 3D47A 1E3ZA 1Q5MA 2DEPA 2FPVA 1PCWA 4O1DA 6XIAA 3WQEA 3ITYA 3T6CA 3F5KA 1IXNA 4JHOA 4LVBA 5GPRA 1AD1A 1A3WA 1GYNA 3LLXA 2Y63A 1GQIA 1TIMA 3M44A 3UFYA 1GPWA 1XD0A 4URIA 1KQZA 2O4QA 4NAEA 4J3VA 3K8KA 3BAJA 5AHNA 5E09A 2XTKA 5EFFA 4QBXA 1TMQA 5LYRA 1KFBA 1FWEC 1JZ6A 3VOFA 2VQTA 3OPSA 3L4WA 3RX2A 5AC8A 4J40A 3EDJA 4J3UA 2V6AA 2CC0A 1EIXA 3GKAA 1SMDA 1M9HA 1W54A 4D6IA 4EPKA 2PP0A 1H1YA 4BQ4A 4ZB5A 2HPIA 2IKGA 2YBTA 4H2HA 2LLEA 3LPFA 1TVLA 1DXIA 2R82A 2ACRA 1GOQA 2PDMA 4TU1A 5CSRA 1GWJA 2BSLA 2HK1A 3W27A 5K2ZA 2WVTA 3ANVA 3REQB 2J75A 3WMBA 4YU1A 3VKBA 3E2RA 1W8GA 4CQCA 1V3JA 1Q45A 4OVXA 4X0NA 1H7RA 2GJNA 1JCLA 1L6WA 2VFHA 3O0KA 5C5YA 4CD4A 2W67A 4JTJA 4WDTA 3SCOA 3F2CA 3SFWA 4LUTA 4F0SA 1ONEA 3TUUA 2D20A 4GABA 2CHNA 4FF7A 3QRHA 4LUYA 1N82A 5I78A 1PKMA 3PUEA 2Z2AA 4RCXA 4YTSA 1DXFA 1EP2A 3PC0A 4O28A 2EPOA 4GNVA 1I0DA 3MSRA 4HN8A 1GHSA 2DT1A 2PDPA 4RNHA 1Z3NA 4ZODA 3EOOA 4R7JA 5FL1A 4LB4A 5EA9A 1UJPA 4Z1AA 5CBJA 1ZJIA 3URQA 2QV5A 3HO8A 3LHUA 3PG9A 3VIFA 1O5RA 1XPGA 1XICA 5G4EA 1Q2SA 3LHTA 4Q7IA 3ZS4A 4EE9A 3W6LA 2VGIA 1IXOA 4A3YA 2DORA 4ADUA 2XIMA 3URBA 4O0QA 1NWRA 1WXZA 2G3IA 3V0SA 3HMJG 4PCNA 4CEUC 3PAJA 4C5ZA 4Q4SA 3SCVA 4W88A 2ZKMX 5C70A 1K4GA 3PTDA 3AI0A 3WLKX 2FJUB 1W6TA 1YPIA 3CZ8A 1A4MA 4YTRA 1SZFA 3KS5A 3D3AA 3ARQA 4W86A 4DXKA 5IM51 1RJRA 2PMQA 3OA5A 1QNSA 4O1CA 4AHOA 1Z9AA 3LERA 3M43A 1XYBA 3II1A 3NQGA 4GGBA 1XDLA 1M7XA 1YDNA 2E4TA 3CQJA 1IZKA 1H1NA 3FV9A 3W00A 4A3HA 1IEXA 3MMUA 5LIYX 1DIEA 1ML1A 4ATDA 2NQHA 3DG3A 3FEQA 3VGGA 7REQA 3VNZA 1R3RA 1UUQA 3O16A 4ACYA 3G6LA 4UOZA 4B5NA 4UZSA 1FWHC 4L9XA 1V6WA 1K9FA 3BANA 1QNPA 1XLEA 3QFEA 4CD7A 2CBIA 1JXJA 4YN5A 1DIDA 3WUFA 1XIIA 3GG8A 4ZOBA 1R46A 1MFUA 3O07A 4WSHA 3QKEA 3RX3A 4YS1A 1UC4A 3SY5A 1K03A 3NEVA 2B4GA 3B8TA 1XIBA 1QWKA 1VD6A 4PUEA 1W3IA 3K4DA 1DJQA 3BAXA 4UFLA 4IUGA 1Q6GA 2WHLA 1M3UA 4CNUA 3UA4A 3KHJA 2QJGA 3WJSA 3UWEA 1CB2A 1XBXA 2VUNA 3ARRA 3F4VA 2C0HA 3ZSTA 2V82A 3NO1A 4L6OA 3FNDA 3TXVA 2ZOXA 4ZOCA 2RDXA 1VFMA 2V8ZA 4JIEA 4GVFA 4HA3A 3CTLA 1DE6A 2V5BA 1JNEA 2F2HA 5I09A 2QUUA 1P4CA 4L6HA 4Z1DA 1OC5A 3W9ZA 4DI9A 4XZBA 1DJYA 3S2JA 2GL5A 5B7ZA 4UQDA 2VEPA 3MP3A 5LSMA 4QLLA 2GQ3A 1U83A 4L80A 3KWSA 1MRAA 1ZAJA 1QOPA 4RNIA 5CGQA 1GEQA 5ABHA 1OHLA 3ZT5A 4JTEA 4N4QA 4WF7A 2R1NA 2HNEA 6XIMA 3N14A 2ZUNA 3UGRA 2AQVA 5G2HA 4TMBA 3W2NA 4O1EA 4LCRA 2PU1A 3E3HA 4M19A 3ZT6A 4GXPA 3O6CA 3TX9A 3NQ8A 3GG7A 5LA0A 4NU7A 3ZQ9A 1J9YA 4J2MA 1HP5A 4UIOA 1SVDA 4DBWA 1KBLA 4C5YA 4U5IA 2G37A 2XGBA 3M1ZA 3UZWA 4X2RA 1E4LA 5AYXA 1AL8A 4DWSD 3LQGA 5LXXA 2ZX9A 3THUA 4TQTA 4ZEPA 2Y89A 3MANA 3SY8A 5B80A 1V51A 1POKA 2WZHA 3KL0A 3A5VA 2R14A 4MTVA 2OPJA 2VGGA 1RJPA 1B2YA 1R0MA 1OF6A 4G2DA 4R27A 2XWEA 4JBRA 1D3CA 3CQ0A 5AN7A 2IS7A 1BRLB 3G1SA 3QN3A 4QDMA 1RHCA 4DBDA 3WQDA 1FOBA 3G0XA 3IGXA 3GXDA 2I5IA 5EY5A 3VKCA 1FA2A 3F1QA 3S1UA 1YYAA 4P2VA 1MI3A 3DGRA 3TNOA 3BLEA 3H24A 3W25A 3S2MA 1M5WA 4UTIA 2V30A 2FB2A 4AYSA 4OQVA 3U6WA 4A29A 3NJ3A 3AZRA 4XB3A 1UP0A 2Z24A 1B9BA 3C2OA 2QDDA 2NQ9A 2VKZG 1M01A 5I3KA 3OU8A 1UMYA 5TAOA 2Y70A 1LQAA 3S6OA 1HQTA 3LPOA 3MO4A 3R7MA 1JQXA 4K7YA 1JG9A 1E71M 1JR1A 1O68A 4U4MA 1E5JA 2AOSA 3QLDA 2FJKA 1E43A 4YTUA 4GI9A 2D3LA 3W74A 5F2GA 2DT0A 1M7OA 1ODUA 1XM3A 2WK2A 1HL9A 1TTIA 4LS2A 1H63A 2CW6A 3C8NA 5FKYA 1Q6FA 4M1RA 2ZXQA 1MXGA 1AJ0A 1Y5XA 4RX0A 1E6NA 3STFA 3VUPA 3VDGA 2IUZA 2FTPA 2Y8VA 5TQLA 1KRMA 1XISA 3JZUA 1GOXA 1MSSA 3CWOX 4AXKA 4YMZA 2H9AA 3R94A 2Z0IA 1NELA 3BICA 3UG3A 4U2YA 3NSXA 3VK5A 2WHMA 3A47A 1Q63A 1AMYA 1T40A 1UWUA 4K1GA 1MYRA 3W37A 4JXCA 3WH9A 2VD8A 1TWWA 5C54A 4TV6A 2BY2A 1J0YA 5C9UA 3W73A 2CWXA 1KV5A 1S38A 4S1FA 2VVSA 4H2CA 3CQIA 1OFQA 4HU8A 2AAMA 3EB4A 1SU5A 4E8DA 1LLOA 2CESA 4D6JA 2OGJA 1JDFA 5DLCA 1BTMA 4MB1A 4WXYA 1UZDA 4ML4A 4LRTA 2GWNA 3I65A 2F6KA 2YPIA 1LWHA 1R3QA 3S0CA 2O9RA 3L4VA 1HJVA 3PZNA 4LAUA 1NOFA 4GI4A 5KSWA 1S2WA 1QVBA 4MJMA 1YPFA 3GWQA 4R34A 3NEHA 3BMVA 4V33A 3BGJA 1C9WA 2D1ZA 3E5PA 4PUWA 3PK7A 3UZYA 4M29A 4IM4A 1W5PA 3N2XA 1XDMA 2WKLA 3UT0A 2EPMX 5CKSA 3PB0A 4Q6XA 1NOWA 2J8GA 3QSRA 3IJDA 1KWKA 5A2CA 1WE5A 1A3XA 3R79A 4O1BA 3H8AA 3ZWSA 1RALA 2D22A 4AWSA 4DO6A 1YDVA 3C52A 1LF1A 3HG4A 2PC8A 4KWUA 2GGGA 4HIBA 3NG3A 3E96A 3WH8A 4IGHA 4B91A 3FHAA 1UPMB 4TIMA 1LROA 4GKLA 3UPMA 4KCUA 1WV2A 4FMVA 2DZUA 3VKAA 5DQPA 3QGAC 1DWHM 1VCGA 4L4PA 1W1TA 4UFHA 3SCRA 3OA3A 4MKVA 4ZO9A 2BBFA 4C6MA 1QNRA 3M4HA 3R4IA 5HPCA 3ARSA 3HPZA 5HWJA 3PULA 3WYZA 1ZLPA 3W75A 4D6EA 4H6QA 4BCEA 3CAQA 2Z1KA 2QULA 3GR4A 4U31A 1XG3A 1KW1A 3WKZA 1FRBA 5BOOA 1M6JA 4AZ6A 4NJKA 2A85A 2A5HA 4IISA 2F6XA 4LNYA 3ES7A 1YW1A 1PTGA 3JU2A 3FLUA 3ZJKA 1RP9A 2Q6ZA 4Q32A 1XH0A 3DG7A 4M56A 4JYEA 1XXXA 5IBXC 4GC3A 4F0MA 4XZ9A 4YLWA 4C6KA 3TA6A 1EX1A 3ARVA 4PB4A 2OKOA 2C15A 2X7WA 3LLFA 2VGFA 4KCWA 3MB9A 3VA8A 1BVZA 4GUHA 4M81A 5MKGB 4FI4A 1KBBA 3H26A 1TX2A 3WLHA 4S2BA 2KX9A 3G2GA 2INEA 2XH2A 2D2JA 3RMEA 2QKFA 3EX4A 1XCFA 3MSGA 2HPMA 2G3MA 2J62A 2WSRA 4LV9A 1AFSA 5FJUA 3SGGA 3LU2A 2BASA 3VKKA 1ISVA 4UOQA 4RDYA 1HJXA 2PLCA 5HMFA 3F4CA 5IDZA 4Z2KA 3EXRA 3QMTA 4PCFA 1NFPA 2PTXA 2VCCA 1QR7A 3LBMA 3PF3A 4JTAA 4WY0A 1AJZA 4FXJA 3E0WA 1SZRA 4R9OA 3WQGA 4YXGA 4HHPA 1JDAA 4IGSA 3VDBA 2D3NA 4MSSA 1AQMA 3CHFA 1KC7A 4H8NA 3XISA 1VRDA 1J6OA 1M65A 3NZRA 1WUFA 3N6HA 1K8CA 5FESA 2ZZ6A 1GJUA 1B9ZA 2E68A 4LEQA 5T91A 4WUIA 4DQWA 5AECA 2B81A 2ZX7A 5DRCA 3QF0A 1ENUA 4N9DA 1XRTA 1XR2A 2A7RA 5XIMA 4M7TA 1G9HA 4NNBA 2G41A 1ZRQA 3W1QA 3UVAA 4XZNX 1XLLA 1E6SM 4HPHA 2Z00A 4OUIA 4WEVX 4FA3A 4Q22A 3BW2A 3GW0A 3N13A 1PEZA 3T0BA 2D2OA 4WKHA 5D05A 4TO8A 1LL6A 5D8ZA 4BZYA 2R1KA 2GSHA 5I02A 3N04A 3L5MA 3AXIA 4W5ZA 1KFCA 1KRBC 6CGTA 1E1CA 3H22A 1Z8AA 3MVTA 1YTKA 1XPYA 3H2AA 1HJSA 3GB6A 3L4UA 3IACA 3GDRA 1A5BA 3MUCA 4UTKA 5J04A 2E9BA 5LIKX 2VMFA 5LHFA 3M7SA 3M6YA 3DI0A 1OB0A 4IQJA 3GE7A 4H4IA 2VVNA 4YWIA 2E28A 3S5NA 1KXVA 1EZ2A 3U2EA 2J79A 3UXLA 2VENA 3A12A 1HFBA 4FO4A 3H2NA 1S3HA 3C86A 1XLBA 1OCJA 2ADAA 1CEOA 2ZYFA 4PUMA 3SUSA 3DESA 1RLDA 1VP5A 1XLHA 3RCNA 3AO0A 3FAWA 3PANA 4I6KA 1TV2A 4DWDA 3WLSA 4J1OA 4QQ3A 1WYIA 1RXOB 4JYFA 1E1FA 2WVSA 3HG5A 1W1ZA 2HS6A 3VDAA 1JL8A 5DBTA 5BCAA 1ONXA 3TLLA 4FNSA 3G8EA 5T8GA 3K30A 3MBFA 5C9ZA 4REQA 2ZE3A 2W3ZA 4EWND 3U5UA 5D02A 2V5LA 1XLGA 1FCUA 3E0FA 4MNMA 4EXAA 4YCPA 3C8FA 4G1KA 4RE3A 1W56A 1S39A 3HM7A 1VFLA 2DZSA 4WDWA 3OYXA 5FSEC 1EYWA 2BG5A 1UKQA 1EP1A 4ZE4A 5HJYA 2O56A 1BRLA 4LS1A 2WMKA 3MZ2A 5CC3A 2DV0A 2CPUA 1VLIA 5BWFA 4RNFA 1TREA 2P1FA 2ZUSA 5ECVA 4GIYA 4LAOA 2NT1A 3S46A 3B06A 3WNMA 1VYRA 4UFKA 5MF5A 3IWPA 1CXHA 2DP3A 3W26A 3EX2A 2E0PA 4CNOA 4E2OA 2YYTA 4FLQA 3CUZA 1VF8A 4PUDA 4US6A 5BWAA 3AISA 2WNNA 3DBPA 4HTYA 3BLOA 4AZ7A 5E9XA 1S2AA 3FA3A 4XBJA 3P74A 4S38A 3TW9A 5A6BA 3U3HA 2QCEA 4IIDA 1MEWA 1V6XA 1NFBA 4CQBA 2VWSA 1R2RA 1WOBA 1J93A 3WK3A 4GZEA 5KITA 3NQMA 1GVYA 1N8IA 5ABFB 1XSJA 3N9KA 1PB0A 2ABBA 2VZOA 2BXZA 1CXEA 3A21A 1UD2A 1Q6QA 4X61A 3E49A 2WNQA 3IJQA 5BXSA 3T78A 3TFXA 1M53A 3TA9A 3U4AA 2QT3A 1R86A 2YLAA 4RZ6A 3GFZA 3CHDA 2QCFA 4FR1A 1LP6A 3R8HA 5EGRA 4KWSA 4LJ3A 1TZ7A 2GJPA 4GJ1A 1F3WA 1SSGA 3KBNA 2ZXBA 3Q58A 1C8YA 3WH7A 1CGTA 7REQB 3UD6A 3N4AA 3EWWA 1DQWA 3EMZA 3V18A 1ZTVA 2BP1A 3GYCA 1DJWA 3WQFA 5A3HA 1W3JA 2I56A 1VJZA 3IJIA 1JI1A 1OIFA 2XN1A 4PTMA 2IKHA 2A6LA 1Z69A 3BUVA 1FFQA 5I6SA 1KR1A 3KVKA 1W5NA 3A5FA 3EOEA 5CPOA 2ACQA 3VINA 1SZNA 2PSNA 3FJ6A 4H7CA 4INFA 2PDKA 4JS3A 3G1HA 3OZYA 3ANYA 1PTAA 5E9AA 1W3TA 2WZEA 2X42A 3ZJ7A 3CWNA 4BI6A 4QJ4B 1E9ZB 4NP7A 1E9YB 4IJRA 5DRIA 4ACZA 2I1OA 3CZGA 4IIFA 4IX2A 2WAGA 5I06A 5EU9A 1CGXA 1H62A 3QHMA 4E38A 1PIIA 4UNKA 1H60A 1FWBC 3WFLA 2PDGA 3FYOA 1BAGA 3ABZA 2ATSA 2FTWA 2XG9A 4GLEA 2J8TA 1OG0A 4JKMA 1MXDA 3W0KA 4CNSA 4OGZA 1YEYA 1KGWA 2E5BA 3VNJA 2EXOA 4WQ6A 3V35A 4EXBA 3HFYA 5I3IA 3T44A 5LNVA 1MW0A 4EOUA 2X1RA 4IPLA 4XD4A 3LHZA 3QW4B 3MTWA 3NZGA 1I6NA 3TE9A 3L2IA 3W7HA 2FVMA 4WX2A 5HXMA 1YPXA 2J88A 1BSLA 3WIJA 1R8LA 4W7VA 1Z7AA 2Y85A 4C60A 1V03A 1GK8A 2XM1A 1AQFA 1CI1A 2CBJA 2IQDA 4FPSA 1V02E 3SEPA 2E9MA 1E6RA 4UQBA 1IQ8A 1PVNA 2A4AA 3EWCA 4UMBA 4UTLA 4HK5A 4J4KA 2DVUA 4L4LA 4DUVA 2CITA 1US2A 4X2PA 1MW2A 4JPGA 1C91A 4FNPA 3O9NA 4PMUA 1KM1A 1EF2A 3RHGA 2PDUA 1D7KA 1F6KA 3MV01 3VOGA 3GAKA 2BVTA 1V3KA 3I7QA 3UWVA 3T08A 3IJ6A 3C2EA 3PJUA 3Q67A 4YHEA 4W93A 4UXDA 3TJIA 3VMNA 5K4XA 3QY8A 1BWLA 3U8GA 2E67A 1SYTA 1SZGA 3BZGA 1FWNA 4AEFA 3NYDA 3UPBA 1UZ4A 1DIOA 3POHA 1R5YA 3T2OA 1L9WA 3O7UA 1OG6A 4ZQPA 2WWDA 1B4EA 2OVLA 3UWZA 2OZ0A 2BY1A 2GK1A 4AC7C 4L6DA 1FHDA 3ITLA 2YCLA 2VDIA 1FP8A 1OVDA 1GQJA 1VQTA 3VNDA 3DX5A 4UWMA 1LT8A 5FEZA 5LIUX 2YSWA 3LI0A 2HWGA 3P8JA 3LUTA 3EA1A 4WXZA 3GDKA 1PYFA 3HMCA 3AHYA 1I4NA 3B4YA 3PWIA 4J3WA 1ISYA 1EFZA 4IG2A 4HNCA 2QDGA 1I2NA 2VXNA 4Z2LA 4ACZB 3FCPA 2PDWA 3VNLA 3W7IA 3I3EA 5KTLA 3FGCB 1L6SA 1E6QM 5BZAA 1W1B1 1IR1A 3KBSA 2FGBA 5AC7A 4YWSA 3I6TA 1RQBA 2X2GA 2QCGA 1J2BA 1HT6A 1V6YA 2A3HA 1A3HA 3ZVIA 1BVWA 1UOZA 3EWDA 4FX7A 6REQA 4FZIA 4BQ5A 2QLYA 4G6CA 1XCWA 3W70A 4F0HA 2Y88A 4K7VA 1Q7MA 5TD4A 4XVEA 4N9CA 1OCBA 1TA3A 3O1NA 4I6VA 4KPLA 4NZ3A 4NG3A 3OOQA 5HR6A 3FSUA 3NL5A 3WH5A 2YL6A 3WQCA 3DZ1A 1UD6A 3NOYA 5CPSA 1PUDA 6PTDA 2KAUC 2NW0A 5JQ9A 1K1DA 4H9VA 2INZA 5C8BB 3LHYA 4PUNA 4HP5A 1O1HA 2WWCA 1G0CA 1J6PA 1TVNA 2RUSA 2CLFA 3NAVA 5C55A 2WZIA 1ITQA 1GKRA 1EXPA 5GNXA 3V5FA 1WZLA 5G4HC 4QS5A 5C6MA 4A22A 2WCAA 3QQWA 2ZZ7A 4D6GA 4LPCA 5A6SA 3L65A 4OJYA 2E77A 2PCEA 2C13A 3MHGA 3HQ1A 2NUXA 3G0SA 4Z2JA 2VUYA 4NNAA 5E6ZA 1OFDA 3OLGA 1LL4A 3KOYA 2PFHA 3AMKA 2NZLA 4QP0A 7XIMA 1XFCA 5DN1A 4RK8A 4GUFA 3NZ1A 2CEQA 3KS6A 4CN6A 1K7EA 3VNIA 1T8XA 3E02A 2CLEA 1DWIM 4OBRA 3PVFA 1BXNA 2QCLA 3W1MA 1T99A 3TC6A 2HVMA 3B03A 4OOZA 4PMRA 1QATA 3C6CA 1GTHA 4XTDA 5H8MA 4E4PA 3STCA 1UP3A 4M0XA 3WD0A 3QMSA 5EBUA 2DJXA 3EBVA 3VIKA 5A5WA 4NF7A 2XVPA 4MIMA 3I3DA 5BXTA 1XLKA 4FK9A 4CUCA 1G67A 1PXGA 3RR1A 2INFA 1PZ0A 1FWGC 1CGYA 1VCFA 2CERA 1VEPA 1ISWA 1WUEA 3TN6A 4DYJA 1MO0A 2QPUA 3CK5A 2E40A 1MQQA 3WELA 4CNNA 4B5XA 1SQ7A 1E4MM 1TTPA 2Q8ZA 3BGGA 1OFBA 3QTGA 5BMWA 2WKJA 3V7PA 1JXKA 1S1PA 2PP1A 1SO6A 3I4KA 4KKXA 5D9NA 1EJSC 4DBUA 1DQXA 1Z32X 5EKYA 1SFSA 1HX0A 4NASA 5C9XA 5AVHA 1HUVA 4AZCB 2AAAA 4DJEC 4LANA 2X0HA 3LPGA 1HGYA 1RP8A 3N3MA 3DGBA 2ZZ5A 3GRIA 3W1TA 7ENLA 1MUWA 2CLIA 5G2IA 3JVAA 4YPJA 1XYZA 4Y96A 1EGMA 1UA3A 4DXVA 1FWFC 3LTPA 5EMUA 2B7NA 3LV5A 2CIPA 4IP5A 4UTUA 4FXFA 5TBOA 2V2HA 3GK0A 2IXUA 1QRQA 3ZR4A 4IT1A 3UWWA 2NXIA 3GDBA 5LNSA 1XRSA 1Q6CA 1CTNA 4BQ2A 5K7JA 3RM9A 5H1WA 3NQVA 4JTGA 1ICQA 4H19A 5DY2A 1R6WA 2V2CA 2BGQA 2XFWA 3UCDA 5HQMA 4BF5A 3ISIX 1DVJA 3THQA 1US0A 4XIAA 2YFOA 3B8WA 4JD4A 3IIZA 2DVTA 3BCJA 1UQZA 4E8CA 3U48A 1R2SA 2CNCA 4LVAA 5SWUA 1YXCA 3OLDA 3WK1A 1MW1A 2H90A 3C0LA 3AYSA 1RPXA 4IJCA 1UKPA 1VYSX 1VBGA 2PGRA 4HMDA 1J5TA 1BKHA 3SCTA 3PBVA 3DBNA 4GYFA 4DM2A 5JMUA 3IRSA 1KXTA 3LCLA 2CLLA 1TPDA 5M1TA 1NDYA 4HPJA 2YW4A 1HKVA 2OJPA 1VFFA 4R5EA 1REQB 2ZZ3A 1GVFA 3GIQA 1HJWA 3KBWA 1B54A 1MQRA 1HJUA 2PWGA 2V69A 3CQKA 1QI5A 1E51A 3CMGA 3NQDA 2FDSA 2AKZA 3W1UA 1WX0A 1BHGA 2CXEA 3GFXA 2J24A 4P8XA 4F9JA 1VKFA 3L4YA 2NLIA 4E2VA 3TSDA 2VWTA 1IGWA 1EPVA 1FVPA 3UG5A 4H83A 3M5ZA 4JQAA 3AZSA 3SCWA 4DPQA 1LG2A 3UNDA 3CMFA 4W84A 4KW2A 4ZVJA 4I5RA 4U2ZA 4AVFA 3FXYA 2AMGA 2CCRA 1D8CA 1VBUA 3UJ2A 3VDHA 2WBGA 3WLTA 4AIUA 3WH6A 3NVTA 1XL9A 3PR2A 1VFOA 1X6NA 3GIPA 3R1ZA 1QO5A 1HIZA 3NXFA 2YDSA 1O5XA 2IMRA 3M0LA 4C6IA 2C7FA 3CT2A 3BJFA 1EYEA 2QAFA 3T09A 4LC8A 2FH8A 3B05A 3NSNA 4Q3MA 3MSDA 4NRRA 1I9CB 2HQAA 1DJZA 2F7FA 2C1IA 3SBFA 2UZ9A 1RD6A 4DXXA 2PDXA 4LNCA 4E2DA 1OABA 4OTKA 1R7OA 1EXBA 4M7SA 3PSVA 3MU7A 4MLRA 4PRRA 3FVDA 5CCZA 5DMLA 4GUGA 1JYVA 3IUDA 1OC7A 3WBYA 4H9MA 3R11A 1I2RA 4UQCA 2J47A 4B2DD 4HNVA 3PTKA 4JTIA 3R43A 1U1JA 2DZAA 2VX5A 1H2JA 1IV8A 1H5YA 4IICA 4U28A 4PEKA 4FNTA 3KBMA 1TWZA 2QNEA 4N6FA 2FHBA 2C14A 5AHLA 1WCGA 2DH3A 1ESWA 3UZXA 4QSHA 1ISXA 1EUAA 5IRPA 1QOQA 5DELA 1C9DA 5C7VA 3DFNA 3EAUA 3IVSA 5JBFA 2FKPA 2P76A 1XGZA 2QIIA 1GTEA 4XZHA 4PMYA 2VR5A 4I9JA 1OGBA 1TV3A 1V3IA 3DKJA 1KKRA 5DXXA 3RCYA 2ZIDA 4NX0A 2XSAA 5DMNA 1OQFA 2ISDA 1AJ2A 5EFDA 4IMGA 3OIHA 1VJSA 3CZEA 2XIQA 1YE4A 3T8LA 2OT1A 2WO5A 1DWJM 4DM1A 1FFRA 3UXDA 4K36A 3XINA 4OV4A 2WCSA 3L7RA 3T2PA 3IIXA 4H9XA 2BX7A 1QHPA 3GTNA 2YFNA 1KCZA 4Q8PA 1PKYA 5K9CA 4Q8UA 2Y5SA 2WW5A 2JGQA 4DJFC 3SN4A 3EOLA 1NAL1 4GZ7A 5EMJA 4OBTA 3AIUA 4ZR8A 3ZMRA 3VGDA 3LNPA 2HCVA 2HZGA 5DCEA 4AHPA 4Z17A 1WAUA 3MI6A 1QI4A 1W5OA 4REQB 1ZAHA 3INPA 2VEIA 4IIGA 5TF0A 1NOUA 4OECA 3AOFA 4O52A 1R47A 3E2VA 5LNRA 1FWWA 1PS9A 4KS0A 1Q85A 4JHMA 1KXHA 2EJ1A 5U7SA 5KZDA 1DWGM 1Q3NA 1EJRC 1O1ZA 3ELFA 2O7SA 2VHLA 3WY1A 2X1TA 2EHHA 1TE1A 1TQXA 1A0EA 2OELA 4BR1A 4C6PA 2RH9A 3QPZA 4GCXA 1VPXA 3RO8A 5LZLA 2PRHA 3LCIA 5J5RA 2DW7A 2E5CA 3W85A 3NQ6A 3WDJA 1WO2A 4W7UA 1JCNA 1P48A 2QIWA 4LGXA 4S23A 3STPA 1XLJA 1U5HA 2HVOA 3R0DA 2WJDA 5D8WA 3S1XA 4L9YA 2DUXA 1QNQA 4RV8A 3KDNA 1B3XA 4JGDA 3WEZA 3WQ5A 1UQYA 4A8IA 1ME9A 3K1GA 3WLOA 2F8QA 3SQMA 4WD0A 1RZMA 5CBBA 1KM0A 1PX4A 3GNOA 1K6AA 3R0KA 2JKAA 1XBVA 1LDCA 3TMLA 2HE5A 4MPKA 2P8BA 1FUYA 3OTRA 5A6MA 1CW2A 4YVPA 4V1YA 4ZSTA 1WKEA 3MMWA 2GUUA 4N6EA 3R89A 2R24A 2REQA 1A0CA 3T07A 3DHUA 3SGUA 3HJEA 4ZSUA 4D6DA 1SR9A 4LVGA 3TR9A 3AXMA 1IEVA 4FF5A 4IMCA 4W87A 1KKOA 4GJIA 4Q4QA 3VGBA 4AMAA 1L6FA 3CL8A 3UW6A 2BGSA 4K1WA 4DJDA 1K9DA 1V4YA 1DHPA 4RW3A 2J9YA 2FIQA 3AROA 3ZYZA 3CPGA 3EEZA 4H6RA 6ENLA 3C2YA 4QEEA 2BDQA 3WK0A 3VGEA 3WNLA 3OQ8A 3VI2A 1E70M 3KP1A 7PTDA 4IFRA 4LTSA 3H2OA 2WPBA 1H61A 1PV8A 4CNTA 4P8UA 4AXNA 4HA1A 1E55A 3W72A 4UB9A 4D1IA 3VX0A 3U4FA 2ZX5A 3LPPA 4E6MA 1J2WA 4KIEA 1XHGA 2BV9A 2C71A 4GZJA 3QC0A 4W85A 4W4QA 1ITCA 3WLRA 1RLCL 1QHZA 2J7DA 2QMJA 3W7KA 3WN6A 1K3UA 2J9XA 2GQ8A 4UTHA 1TJ2A 3WJWA 4Q4PA 5A2BA 4JKLA 4LY8A 3P0XA 2RDTA 2ZXAA 1JPHA 1CXKA 1OJXA 2ACUA 4Z2GA 2ZRYA 4ZTXA 3EX3A 1P0KA 4V27A 1UKTA 4QJ3B 1XH2A 3AICA 4QCFA 2I14A 2VX4A 3MO7A 1K8XA 3M5YA 4AZGA 4KCTA 4Y6GA 4MZYA 2Q01A 1Z42A 1XC6A 4CU8A 1XLIA 2VC6A 3LXAA 5CAKA 1TPWA 5CPNA 1C7SA 3CO4A 3EXSA 2CXGA 3S5YA 3ORWA 1GG1A 4HCDA 4UMCA 2XVLA 1KM4A 2RJHA 3WD1A 2J9ZA 4CU7A 4MAZA 4QX4A 3HTWA 4V1XA 2NVAA 2DZWA 1C29A 2OWXA 2PDIA 4XO7A 5I77A 3U2ZA 2ZCGA 3AWOA 3BG5A 3GR7A 3A3HA 4UR9A 3WLNA 4MFDA 3MY9A 4BKNA 1FDYA 2NT0A 2OLHA 4QR6A 3TMQA 4DI8A 2ZX8A 2PUZA 4A2SA 2PWUA 4OU1A 2O55A 1A5AA 4BJHA 3BAWA 4GQGA 4YL2A 4PUJA 3GXFA 2RKXA 2EGZA 2P3EA 3O6AA 2OG9A 3SCSA 3KM8A 2C91A 3HGSA 1GQLA 3GC2A 3BAIA 4Z2IA 1LBFA 2Z4GA 3LCWA 1XI3A 3HZ3A 1D3HA 4XK2A 3VOIA 4EK7A 4PZVA 3IANA 3AHTA 3F4WA 1K4HA 1E0VA 3G22A 1AH3A 4R53A 3DFTA 3MWCA 2VX6A 3KEHA 4AG0A 1AZ2A 3FVMA 3VPLA 1MEIA 1GW9A 1AW2A 1QAPA 1UWTA 1LZOA 5E6YA 5F4WA 2XIIA 3UWYA 2WBKA 4CN1A 1CYGA 3LGGA 1V3LA 7ODCA 3PS7A 1RBOB 3VM5A 5FEPA 2NQLA 1BSIA 3JUGA 3VIGA 4C6OA 1ZBWA 2PBOA 4XAFA 2JF6A 4U5KA 3N11A 3THAA 4DWSA 2Y8UA 3RUBL 1QASA 3B0XA 4O4WA 1C7TA 1JPIA 4MFEA 3SDOA 4US5D 3IV3A 1MNSA 4YHGA 5D33A 2OQHA 3UA3A 3SFKA 1ECQA 5G2WA 2VFDA 2QVHA 3N9RA 4S3KA 4C91A 4G8TA 3UJSA 5REQB 4H7ZA 1AD4A 3T2QA 4ZQNA 4B3LA 5ABEA 4K68A 3URAA 2PEVA 1A53A 2PDCA 3AHZA 3DHFA 4FIQA 4WJXA 3QW3A 4AX7A 2YGYA 2F6UA 2AL1A 1F8MA 3PN8A 4WKFA 1ZP4A 3M9YA 1H7PA 4QQUA 2JKPA 3CWHA 1U5VA 2FHCA 3AMDA 1IF2A 4AC1X 1AVAA 3E0IA 1DJNA 4LU0A 1P6WA 1W32A 1SO4A 3V1HA 3L2LA 3WL1A 1KGUA 2PC4A 4HHMA 2ZTJA 4Z0SA 3IJ8A 2ZX6A 2F9RA 4GYKA 5FF2A 3M16A 1KLYA 3BARA 5K3VA 4PBGA 4DNMA 4GG9A 4I9TA 4EPEC 1PDZA 3F4NA 2V0TA 4A3RA 2WQDA 3M7WA 3CJPA 1TV7A 3QQ0A 3HPAA 1GVRA 4GNKB 2FHFA 4S3BA 5I3FA 3EX6A 2ZZ1A 4L56A 5I7GA 3QV6A 3CT7A 1H7XA 2C0AA 4H9UA 4J7RA 1ZFJA 3S5OA 3UU0A 2DW6A 3UXKA 3L9CA 3QTPA 4FIRA 4MNLA 2QUTA 1OX4A 2ZTKA 1M1BA 2E6FA 1Z41A 3UEQA 3CHCA 3ZR5A 3S83A 2DT2A 4B5SA 3SSZA 3AIBA 1XRVA 3GUWA 5LXEA 1Q7ZA 3FX4A 1YQ2A 3OZPA 1QU4A 3CB3A 4Y9AA 4CVWA 1O6IA 1OY0A 3W2UA 1UKSA 3HGJA 3NO3A 4LALA 3CM4A 3ZVHB 1BLIA 4CQ8A 1WPCA 5A6BD 4UZUA 1WDWA 3PZGA 4C6LA 1RPKA 1OCNA 1VFTA 1EBHA 2F2KA 3IK2A 2CFFA 2GDQA 3GXIA 3WUEA 3GH7A 1QPOA 3QVQA 3W7MA 4NZ4A 3WMLA 3VIPA 3LV6A 3NL6A 5A8PA 1GVIA 1H7NA 1F74A 1LCOA 1V5XA 2OSYA 3W87A 7TIMA 2PE4A 1VEOA 4QE5A 1S5WA 2DUZA 1UR2A 2VQUA 3IK4A 2PPGA 4DWSB 1C8VA 2VI0A 5DY3A 1KM5A 4CKQA 3RU6A 3CUFA 3OZOA 1B30A 1UW9A 1EPXA 4L1WA 3UP8A 5HMDA 1TMHA 4AF0A 1EB3A 4Q8TA 3M47A 3H70A 3EZ4A 3ERPA 3FIGA 3GDMA 2FZ8A 3T8QA 2YLLA 1IWAA 3B3DA 3EB3A 4EX4A 1DEDA 3H53A 1WDQA 2GK1B 3WUGA 1CXFA 3QZAA 3VFLA 1RA5A 4X60A 4B92A 5CC7A 3S9IA 1V6TA 2X09A 3H4GA 3LCFA 3STGA 4HNNA 4PFMA 4HNTA 3ID7A 4CD5A 4MY9A 1UZ1A 1HKJA 1FY6A 3CXOA 1UMLA 3UR5A 3EWUA 4KEUA 1A5OC 4GO9A 3BV4A 2CHRA 1M68A 5LA2A 5F7UA 2ACSA 1MW3A 4WVXA 3MUXA 3SURA 2WMFA 4GYPC 4AD0A 1O12A 2QMKA 1GCYA 5J5DA 3UWUA 3A22A 4FAMA 5FJOA 4DJDC 4MMWA 3AAMA 3O0FA 3SCUA 2V3GA 1WP6A 3WFAA 2EO7A 2PDNA 3SW6A 1TJRA 4GHRA 4P61A 4A4AA 2NUWA 2VR2A 1I45A 3TDFA 3W1RA 3BQ5A 3RPDA 4B5WA 1TVPA 3ZXWA 4JX5A 3BCFA 1I2QA 4F79A 4TVUA 3C5QA 3FGCA 4MJ2A 2XUCA 3WO8A 1JAKA 4WR3A 2JQXA 3WBXA 1TRIA 1KCXA 4YCOA 2ZWYA 3K8MA 1I75A 3HN3A 1GOMA 3RPMA 3LA4A 1DWAM 1YLVA 1NQ6A 3QEZA 2BGNE 4HN4A 5TNVA 3NZQA 3DFHA 2QCCA 1C8QA 1R85A 2QUMA 4HNLA 3URNA 5CZTA 3TTYA 3W7DA 2VRJA 3FDGA 4HZ6A 4PCPA 4AY8A 5LHEA 5A8QA 2WJFA 3SCPA 4FNRA 1XBYA 4ZOEA 1F8IA 2H8XA 4FLOA 1JAEA 3ONBA 2Z2UA 4D9PA 4PR4A 4JIRA 3WF2A 2VFGA 2FZ9A 4HYWA 1LYXA 3DAQA 4C7DA 4U3CA 5DF0A 3VZXA 2PF8A 4MDOA 3QOKA 3T4CA 4K39A 1BYAA 4HZ8A 3GXTA 2NV2A 1B3ZA 3TTSA 1XFBA 3M41A 1DJGA 1EWDA 1G4EA 1TPB1 1GPFA 1MZRA 1LOLA 3PBMA 4YTTA 5D2TA 4G9PA 3GVWA 1Y7VA 4ZGYA 1V3HA 4M51A 2SFPA 1Q4NX 3T4WA 4MPQA 3IAPA 3C3UA 3W2MA 4O11A 5FF7A 2UWFA 2YBVA 1S3TC 1K8YA 2RAGA 4AMCA 3K8LA 4TTGA 1LRNA 4DN1A 9XIAA 2PWFA 5IDIA 2BODX 1EA0A 2XFRA 3PBUA 4ZQRA 4IIHA 2WNWA 1FX6A 4GYJA 3P8IA 2FH6A 4D2JA 1H51A 3NQ2A 3H23A 3C61A 3SRKA 4MVAA 2WHJA 3OHIA 3BURA 3JR2A 5KZMA 5AYIA 2D73A 3A4XA 3TN5A 2XGZA 3OO2A 5HNTA 3B0VC 2ZC1A 4XG1A 5EBAA 3I4EA 5M5DA 1O94A 2OX1A 4QROA 3CV6A 4JTHA 1LQ0A 4GA8A 1UR9A 1FWRA 1LL7A 4KIRA 1YMYA 1W3KA 9CGTA 4TTUA 1EDQA 1V0KA 1XINA 3H12A 3T0TA 3RRXA 2BY3A 1QOXA 3GNXA 3RFAA 2OCZA 4UTWA 1IXPA 2WC7A 5CGMA 4JEQA 4IF2A 2W0UA 3GBEA 3FDKA 5I3JA 1YIXA 2J7HA 1RK5A 2C1GA 2OEKA 2QJJA 2ZBTA 5KEZA 2VOTA 3CUHA 1N8FA 4AB4A 5C71A 4GO8A 4AQLA 3HA1A 3VCNA 1JULA 2DSVA 5F4XA 2XVNA 4HU0A 3D5HA 3FXGA 1N55A 3ARPA 2YYUA 1SUXA 2WPGA 5GJMA 4F4RA 1HXJA 3ARWA 3NXLA 4OHQA 4XZMX 1D9EA 1F76A 5DBUA 4PTXA 1ODZA 3U2CA 1ZU8A 3GC5A 1XIDA 4GY0A 2VM8A 3FA5A 1Q6RA 1JIBA 3L2MA 3APGA 4QDPA 4W8BA 4W8AA 5G1MA 3WEMA 4Y90A 3B8DA 4LYRA 8XIMA 3NA8A 3GVVA 4KESA 3DOPA 2R94A 3IJLA 4JIHA 2F38A 2G3JA 3G1FA 3RDKA 2V3FA 3D46A 2D2GA 1OX4B 1VS1A 3TZFA 2PDLA 4Z1BA 1SFJA 3GW3A 2Y62A 3TCSA 4DAFA 5EYWA 3G1AA 3UY8A 1RVGA 4F2BA 3BTNA 2OKTA 3I68A 2WSKA 3L68A 1GKQA 1RH9A 4ROQA 5EMKA 3T40A 1K7XA 2CZEA 3NNTA 3SSJA 4NAFB 3LCHA 4U33A 4IPIA 3HV8A 4BY3A 1CCWB 4H1ZA 2V5CA 1WZMA 2PGWA 3AXHA 3BWWA 1V77A 1MVYA 1FXPA 3TQPA 5IOBA 1IEQA 5HMEA 3GM8A 2NUYA 1ZCCA 1TJ1A 3ES8A 3PBYA 2Z26A 3GVGA 3N29A 2HROA 2VZSA 1AZ1A 3C0QA 1AG1O 1BWKA 3VCRA 4RW5A 4I90A 1VC4A 2YA1A 5CPMA 4TVDA 2VL4A 4O10A 2E6YA 4V2XA 1QPQA 5KETA 4IX0A 1F3XA 4QE4A 1UWRA 3TQKA 4AUBA 1R3YA 1DV7A 2ZDRA 3VNYA 1QCWA 3BLLA 4LYKA 3ZLFA 3B4UA 2DSKA 4TX9A 5D04C 2CBVA 5DX7A 2ALDA 3W86A 5BOEA 2GVLA 4DJFD 1FXQA 4N9BA 3E12A 2D24A 4B9YA 2RDWA 3USBA 4DLMA 1EEXA 4OBSA 4GFIA 3P7YA 4WY0F 3BSHA 4XKYA 4MWAB 3OVRA 2GOKA 3COTA 5E5CA 1TCDA 2HDJA 3GS6A 5BMXA 3W4RA 5DMMA 3EX1A 1O7AA 4BWLC 1BFNA 5D9MA 3TYBA 3TVAA 2RHGA 4F66A 5HULA 1KCKA 2DIJA 3PZIA 5E70A 4I8YA 1P6BA 4CQ9A 3ZLHA 2PDJA 4YNGA 2BB0A 3KL3A 2Z29A 4S3GA 1XLAA 3IUHA 2GWGA 2PODA 3LQLA 3KOWA 2OZ3A 4NYYA 2UY2A 3LG3A 6TAAA 2DVXA 1JZ8A 3SRHA 1R3WA 1KR0A 5FJIA 2AMXA 1RCXB 1TJ0A 2O7QA 4H9ZA 3N3TA 4HSOA 4PTVA 3KLLA 4ZOAA 3EDFA 1B3VA 4O8RA 2VRKA 3LCGA 2OYMA 3V5CA 3T0AA 3CLWA 1W9DM 4LVFA 2ISSA 4HPNA 4L1XA 3SB0A 1AH0A 4GVGA 1E5NA 4D8ZA 4WGHA 5AFDA 4R88A 5AC4A 1WBHA 4LOCA 2HBVA 5KMYA 1ZL1A 1E72M 2WKGA 3H4XA 3G24A 5JXQA 2VELA 3D0CA 3O3RA 1IXQA 2MUCA 1KQYA 2XH7A 4JNMA 3ECQA 4DPPA 3HFTA 3NO5A 4AZHA 2X7VA 3HG3A 4FB7A 2ISFA 3W6YA 2EKGA 2I9UA 3LRLA 4I8DA 3HIJA 3PFMA 3CLMA 4GBDA 4P7QA 2G5WA 4AAJA 4JX6A 1V0LA 5GNZA 3DHPA 5XINA 3GU9A 4QSFA 4O12A 4PE8A 3N12A 1GKPA 3KX6A 6ALDA 3N19B 3KRZA 3BVJA 1ZALA 1J79A 4LRSA 1XSIA 3I10A 4QE1A 1SSDA 3TEVA 4GZIA 1Z89A 3PB2A 3VNKA 3H4WA 1HGWA 1XIGA 3WQPA 1EBGA 3MP5A 2OODA 4EXQA 3TN4A 2D0HA 4H8VA 3MVIA 3S2LA 4HPXA 3R6IA 2P5NA 3WBEA 1HKMA 3DYPA 3WQ8A 4M8UA 2NQZA 4ECLA 3U5YA 1VGAA 1MUMA 3AS0A 3W76A 1GVSA 3RN6A 1LM1A 1VR6A 5CLTA 4AWTA 2R91A 1HW6A 1OX6A 2V3DA 5LNUA 4O16A 3RF9A 1JPKA 2XINA 5I2UA 2YKKA 1MXSA 4KETA 5E0KA 2ZRWA 2X1IA 4MDPA 1X38A 4MAVA 1T0OA 4UTMA 3LSBA 1Q13A 2I7GA 4JFUA 1J4EA 1XIEA 1XGDA 1XYFA 1CNVA 4GWEA 2Y0FA 4Z0JA 3KOFA 1ZAIA 3EKGA 2JF7A 3M0HA 3W3OA 2VC5A 3RYSA 4JTCA 4NRSA 2HISA 3QC3A 4MY8A 1W91A 4IQLA 4C6EA 3B0UX 1OX5A 1QJWA 3P6LA 1BYCA 2E25A 3LI1A 4DZHA 2VCAA 1G4SA 1EJTC 1RCOB 2ZUVA 4HJFA 1FH9A 2WMJA 3GAYA 3AS1A 4NAFA 1UYQA 1XKJA 1RY0A 2FZNA 3MI2A 4K8GA 3MBDA 2RJGA 4JICA 1W3LA 4GQ0A 3OYZA 1WXJA 2ZA1A 2ISWA 1SO3A 1WAWA 2BZNA 4G1NA 2YJQA 5JIWA 1BVNP 2E1WA 4D6CA 4S39A 2HMCA 3LHVA 4EAYA 3UF9A 2VP8A 2OQLA 3DYMA 5G5IA 1PBGA 4W8LA 4WHBA 3TK7A 4EF8A 3A9BA 4QIUA 4O4VA 4B5TA 4TV5A 3N4EA 1DJXA 2L5HA 3KTCA 2H3DA 3TN3A 1M7JA 1E40A 3VD9A 5CZJA 4DNHA 2R6OA 4AY7A 3QYSA 3ABQA 3TJ4A 3PFRA 1GOIA 3K5XA 5FJJA 3H7UA 4C1NA 2A3LA 2EG7A 4H04A 4N02A 3VE9A 4L64A 4C1KA 5F4SA 4HA0A 3AWNA 4O17A 4LVDA 1E1EA 2DZVA 2Z7GA 3P93A 4UQEA 4X9SA 5I03A 1Q6DA 3VVGA 4W5UA 1EOKA 1C93A 1E6PA 1DBTA 1H7WA 3M64A 3W23A 4GACA 1DL3A 4JX4A 3OGSA 2WXDM 1YKWA 1TFVA 2ONEA 3DENA 2IPJA 3ZFHA 4NL1A 5AZ0A 1P1XA 3W7OA 1FWDC 7TAAA 5G4WA 2OX4A 4DJDD 3MKKA 1EC7A 2WMHA 1X97A 2WQPA 3S42A 2ABAA 4AH7A 5E0CA 1TTQA 1NF7A 5IFTA 3TR2A 3F2BA 1R2TA 3ANUA 1EUNA 3UWQA 2JIEA 1IWPA 3GQYA 3UZJA 2R1MA 1EQPA 2RGMA 5BXRA 3LENA 5FOOA 4QJ1A 5CSYA 1RJQA 1V6UA 4BF7A 4IP7A 1HVXA 2PGFA 2PWEA 3LZ3A 3QPEA 4ZB2A 3IAQA 4JFVA 3N6JA 1XF0A 1EHNA 4OKDA 2A7NA 2G8ZA 3F5JA 4XAZA 1PZ1A 4UFMA 1I60A 4ML9A 4LH8A 2I5QA 3BLFA 3UJEA 3RO6A 3E9AA 1PZ2A 1ZBVA 3GU1A 2WSPA 3IV8A 3NM1A 5BYWA 1P5BA 4ADTA 2VTFA 2PAJA 4HK7A 3A3WA 3I6RA 3IEBA 4FX8A 3G0UA 4AWEA 1DORA 4ROPA 2W63A 2EQDA 2D2HA 3WQVA 4H6EA 1ONRA 3EA3A 1NP2A 3N18A 3N1AA 3P82A 4ZTYA 4B3ZA 1WDSA 3POCA 5M3WA 5XIAA 3WNNA 4FOKA 3ATYA 4KQNA 3TV8A 4XVDA 2XVGA 1OWQA 4P8VA 3QXBA 3SUTA 4F0LA 2ASHA 1TRDA 1EH9A 3FKRA 4IQDA 2AKMA 4O54A 2TODA 3OG3A 3GH5A 5HA7A 1TWDA 2V5JA 2W66A 3NGFA 3THDA 3OGRA 1KV8A 3QYQA 2V68A 5CZSA 1BG4A 4J3SA 3VC5A 2OO6A 3EGJA 2GVYA 1MDRA 2IQTA 4ORMA 1TPC1 2AQWA 5I23A 2W91A 3GNRA 2GYIA 1WB0A 1EIBA 3ZIZA 5D4YA 4TR9A 4PULA 3U7BA 2WM1A 3T1GA 3ATZA 1E56A 1OT1A 3T9PA 3W7PA 1EJ7L 3HGRA 4IIBA 2BS9A 2OXNA 3H21A 4GQQA 1OYAA 1TQJA 3B9DA 2IKIA 3V75A 4OIFA 1P6CA 5I79A 4JIPA 2PRLA 1VEMA 1JYNA 4PBFA 2XM2A 1ONWA 5CZ0A 1S5TA 3MZNA 2FVKA 4XV0A 3AU6A 2O92A 2JKEA 5DEZA 4ALDA 3H7RA 3AHXA 2FGZA 1R9YA 3AYVA 2X0SA 4PODA 1JJKA 1Y8BA 1E9LA 1CX9A 1O5KA 1E15A 1V0MA 3CL7A 3U0HA 5I5RA 4O50A 3RM8A 3KTSA 4ZO8A 3TNBA 2V38A 2J66A 4K8HA 3CV1A 1PX3A 1CXIA 4HHLA 5FEWA 4HTBA 4FP1A 1V0NA 3FKKA 4PH6A 1S2TA 3G77A 1QBAA 2P3ZA 2AL2A 4RV3A 1PL9A 4MYXA 3L12A 3C2VA 3OP2A 2FQIA 2JEPA 1V7AA 1G4TA 4JL1A 1EA9C 1KGXA 2Z27A 4NJHA 1UR1A 4HA4A 3KVLA 3A4AA 1GOWA 2QW5A 4UCFA 5DANA 2NX1A 4WSJA 2CHOA 5C2CA 1NWSA 1A5SA 2VT0A 5M03A 2WMIA 3PZMA 1SFLA 5H91A 2OOFA 3IS4A 1WXYA 1HP4A 2NXGA 3CYJA 5K9XA 2V5KA 1MNZA 4GRSA 4I9MA 4DRSA 4FXRA 2QJHA 3EKZA 1VHCA 4MOZA 1NDVA 2E8YA 1YTDA 1ZZMA 2CKSA 4UMAA 3WBWA 1ZBKA 4J3ZA 1LLWA 3GTXA 3H2MA 4DO4A 4DX3A 4W7WA 2CKRA 3DXIA 4NILA 2G3NA 4XKYB 3TZNA 3PUGA 4UR7A 1LWJA 3UPWA 4DB7A 3LB0A 3UZ5A 3S9ZA 4UC5A 4NT0A 2WYSA 1VZWA 1CDGA 2F84A 5GQBA 1F9CA 3OB8A 1YADA 2FZBA 4GVHA 4FNUA 1GVEA 3ABSA 4AEOA 2FMNA 1JDCA 1MRQA 1QW9A 1J01A 1MWOA 3ZM8A 1KM6A 1ECEA 2W92A 2V63A 5CLWA 5FCZA 3JS3A 4UOJA 2NQ5A 3ZJ6A 4KEVA 1CB7B 2FGLA 2VDGA 3UY7A 4AF0B 5ABFA 4C6DA 2CZFA 1QTWA 3CEPA 3P80A 4PTWA 3WD3A 3FYPA 3U9IA 3L21A 3CH0A 3M0IA 2E6AA 2PWHA 3VD4A 4MB3A 4NZCA 3G1YA 5JBDA 1XW8A 5F2IA 4J28A 5ECUA 4JFSA 4AD3A 4B5VA 1X7FA 2YL8A 4AZIA 3W01A 1XIMA 3CNYA 3GVQA 3UETA 3OHMB 1SZEA 1PPIA 3G3MA 1DTNA 3VD7A 4BF9A 2A3AA 1H50A 3DKLA 2OMAA 2Y1HA 1EZWA 4KWOA 3QQ1A 1Q6LA 1MDLA 4HYVA 1TX0A 4L61A 1BF2A 2J6VA 3O8AA 1ME8A 4U10A 3WLJA 3LM3A 4X63A 1BG9A 1LT7A 1OZMA 4H3DA 4CCDA 3P81A 1JEZA 4GD0A 1XQKA 2XDFA 4PSPA 1TPUA 2PRMA 5HOSA 3RK8A 4Q4KA 4MJZA 1DWFM 4DF2A 2GPTA 4K2SA 4XBKA 2XJ7A 4RNJA 4AD4A 3PP7A 4DVOA 2ZWZA 4NVTA 4LF2A 4GUIA 3BL3A 1JCTA 3NQCA 4Q8VA 2Q3RA 1JCMP 3GFYA 5BOFA 4FS9A 4ILSA 1NIUA 1HZYA 1E4NA 9RUBA 4Y8FA 1D2KA 5C2XA 4GI6A 4HT3A 1TR9A 4N4PA 3VGHA 1CENA 3MCNA 1QT1A 1KB3A 4Q8QA 2AQOA 2ZRVA 2VRQA 3PPGA 2I17A 3MYPA 4IOTA 3ARTA 3RXZA 2JBMA 5CH9A 1F73A 1HNYA 4JEJA 2Q09A 7CGTA 3WCZA 3NZPA 3P84A 4XO6A 2Y8KA 3TJXA 1UG6A 4H6KA 3MUZ1 2HBXA 3UG8A 1A5UA 1AQ0A 1FCVA 1D3GA 1PCKA 3QSTA 2BLEA 3NUKA 3CUJA 3NVDA 4AX6A 1NFGA 4POCA 1X8CA 2C18A 2P10A 3OLEA 1P0DA 3J7HA 4RPPA 5ABGA 2QDHA 4WOZA 3BO9A 4KBXA 2A3EA 2VEGA 3WUBA 4JTDA 1WNOA 4B90A 3WFZA 3TYZA 1W9PA 1XX1A 2GJLA 2QDEA 1PKNA 2BVWA 3VO0A 3WX7A 3TW6A 1I0BA 1K9EA 2RFGA 4GINA 1DJHA 3GR8A 3WDIA 1CECA 3MV11 1NWUA 1U5JA 2VZUA 2Y4SA 3FHQA 2JIWA 3TC7A 4WCJA 3CAWA 4LCSA 2CZDA 1OFOA 2PZ0A 2A79A 2PD9A 3RLHA 3BMWA 4UFJA 1PYMA 5KZEA 4IMD