2A3HA

Cellobiose complex of the endoglucanase cel5a from bacillus agaradherans at 2.0 a resolution
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
300
Chain Sequence
SVVEEHGQLSISNGELVNERGEQVQLKGMSSHGLQWYGQFVNYESMKWLRDDWGINVFRAAMYTSSGGYIDDPSVKEKVKEAVEAAIDLDIYVIIDWHILSDNDPNIYKEEAKDFFDEMSELYGDYPNVIYEIANEPNGSDVTWGNQIKPYAEEVIPIIRNNDPNNIIIVGTGTWSQDVHHAADNQLADPNVMYAFHFYAGTHGQNLRDQVDYALDQGAAIFVSEWGTSAATGDGGVFLDEAQVWIDFMDERNLSWANWSLTHKDESSAALMPGANPTGGWTEAELSPSGTFVREKIRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bacillus agaradherans family 5 endoglucanase at 1.6 A and its cellobiose complex at 2.0 A resolution
pubmed doi rcsb
source organism Bacillus agaradhaerens
molecule tags Endoglucanase
molecule keywords ENDOGLUCANASE
total genus 117
structure length 300
sequence length 300
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1998-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2a3hA00
3OGSA 3GYCA 4H8VA 4ML4A 1UYQA 5IFPA 2XG9A 4NF7A 1SFSA 4FK9A 1JXKA 1QHOA 1V6UA 4UFIA 3ZOAA 1D7FA 2J79A 1QOXA 1JZ3A 5DO8A 2EPMX 1I1WA 4W87A 1US3A 1KXVA 4AYSA 3ZJKA 4YHGA 1ZS2A 1UR8A 3L4YA 5BRPA 4ZE4A 1ZBKA 2Z1SA 5EMYA 4H04A 5JIPA 4AZIA 4GIAA 1G1YA 3IJ7A 4LYQA 7A3HA 2AMGA 4JFWA 1XRVA 1JNDA 3MMDA 1E73M 3ZT6A 2D1ZA 3W27A 3F4VA 2HISA 3KE0A 2VMFA 2FHFA 2JALA 1SR0A 3T2OA 2BVDA 2DT0A 2EEXA 1CBGA 5CPTA 1VB9A 2ZXQA 4MNKA 4D71A 5D8ZA 1OT2A 2GJXA 1HJXA 2WC3A 3OLIA 4ZENA 2YDQA 3VILA 3ARZA 4HOXA 3II1A 3CZJA 5F7UA 3LMYA 4AD5A 5EB8A 1AVAA 3WH8A 4AEFA 4UFHA 4NI3A 2JF6A 4ZE5A 2HVMA 3N9KA 1UA7A 4U3CA 5BXSA 3FW6A 4W89A 3OGVA 4AIUA 1FH7A 3VX1A 1PX8A 4Z2HA 2PWEA 4WF7A 3WQ4A 2CESA 4HZ7A 1WO2A 4PTXA 3PTKA 1E6ZA 3K8LA 1EQPA 5HPOA 1TFVA 3NSXA 3EDFA 2CETA 2GVYA 3PTQA 1V0NA 4Y7EA 3THDA 4D72A 3VGGA 3IAQA 1VIWA 1W9BM 4M80A 1V3IA 3AISA 3EBVA 3WQ5A 1KXTA 5ECUA 1LWJA 4QCEA 1W3JA 3NJ3A 4F9JA 2ZUVA 3WQ8A 5KZ6A 4D6HA 2Y24A 3AMKA 1TA3A 1UKOA 5E6YA 4ATDA 3OLDA 1V3LA 3OGRA 4DWSC 2GJXB 3QHOA 1FP8A 1UH3A 2VCCA 4PMRA 5DEZA 4FLRA 3UESA 3GNPA 3VIHA 2J7EA 1K9DA 5ABFA 2VTFA 3VM7A 5AC4A 1J0ZA 4OOZA 2ZIDA 4UFMA 3EMCA 3CTTA 5GNYA 1J0YA 2ZX7A 1SYTA 1WZMA 3ARVA 1J11A 4PN2A 1PX3A 3GTNA 2EPKX 1OWQA 1HP4A 3CBWA 1QPKA 3AFBA 3WH7A 2WZEA 3CO4A 3U7VA 3D3AA 4GQRA 4MJ4A 1JG9A 5FCZA 2UY4A 1B30A 3AOFA 1PIFA 4M1RA 2BNJA 5IDIA 3VPLA 2G3JA 3VU2A 4WLCA 4AZGA 2E0PA 3AIVA 1DP0A 4W7WA 2C8NA 6TAAA 2A3EA 5GQBA 5I23A 4TUFA 1GVYA 1S46A 1EIBA 4PMYA 3HMCA 3AQUA 3EMZA 3VVGA 5CLTA 1HVXA 5AYIA 1OT1A 1UWSA 2J7DA 4QAWA 1XH0A 5BWFA 4B9ZA 1K9TA 1Z32X 3K8MA 4TVUA 4HP5A 2PWGA 1UWTA 2YDSA 4W85A 3MANA 3VDAA 4ZEPA 4IUGA 2WCSA 1UR2A 2ZE0A 2PWFA 1V03A 5E09A 3MSDA 3VOCA 2W63A 4TX6A 4DWSA 3WMCA 1LQ0A 4GPNA 4PTWA 4U31A 3WL1A 5A6KA 4CN4A 1OD8A 3FY1A 4GZEA 3VGFA 1A3HA 3I3EA 2FHCA 2O92A 4URIA 3A4XA 2UWFA 1VEOA 4A4AA 3T0BA 3BAKA 1EH9A 1TR1A 2D3NA 4GI8A 3ALFA 1W1PA 4ATWA 4CD6A 1UR0A 1RH9A 2W62A 1XGZA 4J27A 2WMKA 1C8QA 1V3MA 1WDSA 1CPUA 5IXEA 4Z2GA 2GSJA 1OB0A 1UR4A 4DM1A 1ISXA 3ZJ7A 1E71M 3KWXA 1QI4A 2VVNA 4U3AA 2D24A 1J9YA 3T0DA 3SEPA 2MANA 3GDBA 1OIMA 1TE1A 4RE4A 3VGBA 4ZXOA 2AOSA 1PIGA 2F8QA 3LPOA 1H5VA 3SCUA 4ACZA 2WNWA 3AIWA 1D3CA 2PWHA 4C7FA 2ESCA 3TTSA 1CZ1A 1NP2A 1W2VA 2J8GA 1OCQA 3WDPP 2G4FA 4C7DA 1JYVA 2DT2A 2DH3A 3A3HA 4JFUA 3AI0A 3OA5A 4QLJA 1CGXA 3DYPA 1MQPA 1HKMA 1ODZA 3AZTA 4H8HA 1ISZA 2WK2A 1HVQA 3WY1A 4AZBA 2WHJA 2WMIB 2XIIA 3MSGA 1UKQA 1XYZA 4KRTA 4U5KA 3NIYA 1H4PA 1W3KA 2YLAA 3VDBA 1CXEA 3AHVA 2IUZA 2WMFA 1W1VA 1XSKA 4HOWA 3SCNA 2WVVA 4AMCA 4D6GA 3WH6A 5CLWA 3W0KA 1W9UA 3AS1A 5I5RA 1UUQA 1ITXA 1MW2A 2A3CA 2ZWZA 1DEDA 4CD7A 4Q7NA 1HJVA 2VC9A 1QI3A 4ATLA 3GNRA 3N13A 4P8WA 4JHOA 2XIBA 1OIFA 3QHNA 2PF0A 3PZMA 4CCCA 2X1IA 4AD1A 4PMNA 1JDAA 2BVTA 3WD1A 2WHKA 1EDQA 4GI9A 2CERA 4PSRA 1JZ4A 2GUYA 4JKMA 1GJUA 3BCFA 3VD4A 3N17A 1EO7A 1HKIA 2YA1A 1E6XM 3BAXA 3GH7A 1G9HA 2YA0A 4C7GA 4JCMA 4TX8A 3WF1A 3NSNA 1QNRA 3BLPX 2OSXA 4OJYA 4AC1X 1Q6FA 3PZGA 2C0HA 2J78A 1HKJA 1FFQA 1GOKA 3DECA 4CN6A 1JDDA 2VZVA 1VFFA 4TVCA 3WIJA 3N04A 2FHBA 1MFVA 1JFXA 1QBAA 4CN1A 3WNOA 1V0MA 1H2JA 2DQXA 3IANA 4TVDA 1R85A 1KCLA 2WMIA 4PMZA 2D2OA 2G3IA 3WQ6A 2C7FA 4WK9A 1W9XA 3WSUA 1K6AA 2ZUTA 4P7OA 3CUHA 1B0IA 1IT0A 3RM8A 3ZQ9A 1UWIA 2VX7A 3LPPA 5M17A 3ZIZA 2D23A 3LPFA 5EFDA 4ZXLA 1KXQA 4FMVA 3WUBA 2CBVA 4FLQA 3T0AA 5CQ1A 3W38A 3VIIA 1FOBA 3OBAA 4U33A 4DM2A 1ZL1A 3WNLA 1FFRA 3W81A 1E4LA 5BCAA 4PRWA 4AD4A 3EDKA 1ZBVA 2WPGA 3CZKA 3BMWA 3POHA 2BVYA 3QR3A 3OB8A 2D20A 3AS2A 3PZNA 2VQUA 1LLOA 2E8ZA 1E40A 4R27A 4W7VA 1GHSA 2WLYA 2B31A 4JKKA 2NT1A 4PBGA 5A6LA 2E40A 1CENA 3AIRA 3VX0A 2ZX5A 3CZGA 2VL4A 2DSUA 3A4WA 5GNXA 3VKKA 5FIPA 4MADA 1K9EA 3B8SA 2BY1A 2NT0A 3WDRA 1B1YA 4MTVA 3KEHA 4PTVA 1V02A 3NDYA 5BXPA 3AHTA 1KFWA 1HL9A 4PUDA 3AYSA 4D6DA 5I78A 4UQDA 1BAGA 3IJ9A 1TVPA 3BMVA 1H0GA 3RDKA 1QI0A 1W9VA 1C8YA 4AISA 4BQ2A 1YHTA 4J7RA 2WSKA 4HMDA 4P8VA 1V6WA 2IXVA 1HT6A 3AICA 5DFAA 3AIBA 1OM0A 2ZICA 3NSMA 2W92A 1UD8A 4XB3A 3ZMRA 2DIJA 4MNJA 2BFGA 1VENA 4BZYA 1UD3A 1QBBA 1V0KA 4HZ6A 2UY3A 4UR9A 3GXDA 3GXIA 1J0IA 2QF8A 3NDZA 2WC7A 3MUIA 3AMDA 3ZR5A 2CHNA 5EBAA 3PZIA 5A8MA 2YIHA 2A3BA 1PEZA 3WQVA 2GFTA 1W91A 2J74A 2E9BA 3VD9A 1WE5A 3W4RA 4MB3A 3GH4A 3K46A 1CGWA 4PUEA 5HDRA 2QHAA 4PMQA 2WMHA 3EDEA 1E6RA 3SCPA 1UKPA 1PZ2A 1KBBA 3M46A 1BSIA 4M81A 3APGA 4CCEA 1XH2A 3FNDA 4MB5A 4PYSA 4D6JA 3WELA 2ZUWA 2Y8VA 3ARRA 3T08A 3VUPA 4CCDA 2D0FA 4OBSA 4J3VA 3N1AA 1MW3A 4CGTA 2CCRA 2FDMA 1BPLB 1WB0A 2FH8A 4LYPA 3GBEA 2EJ1A 2WVUA 1LJYA 3I3BA 1ZBCA 1H41A 1MW0A 3SUTA 2J7FA 1WZAA 1UD4A 2X05A 1H0IA 2J75A 4UCFA 1G5AA 2VZUA 1NQ6A 4M82A 2WSPA 1X6NA 5BYWA 4QLKA 1CNVA 1FH9A 1CLXA 3MV11 1PBGA 1UKSA 4M24A 1DWAM 1B3ZA 1J18A 1Q6GA 1LL4A 2CBUA 2DIEA 5A1AA 4TOQA 4BCEA 4W7UA 4JKLA 2EPOA 5ABGA 1W3LA 3CMGA 1JF5A 5E0FA 2VRQA 1KGUA 4EKJA 3N15A 5JBEA 2X0YA 2WZHA 3OLGA 3VD5A 1JZ5A 1LF1A 4NSBA 1VFOA 1WDPA 3CLWA 3U5YA 1KWKA 3UR8A 1CDGA 1C7TA 3AS0A 4KGLA 1EHAA 4H2CA 4U5IA 1QNQA 3L4XA 4X0NA 2D22A 4PMVA 3O9NA 1OGBA 1OSEA 1ISWA 4MAVA 4LQ1A 2XM1A 3SCRA 5A6AA 4FLOA 2EPNA 2QMJA 1E6PA 4AEEA 1VAHA 3ARQA 2VZSA 5ABEA 5HPCA 1R8LA 2E9LA 3SUVA 4MPKA 3L4VA 8A3HA 3T2QA 2CBJA 1TZ7A 1M04A 2J25A 1LL7A 1EOKA 4F9DA 3IAPA 1DHKA 1E3ZA 4Z2KA 4UQCA 3N11A 3SCVA 1GQLA 2O9OA 5A2AA 1ZJBA 2WKGA 5AY7A 5CXPA 2CKSA 1UOKA 1V6XA 3SCTA 2WYSA 5A2CA 1EOMA 1GNXA 5A6MA 4HZ8A 3RPMA 1NWUA 3A6OA 3VD3A 1GOIA 2ZXBA 1ZJAA 4PTMA 3VTRA 1UH2A 3KL0A 2OWXA 4J28A 2EXOA 1CGYA 3ZR6A 4WSKA 3S6TA 1ZU8A 2VCAA 2ZXDA 1ISVA 1EDGA 3RM9A 1PJ9A 1XV8A 2E3ZA 1GPFA 4W5UA 2X2YA 2WBGA 1L0PA 4M8UA 4JFSA 3F5JA 4H7VA 1E6SM 3WF4A 3OZOA 1UR9A 3SIMA 3NYDA 1ZB5A 4A3YA 3VGEA 1NP0A 1NWTA 2Y5EA 1J10A 4XZWA 3OLEA 2BS9A 3TTYA 2E8YA 3FHQA 2ZOXA 2ZUSA 2WLZA 3UCQA 3WEZA 4H41A 4W8BA 4OUEA 2XVGA 4PMXA 3OIHA 1XC6A 3CIVA 4J3TA 1E1FA 4CKQA 2RGMA 4MDPA 3W24A 1V0LA 3K4DA 2VX6A 1B3VA 3MUAA 1JD9A 3WNKA 1E56A 3WD0A 2XPKA 4UOZA 2PBOA 2YBTA 4MJ2A 3VM5A 3WH5A 3S2CA 3M07A 1VJZA 2ZWYA 1NWRA 1JI2A 3AZRA 3WDHA 5D9OA 3RO8A 4DWSD 1PAMA 3WMSA 4B15A 3M6DA 1EQCA 2EPLX 4BQ4A 3QOKA 4JL1A 2CEQA 2W61A 2WVVB 5D9PA 5E70A 3WF0A 1CGVA 1F4HA 3BLKA 3EMQA 4UFJA 4BA0A 2O9PA 4PEEA 4F66A 2W5FA 1K9FA 2WXDM 1BHGA 4GI6A 3GXMA 4AIEA 3CZLA 3O2LA 4JCLA 1EO5A 3WD2A 1E6NA 5DF0A 2VZTA 1ODUA 5BXTA 4IM4A 5CPQA 2BHUA 4V28A 3VIJA 1KWGA 1Q6EA 2E4TA 2E9MA 1LG2A 4D6EA 1KCKA 1G01A 2YKKA 3WENA 4DUWA 1BYDA 5A6BA 1CYGA 3W37A 2VX5A 2DT3A 1G94A 3NUKA 4WJXA 3SCSA 3ZM8A 3D5HA 3BXWA 9CGTA 1ECEA 1JXJA 4B16A 1XD0A 2CNCA 3KL5A 4ACZB 3A47A 3RJYA 3UERA 2Y8KA 1QNOA 4AZHA 1VF8A 2BHYA 4ACYA 1W9DM 6A3HA 1GQKA 1E9LA 3KL3A 2D0GA 1GQIA 3K8KA 3TP4A 3BAWA 2F61A 2J7GA 5M5DA 2WW5A 2BY0A 1JZ6A 3IJ8A 1GOQA 1FP9A 4AWEA 1PZ3A 4CD8A 3CHCA 4B9YA 1GZJA 1LL6A 4CU8A 4K68A 1AMYA 1E4NA 1JD7A 4BS0A 1HJUA 1KBKA 2YDRA 2WMJA 4KH2A 3AXXA 3W25A 1TA3B 2BY3A 3K4AA 2J8FA 2XSBA 2GJRA 4CU6A 1J0JA 1MQRA 4OKDA 3AXIA 5JUVA 2CKRA 1QHPA 4HU0A 1C7SA 1B3YA 1MVYA 1B2YA 1B9ZA 2BHZA 1H1NA 1V08A 3L2MA 2OYMA 1OGGA 3UG5A 2WHMA 2BY2A 4NRRA 1XCWA 4RE3A 2A3HA 5JBDA 2V5DA 3MKKA 3PTMA 4B3LA 5HBFA 1FHLA 1BG9A 1V3HA 4M56A 5LA1A 2XUCA 1RP8A 1CXFA 1GORA 2QMKA 4V2XA 4W5ZA 1R7OA 4F8XA 2PC8A 1RD6A 1GJWA 3DHUA 3T09A 3EDDA 1QNSA 5FL1A 1JFHA 1BYCA 3POCA 1E6QM 2XWDA 3AHYA 4HMEA 4D6CA 1UWRA 1KR0A 2YA2A 5D9MA 4CU7A 4AD3A 1BQCA 5CZKA 3T2PA 1E0VA 2XHYA 1CXKA 5EFFA 2YBUA 1DTUA 2J77A 2VRJA 1WPCA 3VD7A 4XUYA 3CUFA 1DWFM 3CHFA 4PMDA 4AIOA 4IISA 3WF3A 4P7RA 1L8NA 4FF5A 1US2A 1MQQA 1BG4A 3DYOA 2WANA 4LPCA 1UZ1A 2D3LA 3BAJA 5CPSA 1M03A 1NOWA 2YL9A 2XVNA 1I75A 4RE2A 3ZT5A 3VIMA 5TD4A 1UD2A 3RJXA 1DWGM 3WBAA 1UKTA 2CYGA 2XGIA 3CUJA 3OG2A 4KGJA 1M01A 1GUVA 1H09A 1JL8A 1J01A 3ZJ8A 5JIWA 4HA3A 1JZ7A 1XSIA 1GOWA 3HU7A 1E0WA 1TVNA 5A8PA 1LWHA 2X0HA 5E9AA 4W8AA 1R87A 4QLLA 2DH2A 3CHEA 2DEPA 4JFTA 2XVPA 3AXHA 1J12A 3MU7A 3VMOA 2GJPA 4J3WA 1BGGA 2VRKA 3WN6A 4HU8A 1UQYA 5A6SA 5IHSA 4GXPA 4Z2JA 2OSWA 1I1XA 3PZOA 5GPRA 2JEPA 4Z2IA 1YQ2A 1V02E 2QPUA 3AIEA 1TMQA 1HX0A 3WFLA 2GK1B 1GQJA 3BSHA 1ZBWA 4GZIA 1E3XA 2FGZA 1E15A 1JF6A 3AROA 4HA1A 4PCSA 3SUWA 5C70A 2VT0A 2XYLA 4F79A 3DYMA 5ABFB 1VEPA 3FAWA 4UTFA 1DWIM 3WNMA 1X6LA 1GOMA 3PZQA 2OYKA 2YOCA 4YHEA 3BCDA 4UOQA 3WF2A 1BTCA 2YLLA 3GH5A 1JAEA 1X1NA 3CMJA 2ZUUA 1E0XA 4DWSB 1HN1A 1ITCA 4P8XA 2PWDA 4XX6A 1JAKA 1VRXA 1XCXA 1Q4NX 1KB3A 3TTQA 1C3FA 1JI1A 2VCBA 4DUXA 1CECA 2TAAA 4ZFMA 3WH9A 1QI5A 1HNYA 1H49A 2VURA 1MYRA 2J47A 1UA3A 1QW8A 2WC4A 3TOPA 4CD5A 3U7BA 4GQQA 4D1JA 1VFUA 1HJWA 1HKKA 1UD6A 3WUGA 1ISYA 3FAXA 4WKAA 1KR1A 2Y2WA 2DSVA 4PMUA 5GNZA 1BGAA 4WKHA 4N42A 3RILA 3WL0A 3ARPA 2FH6A 3UEQA 3ZJ6A 4B3KA 1WAWA 2XFFA 5FD0A 4L4OA 1B31A 2UY2A 1AQHA 4UZUA 3PBGA 4AXNA 3VIPA 1GVIA 3AZSA 3W26A 2WWCA 4W86A 1JZ2A 1Q6CA 1VBRA 3KZSA 3RMEA 1SMAA 4AZ6A 4AY1A 4EE9A 5A3HA 5FKYA 1GW1A 3ARYA 1E4IA 3ZT7A 3AIUA 2DSKA 2V38A 2ZUNA 2WM0A 3UG3A 4AD2A 3O6AA 1E4MM 5CGMA 7CGTA 2NW0A 3SCQA 1E72M 2O9TA 4CVWA 2GK1A 2FGLA 3N18A 3MUZ1 1WKYA 1CTNA 5ABHA 2WZIA 4HA4A 3MS8A 4DUVA 4UFKA 5LA0A 3L4WA 3WKZA 1U2YA 4JIEA 4CUCA 4OBRA 4XV0A 2J62A 4H8UA 4D6IA 3L4ZA 3EYPA 4OZOA 1WCGA 3AMGA 2J7CA 1EDTA 4HOZA 4Q22A 2X09A 5HXMA 1A47A 3CUIA 2WCGA 3W82A 3A4AA 5AC5A 4BF7A 2YL5A 1GCYA 1FH8A 4YPJA 2W67A 3UR7A 1KGXA 4JFVA 3WDQA 4E8DA 3CH9A 4KMQA 1CXLA 1U30A 3GNOA 1JGIA 3WDIA 2PB1A 1W2PA 1V6VA 2G3MA 4E2OA 3AJ7A 2ZX6A 1Q6DA 2G41A 4Z2LA 4PCTA 2XFRA 1M53A 3WEOA 5A69A 1N82A 3WD3A 3N12A 4J3XA 5HNNA 1UWQA 3SUSA 2JFEX 3EDJA 3BAIA 5AYBA 3AS3A 5IHRA 1W1YA 5LYRA 4HMCA 1NWSA 1NOFA 5BRQA 2WB5A 3RCNA 1WZKA 1AQMA 4WSJA 1GOOA 1J0HA 1C8XA 4W84A 1QNPA 1JDCA 4WIWA 3F5LA 3G6LA 1J0KA 3AMLA 3DC0A 2VOTA 1UWUA 2ZUMA 2XM2A 2WVSA 1NARA 1B3XA 1GHRA 1JNEA 3G6MA 5HOSA 2QV4A 1V3KA 3GXFA 4W93A 3CZ8A 1B3WA 3AYRA 3U5UA 1JZ8A 4FLSA 3PN8A 4TTGA 1P6WA 4UQEA 5D9NA 4BQ3A 3BH4A 4J3UA 3U57A 1BVZA 2VJXA 1HP5A 2VUYA 3ARUA 4OOUA 3WUEA 4LX4A 4AZCA 3TTOA 3WFZA 4EANA 1DWJM 3QHMA 3BAYA 3ZO9A 4UNIA 4HTYA 3VDCA 1OD0A 3J7HA 1BYBA 3RM4A 3VINA 4UQBA 3M7SA 4HPHA 4U2ZA 5DT5A 1UHVA 4P8UA 2VR4A 1M7XA 1WDRA 5DT7A 3BSGA 3ARXA 1SMDA 3WD4A 4MDOA 1UQZA 5I77A 3NCOA 4MB1A 4GO9A 2V3DA 3W6MA 3TA9A 2O9RA 1VFMA 4TTUA 1FHDA 3W53A 3K1DA 1XD1A 3VIKA 2OLHA 4X9YA 5E0CA 1OINA 4QDMA 2BXZA 2YJQA 1NOUA 3QGVA 4A3HA 5M03A 5CJ5A 2WWDA 2JEQA 1HXJA 1VBUA 1H3GA 4PSPA 1W32A 3OZPA 2V3GA 3WMBA 3ZSSA 1IV8A 1W9PA 3FN9A 5I24A 3CUGA 3SCWA 3B9DA 1F4AA 2XVLA 1UR1A 1WDQA 4TXEA 2ZX9A 1EHNA 1D2KA 2XWEA 1V6YA 1GONA 1TCMA 3QOMA 1UG6A 2DSZA 5D4YA 1E70M 2XSAA 1R7AA 4R5EA 2CPUA 1QHZA 5CGTA 4S3KA 1MW1A 1WP6A 1HL8A 4IPNB 6CGTA 4UFLA 2YL6A 1PPIA 4RL3A 4M29A 4GKLA 1NH6A 3FHAA 3PZVA 3VIGA 4W8LA 4GINA 4JL2A 2WMGA 1HJQA 3CGTA 3FXYA 2DT1A 2VR5A 4YN5A 3WDJA 5D8WA 1E5JA 1UZ4A 2GDVA 1XHGA 4HPGA 2WKLA 1E55A 2UY5A 2DDXA 5A6BD 2VQTA 2QPSA 2BXYA 2XFYA 3PZUA 3RIKA 1BYAA 5JBFA 2V5CA 5I79A 3VMNA 5I2UA 2J4GA 4P7NA 1JYNA 1AQ0A 1HF6A 1O6IA 4PMOA 1H11A 1QW9A 3BGAA 4KWUA 3TONA 3VDHA 4P7QA 1XH1A 4AZ7A 4N0RA 3AHXA 5KEZA 3CHDA 5A95A 4JHZA 4JZ5A 2XVKA 2JE8A 1O7AA 1E1EA 1E5NA 3B9AA 1UD5A 3SURA 4V27A 5I3DA 4LXFA 3MUY1 2VVSA 7TAAA 2NSXA 5M3WA 2VO5A 2J7BA 4JAWA 1EXPA 1KGWA 2PBGA 2V3EA 1V3JA 2OYLA 2GDUA 1CXHA 2JIWA 5A8OA 3SUUA 4X0VA 3MO4A 8CGTA 4AD0A 5A8NA 1FA2A 1MWOA 3L4UA 1ESWA 2VNCA 1BVNP 2J7HA 1HJSA 1HIZA 4CVUA 1LG1A 2F2HA 2W91A 4EK7A 5I6SA 3JUGA 1Y7VA 1OGSA 1BF2A 3ARTA 2DGAA 2A3AA 3WBEA 4UQ9A 4GZJA 2RGLA 4UOJA 4J3SA 1JIBA 3F5KA 2DSWA 2Q8XA 2CHOA 1WZLA 3L4TA 1VJSA 2EQDA 3WNNA 3LPGA 1U33A 2WHLA 3WNPA 1W3HA 3B9EA 2G3NA 1BLIA 2JF7A 4D6FA 3MMUA 1KXHA 4QCFA 1EGZA 3VIFA 3VMPA 4LYRA 1R86A 3VO0A 1DWHM 2VX4A 2PI6A 5BXRA 1B90A 4P7LA 3PHAA 2OSYA 1KQYA 3PZ9A 2DPEA 2V3FA 4AZ5A 3ARWA 4KRUA 5FOOA 2YL8A 2Z1KA 2OWCA 1IZJA 5C8BB 5A8QA 4GO8A 5LA2A 5A6JA 2CIPA 3UETA 5I0DA 5CG0A 1CWYA 3E1F1 3IK2A 2CBIA 1W1TA 3WEMA 3W28A 2XTKA 3GBDA 2WVTA 2WBKA 3AMCA 3PZTA 4WKFA 4D1IA 4U2YA 1G0CA 3SCOA 5C71A 4MNMA 3GZAA 3GM8A 1RP9A 5CSYA 2W66A 2WCAA 4W88A 1C91A 5IFTA 1CIUA 5DMYA 4AW7A 1WNOA 3BC9A 2EBNA 3MMWA 2X8RA 4S3JA 3WUFA 1XYFA 3ECQA 4OIFA 1C92A 2VI0A 2WAGA 3CPUA 4XZBA 2G8ZA 3ZSTA 4IPLA 2W4XA 3VNZA 1EA9C 1TG7A 2EO7A 2XJ7A 4AZCB 4EAMA 3HN3A 2CITA 1RPKA 3WQWA 1C93A 3AHZA 2JIEA 2IXUA 3VGDA 2XGBA 1MFUA 3ARSA 1VEMA 1QVBA 2CXGA 3VNYA 2ZX8A 4NZCA 1E43A 1TUXA 3ALGA 1CEOA 4MAZA 3VGHA 1KQZA 1MXGA 1CLVA 4QP0A 3HJEA 2QLYA 5CSUA 4QFUA 2AAAA 4NRSA 4UQAA 2Y4SA 5A94A 1C90A 2ZXAA 1CGUA 1OBAA 4CD4A 2D0HA 3W29A 4L4PA 4E8CA 4UZSA 3VIOA 5FL0A 1IZKA 1JYXA 3AIQA 3CZEA 5BROA 1JYWA 1CGTA 3L2LA 2BV9A 3I3DA 4BQ5A 1PX4A 4LGXA 2VZOA 3DHPA 1NM9A 5E6ZA 3UG4A 4MB4A 1QI2A 1XSJA 4E4PA 1BFNA 1CXIA 3THCA 5A2BA 2OWWA 1UH4A 3W6LA 3MV01 4MNLA 1MXDA
chains in the Genus database with same CATH superfamily
4OBTA 2A3LA 4HJWA 5I06A 5CAHA 2HXUA 3KBWA 4FK9A 3ZOAA 3TW6A 1JZ3A 1IEVA 4TIMA 2EPMX 4YHGA 1UR8A 3H2MA 3L4YA 4ZE4A 2P53A 3CTLA 1VPQA 3SRKA 1V51A 1ICPA 4H04A 4GIAA 5HNUA 4NZ4A 3IJ7A 2R9RA 2FQIA 7A3HA 4JFWA 3A5VA 1VYSX 2HISA 3KE0A 1L6SA 2FHFA 2JALA 1BRLB 3FYYA 7ENLA 2BVDA 2QJNA 3V1HA 3B4UA 4J5NA 2ZXQA 4MNKA 5D8ZA 4DZHA 5LIWX 5G2IA 3OLIA 3VILA 4HOXA 4G5DA 3R12A 4Z1AA 5F7UA 4O1EA 2VC6A 3WH8A 4UFHA 3VE9A 3DFOA 4JR5A 1UA7A 3CH0A 4U3CA 3BLDA 1XLGA 2RDWA 4JTJA 3TFCA 4WHBA 5G1MA 2QDHA 4Z2HA 1OFDA 2CC0A 4HVXA 1I6NA 2Y5SA 2CLKA 1NY1A 3TN4A 1TFVA 3LI0A 4XBJA 3GR8A 1WBHA 1FWHC 2VWSA 3THDA 3WLHA 3IAQA 1TE6A 5D05A 4M80A 2J6VA 1V3IA 4FOUA 3WQ5A 1LWJA 3EPNA 1PKLA 4QCEA 3REQA 1QR7A 3WQ8A 5FEXA 3CJPA 2Y24A 5FACA 2NVCA 1UKOA 4ATDA 4MG4A 4XAFA 3TU9A 1TV7A 3SO7A 1W31A 4DNHA 3GNPA 2V63A 4YMZA 4O1FA 3VNJA 1SYTA 2PSNA 1RD5A 1P7TA 3ARVA 4PN2A 3VNLA 1EYWA 3HM7A 1GTEA 4L9YA 4K2SA 1TZ9A 2ZA2A 4H9XA 1VH7A 4MUZA 3U7VA 3D3AA 1JG9A 1Q63A 4TQTA 1PIFA 3HTWA 3KBMA 4M1RA 2AKMA 1R2TA 3NDOA 3EPMA 3ITTA 2OELA 3VU2A 2C8NA 4DO5A 6TAAA 3O7UA 5D03A 2A3EA 3ES8A 4I9JA 3F1QA 4NILA 5C0QA 4TMBA 3P81A 1HVXA 4QGCA 5BWFA 4JX5A 4BHYA 4B9ZA 1K9TA 2JGYA 1Z32X 3L9CA 3K8MA 4TVUA 1NJJA 1UWTA 2ZRUA 2WCSA 5LGZA 1UR2A 3WQGA 3W1LA 4BEQA 4DO7A 3MSDA 3VAVA 5CBBA 2CLIA 2EKCA 3WMCA 2GQAA 1LQ0A 4GPNA 3KOFA 4GZEA 4HK6A 3VGFA 3S2NA 4R7WA 2UWFA 3CWHA 4HK5A 1EEPA 3KBNA 4C6NA 1A5KC 1HFBA 3T0BA 3BAKA 4JTUA 3VFCA 5BZAA 5D2TA 1M1BA 3TYUA 4LW7A 2W62A 3V36A 1V3MA 3FYPA 1XPYA 3SM0A 4Z2GA 1OB0A 5KINA 1YNYA 4I7UA 2V6AA 1E71M 4PBEA 1XINA 3MVIA 3ZWSA 4U3AA 5C9ZA 1HZYA 1GYNA 2FZ8A 3SEPA 4HNNA 1DQXA 2MANA 3GDBA 2Z6JA 1VYRA 4H7ZA 4ZXOA 4O0ZA 1PIGA 3LPOA 3AIWA 2VEIA 4RW5A 4C7FA 5HNRA 4Y9NA 3PJUA 4AYGA 2J8GA 1OCQA 2G4FA 3MB9A 2WM1A 3AI0A 4QLJA 4JN8A 1ISZA 3JZEA 1R30A 3SFKA 3JR2A 4QQUA 5EU9A 2PMQA 3UVIA 3GG1A 2V5KA 2YLAA 3GHUA 3C0JA 3D0CA 2BX7A 4FNQA 2G96A 1W54A 4HOWA 2P76A 2ZKMX 3HFTA 3D47A 2A85A 4DJDA 1DXEA 2B7PA 1FXPA 4XD4A 3T6CA 4DXKA 3G1HA 1AZ2A 3N13A 3TCEA 3WJWA 1OIFA 4ZSTA 4JNYA 3CPRA 3NG3A 3DDMA 2IS7A 3PZMA 3W72A 4W9TA 4HZMA 3BGJA 3AYTA 5D30A 1LZOA 2BVTA 2H9AA 3HGJA 3LXAA 3HJZA 2GJNA 3LHYA 3VD4A 4KESA 1SZNA 2YCIX 3SY1A 1E6XM 4A05A 3GH7A 2YA0A 4C7GA 2C15A 3YPIA 1NF0A 3BLPX 2C18A 4OJYA 1Q6FA 2WSQA 2DUXA 3CMFA 4UTHA 1XLDA 1VZWA 3JS3A 3DECA 1SFLA 1O4UA 5FEWA 3N04A 3LCGA 1QBAA 2PURA 3IANA 4TVDA 2DZUA 2WMIA 4PMZA 2G3IA 2C7FA 5AN7A 4ES4A 4H9MA 3UD6A 2FB2A 2VD8A 5DBTA 3WG6A 1IT0A 1DJXA 3TQPA 2VX7A 4XBSA 3VNIA 2R91A 4AVOA 2NLYA 1XXXA 2Q8LA 3WUBA 2CBVA 3B04A 3RAOA 3MSYA 1SJAA 3W38A 1F76A 1RQEA 3NVDA 2B4GA 1FFRA 4ZGYA 2PP3A 4FI4A 3ANVA 2WJDA 1E4LA 5BCAA 1O12A 1LWIA 1ZBVA 1Q8AA 2PDMA 3LGDA 2BVYA 3OB8A 2DIKA 3AS2A 2E8ZA 1P7TB 3S2LA 4Z1BA 3C2EA 1GHSA 5J04A 4IUOA 2PDUA 3KVJA 3ZLFA 4MSSA 5EL1A 2NT1A 2TMDA 4PBGA 5A6LA 3CZGA 5GNXA 3G1SA 3W7KA 4MADA 3MDWA 2A5HA 5LZLA 1MI3A 2NT0A 1B1YA 4MTVA 5DANA 3C6CA 1MRQA 3AHTA 4UTWC 1SFJA 2Z00A 3ANYA 1HL9A 3H2NA 4D6DA 5XINA 3WLOA 4UQDA 3A13A 1TVPA 1QI0A 4TO8A 4DJED 1DJYA 1C8YA 4AISA 5JVLA 3LQGA 2I5QA 4HMDA 3GR7A 4DQWA 3NQEA 1EUAA 2IXVA 3AIBA 1NDZA 1OM0A 1A4MA 1LTDA 5HINA 3RHGA 3BJFA 4XB3A 2RJGA 5TQLA 1K8XA 5HJYA 1KM4A 2BFGA 2NVDA 1JUKA 4BZYA 2NXIA 1HL2A 5KMYA 1U1JA 2ISFA 1VBHA 4UR9A 3GXIA 2QF8A 3ZLGA 2WC7A 5H1WA 3JVAA 2CHNA 2YIHA 2A3BA 1W91A 3BURA 2J74A 3GUWA 1FRBA 4ZTYA 4JTGA 4PMQA 3M64A 1E6RA 3THAA 1C8VA 3N4EA 3B0YA 1NFPA 1KBBA 2E5CA 2J9XA 1BSIA 3APGA 4JTTA 3GG7A 4CCEA 3RO6A 2PS2A 3U0HA 2RKXA 4K8EA 3WELA 1TPVA 4OBSA 1PS9A 4J3VA 4H00A 3STEA 1OCJA 1MW3A 4CGTA 2CCRA 2FDMA 1BPLB 4LYPA 2EJ1A 4NJGA 3I3BA 1ZBCA 1H41A 1PKNA 3GNDA 3V5CA 3GE7A 4LFYA 2X05A 2GJLA 4UCFA 2CZFA 3CQKA 4JQAA 5BYWA 4GCAA 4QLKA 2H3BA 1CLXA 1PBGA 3MV11 2DIEA 4MWAA 2RAGA 2V68A 5REQA 5A1AA 5M1TA 4JKLA 2EPOA 1YKWA 3KCLA 3CMGA 4FALA 1JF5A 3NFUA 5E0FA 1VFTA 2VRQA 3DC8A 3N15A 2EJAA 2VFEA 2WZHA 2X0YA 3G3DA 1J2BA 1EJSC 4H9YA 1RAKA 4X60A 4ZQCA 2IPJA 4D9PA 1Q2RA 1CDGA 4KGLA 4QDWA 2BGNE 3P14A 3OU8A 4PMVA 1W5MA 2CLEA 1BXBA 4NL1A 3MCMA 3SCRA 1O95A 2EPNA 2QMJA 4AEEA 3NO1A 1ENUA 3NQBA 2VZSA 1THFD 4IPJA 5HPCA 1QXLA 3I10A 4XAYA 3RUBL 4H6EA 2Y89A 2QXWA 4H6KA 4C90A 3T2QA 3O8AA 4JTDA 1LL7A 1EOKA 2W79A 3N2OA 4F9DA 3HG2A 1E3ZA 3IAPA 4Q4MA 1JPIA 1X1ZA 3CAWA 3FLUA 4U10A 4LBSA 5E0KA 2CKSA 4LNYA 2P3ZA 2F9RA 3SCTA 1G69A 2RJHA 3LERA 4ICNA 3TMLA 1GOIA 1UR3M 3NPVA 3TVAA 4PTMA 3U4FA 1UH2A 4ENLA 4J28A 3VKBA 4KEMA 1DXFA 5F1VA 4NI8A 4WSKA 3G3MA 1XIHA 4X9SA 2VCAA 4UTTC 1ISVA 3UXDA 1EDGA 3S2JA 1LT7A 1ZZMA 4S1FA 4IG2B 1ICQA 4P2VA 2X2YA 3T8QA 3BMXA 4JFSA 3F5JA 4H7VA 4XSLA 5AHNA 3SIMA 3NYDA 1PO9A 3S1GA 3STPA 1XLIA 2WLZA 1AFSA 2PGWA 2CWXA 4W8BA 4PEKA 2F2KA 3GG8A 4LC6A 3FEQA 1R2SA 3UZWA 5KTLA 4MDPA 3W24A 3BV4A 2VX6A 1B3VA 3LBMA 3MUAA 3WNKA 4YWSA 1E56A 2XPKA 3OBKA 1YNPA 3W73A 1H60A 4GX8A 5LNVA 2PBOA 4KWVA 3WH5A 4NHVA 2CHRA 3QTGA 4U28A 3WK3A 4RPQA 1JI2A 3RO8A 3BCJA 2RH9A 4GFSA 1SJDA 2NXHA 4B15A 2VFIA 2EPLX 3QOKA 1KM5A 2W61A 2WVVB 1PDZA 4DPPA 1NU5A 5BOOA 4YLWA 2B0MA 1CGVA 4KT2A 3BLKA 4UFJA 2O9PA 1GEQA 1B9BA 1VCFA 1NF7A 3E5PA 4FZIA 4JCLA 3Q37A 3P0WA 4YL2A 3EXRA 4FXRA 3WD2A 4JTCA 1E6NA 5DF0A 5CEWA 3IVSA 5AB3A 3E02A 1UWAA 4LS1A 4P5UA 1TPC1 1WXZA 4ZQPA 4D6EA 3HG3A 3WENA 1BYDA 3I4KA 1EXBA 2VX5A 2FZNA 3CAQA 2XGZA 4WJXA 2YXGA 1ONXA 2ODOA 1KBIA 3UWUA 1X7IA 3S46A 4ACZB 2VDIA 4N6FA 4PL1A 1PKYA 2BLEA 3UERA 3GUGA 1QNOA 1VF8A 4ACYA 1V7YA 3NPWA 1GQKA 1RR2A 3O3RA 3BAWA 2QCFA 3OYXA 1PKMA 3HG5A 4RK8A 4DJFC 2VEMA 3K5XA 4C6BA 4B9YA 4CU8A 4R9OA 1Z69A 1AMYA 1E4NA 4LRSA 4LUSA 1HJUA 1KBKA 4LS2A 2WMJA 2PDQA 5D02A 4KH2A 2J88A 2BY3A 3NEHA 3TJXA 2XN0A 2EG8A 5FSDC 4LSBA 4F2UA 1J0JA 4S3BA 1J6PA 4GMEA 1R9YA 4GQBA 1EX5A 3NNTA 3W02A 3ABSA 1XP3A 4J1OA 2ACRA 1XCWA 2PDCA 3B8DA 5JBDA 4B3LA 4LUYA 2ANUA 5HBFA 1FHLA 1ZLPA 3HGSA 1WOAA 1EIXA 4XAZA 1RP8A 4W5ZA 1RHCA 3PB0A 1K7XA 3DHUA 4HN8A 2E6FA 3GFYA 4FNUA 2PCQA 1E6QM 2YFOA 2OT0A 1GVQA 4HMEA 4AHOA 4Y90A 3FYOA 4ASTA 4KRZA 4JBRA 1KR0A 1OFBA 1XIJA 2YA2A 2BOEX 3GDKA 4US5D 4CU7A 5B80A 1BRLA 4MZ8A 3LTSA 3KHDA 5EFFA 3G1XA 2YBUA 1XF0A 1DTUA 3N29A 1UP3A 1UIOA 3VD7A 2VFDA 1RBAA 3M6YA 2BG5A 1DWFM 3IV8A 4L7ZA 3QEZA 1UCWA 2CLLA 1R3QA 2EG6A 4IISA 3VZYA 3GNXA 3NL6A 1RXOB 2QCEA 5CPSA 4IIHA 2IQTA 3CASA 3O0FA 2YL9A 4ZODA 2XVNA 4RE2A 2YCLA 4KCUA 3THQA 3TJIA 2E6AA 4BK9A 3FCPA 4PL2A 3TLQA 4DBDA 2CYGA 3B8IA 2FZMA 5I3KA 3TNOA 1TV5A 3NL2A 1EJUC 1JL8A 1J01A 4REQA 1PB0A 5D2XA 3KXQA 4DNMA 5EYWA 3MQTA 1E0WA 1TVNA 2REQB 1LWHA 1POKA 4CNTA 6REQA 1FCUA 1W8SA 1YEYA 3CHEA 3NO5A 2O7QA 5C2XA 1OHLA 3S6OA 1UMLA 3AXHA 3VMOA 3CAVA 4J3WA 3ORWA 2VRKA 3WJYA 1M6JA 3BG3A 3SJNA 5EKYA 4GXPA 3W83A 3NA8A 4XBKA 2GQ3A 4MVAA 1YQ2A 2P3EA 1XIFA 3Q94A 1F2JA 1WKEA 5F4XA 1GQJA 3N9RA 4PCSA 4KEVA 2XYLA 4C1KA 2Y1HA 4GH3A 1F3XA 5LHEA 5AYZA 3P61A 2F6UA 1GOMA 4LS0A 1R6WA 4IWWA 1ZGDA 1IQ8A 3TAKA 5FAJA 2H8XA 4HQVA 1M65A 4IIBA 4K7VA 1SJCA 2ZUUA 3DFNA 1HN1A 1Y8BA 3IARA 4DWSB 1XG4A 4O8AA 5GJMA 3O07A 2VCBA 4LTSA 3W22A 3KRSA 1JULA 4N7QA 3WH9A 1H49A 4M6VA 2R8WA 5DCDA 5I00A 1U83A 5EBUA 3TOPA 4S23A 1DJGA 3LCIA 2C16A 1HJWA 1A5OC 4AHPA 3WK2A 4PMUA 3NR0A 2E09A 3FDKA 4WKHA 3ARPA 3UWYA 2I14A 3A5FA 3BOFA 1OCBA 3ZJ6A 4B3KA 1WAWA 1BXCA 4PTDA 9XIAA 1OFOA 2UY2A 3PSVA 4UZUA 2V82A 3TSBA 3AZSA 3A3XA 2XH4A 2WWCA 1JZ2A 1Q6CA 1VBRA 4NZ1A 4ORMA 4AZ6A 1M41A 4AY1A 4EE9A 3N3MA 3ZT7A 2QEZA 3IRDA 2Z1VA 3GTFA 4YVXA 1P0DA 4WRHA 3UZJA 1G7VA 4B5XA 5CGMA 7CGTA 4UTTA 2GWNA 1E72M 4GYPA 4LB4A 1QJWA 4MWAD 3N18A 2WQDA 3L68A 4HB7A 3NAVA 4DUVA 3TYDA 3L4WA 3ZR4A 3HOJA 2F84A 3TQ0A 1OC5A 1H50A 4MY9A 2YCEA 2NX1A 4XV0A 1L6FA 3Q2DA 2IQDA 1VLIA 4O54A 3CV2A 3W7MA 1DOSA 4Z0SA 1DJNA 2PDBA 5LNWA 5HXMA 3W82A 2Q71A 4M19A 1LBLA 5CJNA 3UR7A 1D3GA 1KGXA 3LRKA 1JCJA 3C2VA 4M6QA 3DHDA 1JGIA 3S8HA 2PDHA 1V93A 3THUA 4RDYA 1Q6DA 4Z2LA 3A24A 2XFRA 1M53A 1E51A 1Q6QA 3DFYA 3WEOA 3EOLA 3N12A 3H12A 4R3UA 5AYBA 1GT8A 1FWAC 2OFJA 4HMCA 4DYKA 3I4EA 1WZKA 3SRDA 2AQOA 1XPGA 4WSJA 1E9YB 1J0HA 4DX3A 2Q02A 4AX7A 8XIAA 8TIMA 4GISA 1J0KA 1X8FA 1OFEA 2VOTA 1UWUA 1YXDA 3CO8A 2ZUMA 2XM2A 2WVSA 3SFWA 1UUMA 3PAJA 1B3XA 1JNEA 3G6MA 2QV4A 3GXFA 1TCDA 3QPYA 4QJ4B 1B3WA 1KTBA 4BF5A 3ITOA 3LUTA 1A0CA 4ZOBA 1TV2A 3KRZA 1JZ8A 3EOUA 4TTGA 2V5LA 1P6WA 4UQEA 5D9NA 3BH4A 4JQ2A 2O0TA 3LN3A 1ZAHA 4J3UA 2ISWA 5HJLA 1BVZA 7REQB 2VJXA 2XSXA 3QYSA 1HP5A 1GZ1A 2VKZG 3WUEA 4LX4A 4CNPA 1DWJM 3VXGA 3IJQA 1HGWA 4ERIA 1K03A 1M3UA 3IJLA 1W6TA 3GR4A 3GS6A 3PC0A 3E49A 3M7SA 4U2ZA 1UHVA 2PP1A 1U5VA 3ITXA 4D2JA 1M7XA 2E6DA 2QR6A 3ARXA 3STCA 4MDOA 5I77A 1X7FA 1W5QA 3W6MA 5I7GA 1FHDA 1XD1A 3UZXA 1TPH1 4Q3MA 2OLHA 3BJTA 4QDMA 5GVJA 4E4FA 2BXZA 2YJQA 5CJ5A 3HPFA 1E1CA 4I9MA 3DCPA 4KPLA 3KRUA 3WMBA 5AHFA 3QYQA 4UNLA 3CUGA 4L9ZA 1F4AA 4QEEA 2GGEA 1QWGA 1UR1A 1XLKA 3IRSA 4TXEA 5HMDA 4LUIA 5IRPA 1F74A 5I3GA 1VQTA 2YBVA 1FWDC 4GQ0A 4IL0A 2A0NA 4D8AA 1NTHA 2QCGA 2PEVA 1UG6A 5D4YA 1LRNA 5LNSA 4KF1A 1P0EA 1Z8AA 3CUZA 4R5EA 2CPUA 3HPXA 4RL3A 2D2JA 4M29A 4WSHA 4KFNA 1IT8A 1BEUA 4F2TA 1HJQA 1WUEA 3QLDA 4G7EA 2MUCA 3FXYA 4YN5A 1E55A 1PDYA 4NX0A 3M1ZA 3MY9A 4F0KA 5JBFA 1BYAA 1TJ0A 2V5CA 5I79A 3VMNA 4XD5A 3UG8A 3KFTA 1Z9AA 4Q8QA 1MNZA 1QW9A 2QS8A 3QMTA 3E2QA 1RVGA 3ITGA 1EJVC 3UQNA 3BSMA 1S2UA 3C8FA 4K39A 4LJ3A 4YNGA 2YXXA 5A95A 5D32A 2AGKA 1XW8A 3GXTA 4JZ5A 3NQ2A 1RK5A 4IFKB 1EJ7L 5MHBA 1O7AA 1E5NA 3SURA 4I7WA 5I3DA 4LXFA 2ZRWA 3DI0A 2OVLA 1I45A 2GL5A 4JOMA 4PUWA 2GVJA 7TAAA 1E0UA 4DF1A 2VO5A 2J7BA 4LUJA 1EXPA 2PBGA 3Q67A 4UR8A 1V3JA 5ENLA 3FXGA 1CXHA 1KV5A 3SUUA 4X0VA 3H6OA 1TV8A 1FBAA 2QULA 1MWOA 3BICA 1J79A 3L4UA 4J9JA 1LUCA 3EA3A 2Z2UA 5K9CA 1DHPA 1LG1A 3JUGA 1JCYA 4J2MA 3ARTA 2DGAA 4F48A 3E2SA 4GZJA 4KW2A 1GPWA 2RGLA 4HMNA 5K3VA 1U5JA 4XUGA 1WZLA 3WNNA 3OPSA 4IJRA 3EX3A 2FJUB 4AH7A 3LD5A 2I56A 1W3HA 3PBYA 1J5TA 1LCOA 2V69A 5C2GA 4O18A 3MHUA 3ITLA 3WLJA 3GIPA 2HBXA 1R86A 1DWHM 5BXRA 4O1AA 3GG0A 1KQYA 3PZ9A 2DPEA 2KZHA 4F0RA 4AZ5A 3USBA 2RHGA 1YXYA 2YL8A 3TSMA 2OWCA 5C8BB 2OO0A 4B5VA 2PPGA 1CWYA 3E1F1 1KRCC 4BJHA 3GBDA 3H4GA 3AMCA 4WKFA 4D1IA 5C71A 1G0CA 3SCOA 4IFOA 4MNMA 5IDZA 4FOKA 1C91A 2Y63A 5DMYA 3OW1A 1WNOA 1KFCA 4HNTA 2X8RA 3CL6A 5DMNA 2O56A 3ECQA 3B40A 4XZBA 4N4QA 3CPUA 1RSCA 2WNQA 1TTQA 3GAYA 3IIVA 3ZSTA 4FO4A 4IPLA 4K7YA 3FVMA 4YCPA 1F3EA 4NVTA 4EAMA 2ISVA 5B7ZA 3AHZA 2HPIA 2JIEA 3L65A 4I8YA 1GTHA 5G4HC 3VGDA 4ZBCA 5KZDA 3UW6A 3ARSA 3RPDA 1QVBA 5FI8A 3H4XA 2CLHA 2Z1BA 3ALGA 3STFA 3DHFA 3TW9A 1MXGA 1CLVA 4O11A 3ISIX 5XIMA 2PUZA 4H9TA 3QVQA 4QG9A 3CV6A 3WQOA 3W00A 5FJTA 4L4PA 3PNZA 2NZLA 4E8CA 1FWTA 4QSHA 3P93A 1ZHAA 3LHUA 3NPXA 2Y70A 1JYWA 1CGTA 2BV9A 3I3DA 3LSCA 4BQ5A 4BWLC 4LGXA 3DHPA 4PCNA 1NM9A 5IM51 3AUOA 4Q8OA 4H1ZA 2J27A 1A5UA 1IXPA 3PS7A 4A3UA 4MWAC 3SB0A 4WCJA 5A2BA 3NGFA 1UH4A 3IGHX 5CBIA 3BL3A 4HHHA 4PUMA 3IVUA 1UP2A 4ML4A 4WQ6A 2IKHA 3B3DA 5IFPA 1PWLA 1OVDA 2XG9A 4PUJA 4E38A 1EPVA 3H2EA 1V6UA 4C6OA 1I1WA 4W87A 5LKYA 1AL8A 3P7YA 3G24A 4AYSA 1TMLA 3CPGA 5BRPA 3S4TA 1LROA 2R6OA 5EMYA 3EZ4A 3C0QA 3HPZA 5H91A 3NXFA 1OEPA 3NQVA 5BW6A 5JIPA 3S9YA 1G1YA 1AH3A 3RFAA 3LHWA 3ZT6A 2D1ZA 3HV8A 2VMFA 3UWEA 5D2VA 7ODCA 1SR0A 2XFWA 4XISA 4LV4A 1W1IE 1VB9A 3O6CA 4D71A 3FJ6A 3GXPA 1B4KA 2YDQA 1YADA 3G1YA 5AZ1A 4Y6GA 3V4BA 3UXLA 1AVAA 1JQVA 3WZ0E 1UASA 2JF6A 3E0WA 4ZE5A 2HVMA 3BLOA 1L2UA 4A29A 5BXSA 3AWNA 2QJJA 3ATYA 3VX1A 1PX8A 4WF7A 3WQ4A 1WO2A 4PTXA 1AUSL 2QIIA 3XIMA 3PTKA 1E6ZA 4AF0A 4DB7A 5HPOA 5DY2A 3EDFA 9XIMA 2OB3A 2ZVRA 2QNEA 4UTKA 1H62A 3T42A 5BOFA 3M5XA 1PTDA 4E2VA 1W9BM 4BFAA 3BK0A 3EBVA 1KXTA 1B5TA 5ECUA 3VOHA 1W3JA 4ADUA 4ILSA 3AMKA 4Y9PA 4B5UA 2PF8A 1V3LA 3DBNA 3N3TA 3OGRA 3M0XA 3MDUA 4JQ1A 3W1PA 3U9IA 2O7SA 4FLRA 3VIHA 2J7EA 2VTFA 3HPSA 1JCLA 1J0ZA 3DI1A 4OOZA 3EMCA 3CTTA 2ZX7A 4WOQA 4AVNA 3T0TA 3DXIA 3O05A 2YZRA 3TKFA 3RLVA 3GTXA 4GWEA 2ACSA 1MDRA 3E2VA 3SY8A 1QPKA 3AFBA 2OOFA 1VCGA 4JQ4A 4DEFA 3CO4A 4GIRA 2XIOA 1XI3A 3HQOA 1LBMA 5FCZA 4QS6A 1B30A 2BGSA 2BNJA 2FMOA 5IDIA 1V5XA 2NSOA 1VC4A 3VPLA 5HATA 4NX5A 2G3JA 5C9RA 1A5CA 4WLCA 3PBWA 1DP0A 1TMHA 1HKWA 1R3SA 5I23A 5E5CA 1S46A 1EIBA 3V18A 3V5FA 3EMZA 1DYSA 1L8PA 4YVVA 1WA3A 1XH0A 3E74A 4DELA 5MKGB 5G5IA 5C5YA 4UNKA 3WK1A 4W85A 2NQJA 1VKFA 4ZEPA 4NJKA 2E7FA 3MMTA 5CBJA 2Z2AA 2ZE0A 4KCVA 1V03A 5E09A 3G22A 4DWSA 5HQEA 1UBPC 2TRSA 4KEUA 3WL1A 4X22A 4A8LA 4QSFA 1U1UA 4UUIA 2FHCA 3GTIA 3EX1A 3IGUA 1W3TA 2ZA3A 5L6UA 3BGGA 1T8QA 5EMUA 1TR1A 1VFHA 1JRCA 1W1PA 3LMZA 1SZRA 4RDZA 1UR0A 2UBPC 1RH9A 4L64A 1XGZA 3KOYA 4J27A 1F5ZA 3TH6A 3UY7A 4HNVA 1CPUA 4S38A 3LG3A 3WJXA 3MJMA 4DM1A 4FS9A 3HMJG 3ZJ7A 2X1SA 4LT9A 4QIUA 1QI4A 3G1DA 2D24A 3T0DA 5C2CA 3IWPA 5AHLA 1POJA 4RE4A 3BW3A 4AUBA 3EA1A 2LLEA 4YIWA 2WNWA 1D3CA 2DT2A 3LCHA 3P82A 4JFUA 3OA5A 3DYPA 1HKMA 3N2MA 4H8HA 4DJFD 1HVQA 1IYXA 2WHJA 4CQCA 1UPMB 1TWIA 3KAOA 2F6KA 1FVPA 1UKQA 4I5RA 1XYZA 2I17A 4QROA 2Z1XA 3NIYA 1W1B1 3HG4A 3VDBA 1CXEA 3AHVA 3QKZA 2X40A 4IMEA 1KLYA 2WMFA 5T9CE 2G95A 1W1VA 1XSKA 3SCNA 2FIQA 3GDRA 4D6GA 4A8RA 3GZ3A 4FR6A 3USZA 5I5RA 3R8HA 1TJ2A 2VGBA 1UUQA 3HA1A 1MW2A 4TR9A 4XWUA 2P0IA 1GKRA 3QR1A 2HTMA 2QZRA 2VC9A 1QI3A 4Y8EA 4ATLA 3I7QA 3GNRA 4I9AA 3LLDA 1ONWA 4G56A 3QHNA 4DO6A 4PH6A 5AZ0A 3VKAA 4GI9A 2CERA 3PULA 3UJSA 4PSRA 3BCFA 3QV8A 3U6WA 1NFBA 1DL3A 2ICSA 3SR7A 3NGJA 1RUSA 2PU0A 3WF1A 4FSAA 2OSXA 3VZXA 3LB0A 3PZGA 1Q5MA 2C0HA 3B0PA 4R85A 4G8TA 1HKJA 1FFQA 4B4HA 1JDDA 1ZJHA 1R9XA 4TVCA 3WIJA 2Z6IA 4Z08A 1KTNA 3NPUA 3T07A 3F2CA 4XQ6A 1MFVA 2QIWA 3WNOA 1V0MA 3EAUA 2DQXA 3W1UA 3T78A 2D2OA 3WQ6A 3OVGA 3NYZA 4NG3A 1W9XA 3NQMA 2VEKA 1YDYA 2ZUTA 4P7OA 1B0IA 1X6UA 4QRNA 5FF2A 3W74A 3QBUA 3ZIZA 1T6MA 1HQTA 5EFDA 2EF9A 4R7JA 1FDZA 4FLQA 3T0AA 1I0DA 3U4AA 2SFPA 4XVEA 5FJOA 2QT3A 5H8UA 2QF7A 1ITQA 4HD5A 1CW2A 4AD4A 3IUIA 3TYBA 5DCEA 1TPEA 1S39A 3ABXA 2WPGA 3H8AA 4FP1A 4J4KA 4YCOA 3QR3A 4V1XA 2D20A 3LNMA 1LLOA 4YJ5A 2VEGA 1H7PA 2H3DA 4R27A 3PUGA 5LIYX 5HA7A 1XX1A 3VX0A 3AIRA 4DAIA 1DPMA 1OFQA 3A4WA 2PTYA 2V81A 3C8NA 2HMCA 2GVEA 3P62A 4GNVA 3UPBA 3WDRA 3KTCA 1ME9A 1V02A 3NDYA 4GUJA 1F9CA 3QY8A 3SGGA 3PBUA 4QE4A 4PUDA 4LYKA 3B06A 4O8RA 5I78A 1BAGA 3IJ9A 4LANA 2QDDA 1W9VA 3C5QA 4BQ2A 5J5RA 1YHTA 5AC6A 1Q6OA 1RQBA 4P8VA 1WKFA 1FCQA 3H7VA 3LM7A 3AICA 4JDYA 3HQPA 3S83A 4JICA 2W92A 3KTSA 1UD8A 5HUOA 3MC5A 3ZMRA 4OGZA 4ZQOA 4MNJA 4XIAA 3VZZA 3GHSA 3DUGA 3KP1A 2FKPA 4ZOEA 1QBBA 1V0KA 4HZ6A 1IWPA 3ZVIA 3OEXA 1TB3A 3NDZA 1SO6A 1LOSA 3N2CA 1VLWA 3MUIA 3BG9A 4DLMA 4AC7C 1R5YA 1SW3A 4ICMA 3B0UX 3VD9A 4WZHA 4R53A 3KOXA 3K46A 1RQHA 4IJBA 3L7RA 3LHZA 3NQ7A 4CNOA 1BQGA 1BWVA 3UWVA 1UKPA 3WCZA 4IQLA 4GABA 1Z41A 3VYLA 4LVFA 1L6GA 4Q4SA 2ZYFA 4D6JA 1KA9F 2ZUWA 3ARRA 3T08A 2D0FA 2QKFA 3R8RA 5E9XA 1IE7C 4JIIX 3XISA 1GJPA 3LHVA 4RNHA 4OECA 1RV8A 1LJYA 2PRMA 4HSHA 1YDNA 4LEFA 1MW0A 3SUTA 1BVWA 1M9HA 2VZUA 1OZMA 1K7FA 1X6NA 3C56A 4Y8FA 3U2OA 1UKSA 1DWAM 1B3ZA 1J18A 1F73A 2CBUA 1IF2A 3C0SA 3U3HA 3PNUA 4BCEA 5HULA 5ABGA 3LXCA 1UJPA 5LIXX 4EKJA 2ON3A 2ZC1A 4LCQA 3VD5A 1RA0A 1LF1A 3AYVA 3P2VA 4QEHA 3OYZA 4NSBA 4DY1A 1WDPA 5KSWA 3U5YA 2I16A 1C7TA 3ABQA 3AS0A 1K4GA 1GK8A 1TELA 1NDYA 4H2CA 1QNQA 3E0IA 1DJHA 1OGBA 1ISWA 4MAVA 1VS1A 4S3GA 4FX7A 3S5OA 3PPGA 1S38A 2TYSA 1R8LA 5D2YA 1DXIA 4UR7A 3AC0A 4MPKA 3GU1A 3HZ3A 1LQ2A 4RJEA 5EA9A 4DZIA 3TQVA 5MF5A 4DJDC 1M04A 3TDFA 4Z2KA 4WVXA 4KWOA 3H2OA 1T5AA 3N11A 1T40A 2O9OA 1A0DA 1GGOA 3MCNA 5A2AA 3URNA 5AY7A 5CXPA 1KCXA 1KNWA 1MUWA 1EOMA 3NL5A 3RPMA 3E9AA 1TIWA 2ZXBA 3VTRA 1W56A 2OWXA 4QE1A 1SO5A 2EXOA 1CGYA 3PPFA 3ZR6A 4YWIA 3DENA 5AYYA 3S6TA 3E96A 1ECQA 1W1A1 3IIZA 1ZPTA 3RM9A 3DERA 4JTIA 4M7TA 1EBHA 3W7CA 2Y7DA 1L0PA 3G0XA 3R79A 4M8UA 3WF4A 1UR9A 4HNOA 1QW7A 1ZB5A 5A8GA 2ABAA 4IZGA 1QOQA 4A3YA 1NP0A 4X61A 1XIDA 4ZQRA 3L0NA 5LIUX 4XZWA 3TTYA 2E8YA 4CQAA 1YBQA 4GFIA 5AVHA 4Z42C 4IPPA 3UCQA 3WEZA 4H41A 1ZNNA 2DW7A 3G8EA 4J3TA 4CKQA 2VC5A 1WKDA 3NURA 2FJKA 2OLSA 1V0LA 4NP7A 1DJZA 2HPMA 1I2RA 3LTYA 4EPBC 1IEWA 3QY7A 1UROA 2OODA 4UOZA 4O19A 2YBTA 1Q3NA 3S2CA 4B2DA 1BWKA 3ZLHA 2QJMA 1VJZA 4FNPA 4WDWA 3WDHA 4GK8A 4DWSD 1EB3A 4NZ5A 4V33A 3WMSA 3M6DA 2R94A 1KO0A 3TROA 2QGYA 2GOKA 4EXAA 4NIRA 2CEQA 2DZPA 1Q2SA 4GUIA 3WF0A 4AHQA 5DN1A 1QOPA 4PGLA 1K9FA 1BHGA 4GI6A 3PJXA 4WUIA 3R11A 3W70A 2BSLA 3CZLA 1VFSA 3O2LA 1EO5A 4JXCA 1P4CA 1Q13A 2ATSA 3VIJA 4ZQMA 1YLVA 2NWSA 1EF3A 1Q6EA 2E9MA 3D3FA 2PLMA 2YKKA 4DUWA 5A6BA 5DY3A 3R6IA 3SCSA 3ZM8A 3W2JA 1ECEA 3MTWA 2VM8A 1JXJA 4B16A 5FJPA 3F4NA 4DZAA 4INFA 4F0MA 3RJYA 3BLLA 4W4QA 2NVAA 4A2RA 2D0GA 1GQIA 3K8KA 5D37A 3TP4A 2F61A 2ACUA 2J7GA 5DBUA 5M5DA 3GU2A 4Q8VA 2BY0A 1GOQA 4AWEA 1PZ3A 1YE6A 3UPMA 1GZJA 1LL6A 2GUUA 1P5BA 1PSCA 2ONEA 1MNSA 1JD7A 3NZ1A 3W7QA 3W25A 3AXXA 1NIUA 3SSZA 3K4AA 1YTDA 5DRCA 3SY5A 4GA8A 2QCDB 2GJRA 4JTEA 4GYKA 3R5EA 2PTWA 1EP3A 4DI8A 5J8LA 4KEZA 2QCLA 4PR4A 1QHPA 4HU0A 4PMJA 1C7SA 1B3YA 3UGVA 1MVYA 1EP2A 3FA4A 1V08A 1CB2A 2OYMA 3FJNA 1K3UA 3I68A 3WJZA 4AAJA 2DUZA 2WHMA 3WLMA 2A3HA 5LGXA 3EWCA 3MKKA 1F61A 3PTMA 4Q4KA 1BG9A 4DYEA 5BWAA 5LA1A 1CXFA 2GUBA 3KDOA 1TWDA 4V2XA 2NUXA 4WJEA 1TTPA 3SN4A 4F8XA 4DZ5A 4DJEC 2JGQA 2OEMA 4YTUA 1XGEA 1H1YA 2GZXA 1QNSA 4HJFA 1JCXA 1S2VA 4D6CA 2KAUC 4K8HA 2VGIA 2ZZ2A 1TPDA 3PUDA 3MP4A 3F4WA 4RNFA 3VCNA 1EWDA 1OFAA 3MP5A 3T55A 4QE5A 2BODX 4QAIA 2J9ZA 3LQLA 3RYSA 2OEKA 1X97A 2D2HA 4P7RA 3QZAA 1IWBA 1S5VA 3LCXA 3KBVA 4C1NA 1HGYA 3TTEA 1QWKA 1US2A 2A79A 1XM3A 1BG4A 1VD6A 3DYOA 4A3RA 3PUEA 4LPCA 1UZ1A 1NOWA 3CQHA 3CT7A 2YXOA 4NYUA 3G1AA 4ERGA 4ZFCA 1ZALA 1DJWA 1K6WA 1CI1A 4RX0A 2NQHA 1UD2A 4KCWA 3RJXA 1GZGA 4ORIA 3WBAA 3R58A 3QN3A 2V2DA 3KRBA 3GK0A 1FHUA 4H6RA 3OG2A 1ICSA 1KBJA 3GVWA 4AVFA 1H09A 3FV9A 4MKVA 4C5YA 2FVKA 4I3GA 3VKCA 3NOEA 1GOWA 2BBFA 8XIMA 3W2NA 1KFLA 3BO9A 5A8PA 4O15A 3GDLA 1WUFA 4HSOA 2DH2A 3XINA 3O06A 1RA5A 4JFTA 3MU7A 1I2NA 1BGGA 3CB8A 4F0SA 3EPOA 2ZCGA 2VEFA 1UQYA 3GSMA 5A6SA 4Z2JA 2OSWA 1DQUA 5CPOA 1V77A 3PZOA 4Z1YA 5GPRA 1P1MA 4S3CA 4WGXA 4RPPA 4Z2IA 4O0KA 4UIOA 2QPUA 4FR1A 2HSAA 2EHHA 3BSHA 1XICA 1ZBWA 2GOUA 2HV5A 4R33A 3E6EA 3AROA 4HA1A 1US0A 4F79A 1AJ2A 4S3DA 3M0ZA 1DWIM 3KHJA 3WNMA 1EBGA 3QRHA 3WLSA 4M5PA 3PZQA 2OYKA 5HR6A 2YOCA 4UOQA 3JU2A 3GH5A 4PC8A 2QUNA 1EZ2A 3HURA 1QO2A 4EXQA 1GG1A 1VRXA 1C3FA 1JI1A 2GVLA 4RV8A 3RR4A 4QDPA 2TAAA 2ZQ0A 2FYMA 2PFHA 4WGHA 1AH0A 3GW3A 1DBTA 4JNZA 4WDTA 1YDVA 5LXXA 1KM2A 3U7BA 4GQQA 2IPGA 4KFPA 1UD6A 1ISYA 5FF0A 2Y2WA 3KVMA 3BVJA 4YTSA 4O10A 1BKHA 1XYCA 1IXNA 4QM1A 4IMGA 3ES7A 2PGFA 2DJLA 3RPTA 1O5RA 4L4OA 3SGZA 1VBGA 3TC6A 3KVKA 4JPGA 2C13A 2NX9A 4Z0JA 3CLMA 1W1ZA 4LAKA 3ABOA 2DSKA 5DMMA 1NSJA 2WM0A 4NKCA 1OF6A 3H7RA 3W2MA 1E4MM 3OVRA 4YYFA 3AXMA 1CCWB 3SRHA 1ZQ5A 1RJQA 4CVWA 2HJPA 1YX1A 2WQPA 1WKYA 2WZIA 4HA4A 4C6MA 2PDYA 3LX9A 3IJDA 1U2YA 1ZY9A 3KTXA 1SZEA 4DN1A 4D6IA 3EYPA 4OZOA 5CKSA 5CSRA 2P8CA 2X1UA 2OT1A 4HOZA 4Q22A 3PTDA 3D6NA 3S0CA 1A47A 3CUIA 3WLIA 2YL5A 4L9XA 1PCWA 2REQA 4E8DA 1YE4A 5I3IA 1IZCA 3CH9A 5LIKX 1RK6A 3I6TA 3PFMA 4FEZA 1U5HA 2PD9A 5H6HA 3PF3A 1N82A 1AQFA 3WD3A 5F2MA 3OODA 1TV3A 2EGZA 1UWQA 1LRTA 2JFEX 3EDJA 4KIRA 5CZTA 3AS3A 4RLIA 3I65A 5IHRA 5LYRA 2WB5A 3PFRA 1I2PA 2FPTA 1GOOA 1C8XA 3LTPA 1JDCA 3PJWA 2XIJA 4OT7A 3W7EA 4TMCA 1I9CB 3ONCA 1P43A 1GVFA 1PIIA 1NARA 5H8MA 1GHRA 3EX4A 1ZUAX 5C7VA 5FA5A 2IKJA 3AYRA 4ECLA 5G1TA 4KERA 1K70A 4BQ3A 5IBXA 2IKIA 4LY8A 2P1FA 2CLMA 1SM9A 5CC7A 2VUYA 3W1TA 3TTOA 1TJPA 3REQB 4BEUA 1AW2A 3JW7A 3QMRA 1BYBA 3VINA 1SUXA 4HPHA 3MBDA 3CL7A 3QMSA 3E0VA 3A21A 2VR4A 1LQAA 2YW3A 3BSGA 1SMDA 4ZOCA 3B8TA 3RRAA 2MNRA 4M6PA 3UPWA 4GO9A 5HNTA 5DQPA 4C60A 2CWNA 1RALA 3GNNA 4S3AA 3K1DA 4IP5A 1FWRA 4L65A 5E0CA 1OINA 1Q7ZA 2VGGA 4XVDA 1NOUA 4A3HA 2DY3A 2JEQA 4POCA 4NNCA 1H3GA 4Y96A 4I90A 1W32A 3ZSSA 2Q6ZA 5FF3A 1W9PA 3FN9A 2QYGA 1JPHA 1N7KA 3RLUA 3UU0A 4Q33A 3SCWA 3B9DA 5E93A 3QPZA 2DV0A 4QJ3B 4NJHA 2ZX9A 1EHNA 2V5BA 2E5BA 3WQCA 2ZRVA 1B3OA 4MZ1A 1TCMA 3PAOA 1OCNA 1A5MC 3S1VA 2XSAA 1LP6A 1R7AA 1JUEA 3FSTA 1DIOA 2WNNA 3IACA 4IPNB 4UFLA 2YL6A 4GXMA 1I2QA 4FIQA 3PZVA 4CCZA 4QISA 4AWUA 4JL2A 5C55A 2DT1A 3WDJA 3QFEA 1E5JA 2HVOA 1XHGA 3CAKA 4IF2A 2UY5A 2DDXA 4MY8A 5A6BD 1JEZA 2VQTA 3SDOA 2DJXA 3EOSA 3NOYA 2XFYA 3GC5A 3RIKA 3KX6A 2O4QA 4H9VA 3R94A 1JYNA 2FVMA 1YXCA 5CC3A 1O6IA 4IXXA 1Q7QA 2QJGA 3N73A 2IW0A 3VDHA 3N4AA 4LVBA 4AZ7A 3AHXA 1XBVA 5KEZA 3LS9A 3CHDA 1KM6A 5J5DA 2C14A 4A8IA 2JE8A 1E1EA 3WBWA 4K38A 1UD5A 1TTIA 2OLAA 3VOIA 3MWAA 5CPNA 1W17A 1ZFJA 1TTJA 5D38A 2VVSA 1MXDA 5M3WA 4I5UA 4NUWA 1T41A 2Q8ZA 1KGWA 3DEQA 3NQGA 4K36A 1TPWA 1LDCA 3HIJA 3MO4A 3PR2A 5A8NA 3QC3A 3LBOA 1A5AA 3HV9A 1ESWA 1S2TA 1L2QA 1BXNA 2VNCA 3V0TA 2FMNA 2J7HA 2Z28A 5CZJA 2OMAA 4CVUA 1ZP3A 2W91A 1OGSA 3RGTA 4IX0A 2A3AA 3W75A 3GVQA 1XIEA 3WBEA 3P84A 1XDJA 4UQ9A 4OV9A 3T0CA 5T8GA 1DE5A 2WJFA 3F4CA 1XBXA 4J3SA 1JIBA 3QXBA 3K4WA 2P0OA 3LCFA 3W1XA 2GSHA 3LPGA 1U33A 2WHLA 2YDAA 4GHRA 3WNPA 3B9EA 2JF7A 1KXHA 1J6OA 2Z7GA 4CNNA 1AA1B 2INZA 3GHTA 4JIHA 4LYRA 3UCDA 4QJ5B 3VO0A 3PB2A 2PI6A 4JTAA 3R8GA 3PHAA 4E2BA 2OSYA 4N6EA 5C6MA 3N9SA 4E0CA 2B7OA 4UBPC 4GRSA 4MZYA 2R1KA 2QPXA 3ARWA 4K6AA 4UTUA 2DZWA 2Z1KA 3RU6A 3F7JA 4QBXA 4GIYA 1XRTA 3L0KA 1OC6A 1A5LC 3AXKA 5LA2A 2PDPA 3GWQA 2CIPA 4QXIA 5CG0A 3BQ5A 2CBIA 3WEMA 3U8GA 4U2YA 1OYCA 4Z1CA 1H7WA 4PRTA 5CSYA 2WCAA 4G1NA 4AW7A 3BG5A 2EBNA 3N25A 1YRRA 2ACQA 3ZVHA 3MBFA 4OIFA 3ZS4A 1EA9C 2EO7A 4AZCB 3P8JA 1AZ1A 4UMAA 4Q8NA 4G7EB 3WQWA 1C93A 3C2OA 3E12A 3OTRA 1KD0A 5LHFA 5D33A 3MUXA 4WR3A 1VEMA 1FKXA 2CXGA 3TIMA 4GNKB 1OY0A 2ZX8A 4NZCA 3B4YA 1E43A 2CZVA 4JTLA 1KQZA 3S5NA 4I6KA 4ZSUA 3TNBA 4QFUA 1OF8A 5A94A 2Y4SA 4XAGA 4PZVA 4E6MA 1C90A 4IIFA 2ZXAA 4CD4A 2D0HA 2RDUA 3JRKA 3W29A 1OK4A 1IIHA 1OFPA 4UZSA 4QTGA 4ADTA 1BTMA 5FL0A 3R1ZA 2PDKA 5BROA 3L2LA 3CS2A 4O12A 2OCZA 5REQB 2XZ7A 1PX4A 3BWWA 3TN3A 4DO4A 4C6LA 3BARA 1UW9A 1QI2A 4IQJA 4E4PA 4HU4A 3GC2A 3OGSA 1ZJIA 4GCXA 1UYQA 3T7VA 1U1HA 3RR1A 1QASA 1OADA 4NZ3A 2VFGA 4RV3A 1JXKA 1QHOA 4UFIA 2BXVA 1XYBA 1QOXA 5DO8A 2QCDA 4ALDA 3U2EA 4NAFA 4MJZA 3V1PA 2VELA 1KXVA 1ZS2A 5TF0A 4FNSA 3S5ZA 3WLNA 1ZBKA 1W3NA 1XRFA 4G6CA 4I7VA 1H7OA 4AZIA 2OO6A 1Z42A 2ISDA 4HTBA 1QATA 3EWDA 1XRVA 3BZGA 4HGXA 1DTNA 3P3BA 3FEMA 1JNDA 1SO4A 2E28A 3B05A 4IMDA 2PZNA 2OZ8A 3F4VA 2CZDA 4YXGA 3UA3A 1R3TA 1YW1A 1JDFA 5CPTA 3BLEA 1XLJA 5E1QA 3HB9A 4RXFA 1OT2A 2GJXA 1KM3A 1TSIA 2WC3A 4ZENA 1UC4A 3W7LA 3LHTA 4XSMA 1K8CA 5CSSA 2XIQA 1R47A 4NI3A 3UFYA 2VOMA 4M3PA 1TR9A 3FW6A 4AIUA 1XYMA 4GZ7A 1FH7A 2WJZA 3GU9A 5A5WA 2PWEA 3GB6A 2OZTA 1P6BA 2CESA 4HZ7A 4IG2A 2QCMA 4PUNA 1QPRA 2A6LA 3B8VA 1K1DA 3QSTA 1F6PA 3IS4A 3PTQA 3G1RA 4Y7EA 2PAJA 4D72A 3MT1A 3VGGA 3CV7A 3BTNA 3AISA 4LEQA 2YCJA 3T44A 4PTNA 4F9JA 1LLZA 2ZUVA 4L61A 3VABA 4RUBA 4D6HA 2X30A 3U2CA 5ECVA 2IPFA 4R9XA 4K8GA 7REQA 3OLDA 1L6YA 4DWSC 3TYEA 1GYMA 3QHOA 1FP8A 1UH3A 2VCCA 5BRBA 3MHFA 5DEZA 1K9DA 3VM7A 1BWLA 4IMAA 4Z17A 2ZIDA 4JD4A 5GNYA 3EX6A 1J0YA 5IBXC 1CB7B 1A50A 1J11A 1PX3A 4YYCA 3GTNA 2EPKX 3H2FA 2YSWA 3CBWA 3WH7A 3LI1A 5AVNA 2Z27A 5AHMA 3M9YA 1NQKA 3Q65A 4GQRA 4MJ4A 1XLFA 1PYMA 1FWIC 4GVIA 3ZFHA 1PV8A 4AZGA 3AIVA 1JPMA 5GQBA 4TUFA 1GVYA 1XLLA 3HMCA 2X41A 3NQFA 5CLTA 5EMKA 5AYIA 1OT1A 2NQ5A 2J7DA 4QAWA 1IEXA 3R13A 3GVGA 4HP5A 4PRRA 2PWGA 4UTWA 4I8DA 1XGDA 4IUGA 4HT3A 1K02A 1C29A 3T8LA 4ERAA 4HK7A 2PWFA 3R89A 3VOCA 2OQYA 2VDHA 1W3IA 3BW4A 4U31A 4PTWA 3VE7A 5A6KA 3LEPA 4CN4A 2TPSA 3FY1A 2FFCA 4MMWA 3TV8A 2O92A 3A4XA 3UNTA 1OX4B 1VEOA 3TEVA 1H51A 1S5NA 4UC5A 5AC8A 1IEQA 4MPQA 4L56A 2PDWA 4CD6A 1IGWA 4L6HA 2FTYA 3W76A 3O15A 2WMKA 1BD0A 1WDSA 5IXEA 2GSJA 1ZTVA 1UR4A 1ISXA 3DN5A 3QM3A 2CW6A 1J9YA 3CM4A 3SW6A 1G6CA 1J93A 3BOLA 1EJWC 1YBQB 3VGBA 1ZCCA 4NQ1A 2AOSA 1ZRQA 1MEHA 4ROQA 3SCUA 1OK6A 4ACZA 1YIXA 2ZBTA 2C19A 4RXGA 2PWHA 1XFCA 3IIOA 3N4FA 3MZNA 2DZSA 1CZ1A 3SQSA 1ZCOA 1JYVA 1F3TA 1MMFA 3A3HA 3NM3A 1F05A 1MQPA 1ODZA 4AX6A 1VR6A 4ONVA 2WK2A 4GYJA 1ADSA 2NQZA 2WMIB 4X2PA 1SSDA 2XIIA 3MSGA 4KRTA 2AAMA 1H4PA 3SECA 1EFZA 1H61A 4ICCX 4DAFA 4G2DA 4O50A 2PTDA 3VDGA 4QX4A 5CLWA 3W0KA 2OJPA 3OVQA 1RY8A 1ITXA 3EGJA 1BSLA 1ADDA 5C54A 2OX1A 1RBLA 4IMCA 1DEDA 4O4WA 1T99A 1PL9A 4XD3A 1EA0A 4IGSA 2VFFA 3CUXA 4P8WA 7XIMA 1A3XA 1FWGC 2PTXA 1XLCA 2I9EA 7PTDA 2PF0A 1H1ZA 5FAGA 2CZEA 5CH9A 4CCCA 3KS5A 4PMNA 4MUPA 4M1BA 4AEOA 1EDQA 2ZZ4A 2P88A 4CEUC 4DLFA 1DORA 1S2WA 2Z7KA 2G37A 4JCMA 3IIXA 3NSNA 3URQA 1QNRA 3E0LA 4ZR8A 3LGGA 3NM1A 4BKNA 2J78A 3L12A 1GOKA 1RVKA 1FWBC 4CN6A 2VZVA 1O5XA 4PULA 3GVVA 1W0MA 3KLKA 2HDJA 2E1WA 1N8IA 3CWNA 4CN1A 1H2JA 4YTTA 1R85A 2HS8A 5ABTA 1ZP4A 2NLIA 3DFSA 3LDVA 3UXIA 4EX4A 1FQ0A 1GYLA 3RM8A 1UWIA 5HQLA 3B03A 4LRTA 2D23A 3LPFA 4DBEA 2YW4A 2HVNA 2I5IA 4FMVA 2A1YA 5CQ1A 2OKOA 1TPUA 3VIIA 3FX4A 1FOBA 2ZDRA 2HRWA 3OBAA 4KIEA 4U33A 4EWJA 3UJFA 4L1WA 4LUSB 4KWSA 1X38A 3L5MA 2INEA 2O55A 3WLQA 4PRWA 3EDKA 3H4WA 1FCVA 4LBUA 3CZKA 3POHA 4GUHA 1ZENA 5JH1A 2VQUA 4GYPC 2X42A 3LOTA 4W7VA 1PTAA 2WLYA 1EJXC 2ZRZA 5JU6A 1O1HA 1CENA 4ZL1A 4BI6A 2ZX5A 2VL4A 3S2MA 3QV6A 5G2HA 4O13A 1ALDA 3VKKA 1YPFA 2ZZ5A 4GNJA 1K9EA 2HK0A 1K8ZA 1Z6KA 2ALDA 2F38A 2Y7GA 4A8NA 4PTVA 3C2FA 3QKEA 3UJ2A 2PU1A 3AYSA 3EB4A 2DP3A 4L1GA 3VOGA 4L4MA 1TX0A 4GJ1A 4C91A 3Q58A 2WSKA 3O6DA 1V6WA 3EKZA 1HT6A 3TN6A 3VNKA 3WQEA 6ENLA 2ZICA 3MP3A 1EL3A 3NSMA 1OFRA 4IIEA 4NU7A 4PUKA 4Q7BA 4BY3A 1JGMA 5HK4A 3C3UA 3SBFA 4YTRA 3GTHA 4O4VA 1VENA 1LBFA 2JKPA 2ALRA 4F0HA 2UY3A 1VRDA 1J96A 3M47A 4AWTA 3AMDA 3B9OA 5A8MA 1PEZA 1LOQA 3K13A 2PDNA 1KM0A 2PD5A 2HS6A 3W4RA 4UTMA 3PUOA 3SGUA 1TYGA 3K30A 2QHAA 4PUEA 5HDRA 2WMHA 3U2ZA 3EDEA 4LUTA 4N4PA 3BPWA 1KW1A 4WY0A 1YMYA 1PZ2A 1FWWA 5I3HA 1TRIA 4H19A 1MUCA 3SIZA 1VHCA 4JNMA 5BNKA 1XH2A 4PYSA 3P80A 2QUUA 5DMLA 2Y8VA 3LLFA 3VUPA 4CCDA 2Z4GA 1F7BA 3WLLA 1A5SA 4XK2A 1Z89A 1OX4A 3ZZ1A 1WB0A 5AC7A 3GBEA 3W01A 6XIAA 3ITCA 1SO3A 2J7FA 1WZAA 4JYFA 1H0IA 3SN0A 5K2ZA 2J75A 1AD4A 2YPIA 4HPJA 3NEVA 4M82A 3C0LA 3S5YA 1FH9A 4XKYA 1J2WA 4M24A 4PBFA 2HEJA 3EEGA 1Q6GA 2A4AA 1FY6A 4BI7A 3O63A 4HYRA 1XLBA 3AWOA 4TOQA 4W7UA 2BVWA 3BQ6A 1W3LA 3PG8A 5LSMA 1UP0A 3M0IA 5AECA 3UYCA 3PPCA 3P6LA 3APTA 5I03A 3CNYA 2PP0A 4GOAA 1RCQA 4MOZA 1VFOA 4H01A 3CLWA 1KWKA 3O1NA 2E77A 2VENA 3W1RA 4U5IA 3ABRA 5BU9A 3DGBA 3L4XA 2D22A 4QNWA 3PVFA 1V79A 3O9NA 1OSEA 3OOQA 4LQ1A 2XM1A 4KFOA 4FLOA 4RDWA 1VAHA 4LAOA 4LWWA 3G1FA 4LY4A 2A2IA 3MKCA 3TC3A 4ZO6A 5K4XA 2PWVA 2E9LA 4GY1A 5HWMA 2W0UA 4QR6A 8A3HA 4H6QA 4C1LA 3LLXA 1ZSXA 3OZMA 1TZ7A 3LK6A 2J25A 4JTRA 3A23A 3P60A 1DHKA 4GG9A 2OQLA 3WJSA 3LCWA 3SCVA 3W87A 1GQLA 7TIMA 4O0QA 1UZDA 1UOKA 4HZ8A 1VIZA 4ZB5A 1NWUA 3A6OA 3OA3A 3EKLA 4QQ3A 3GDTA 3UJEA 2BB0A 1R2RA 2ZXDA 3EOEA 2R1MA 4CLMA 3TYCA 1E9ZB 2VWTA 1PHQA 2E6YA 4JEJA 2QDGA 2ZDSA 5F4WA 1AODA 2C6QA 5U4NA 2Q01A 2Y5EA 1J10A 2BS9A 3M7WA 1WX0A 2ZOXA 4JIPA 4K1GA 4XD6A 4YS1A 1Q7MA 2XVGA 3W07A 3OIHA 3WQPA 2QJIA 1ELSA 5G2WA 1E1FA 3HQ1A 4DJEA 3WLRA 3K4DA 1Q65A 1A53A 2X16A 4US6A 1JD9A 1TUFA 3WD0A 2VXNA 4MJ2A 4AWSA 1U22A 1NELA 2FVLA 2ZWYA 5DLCA 3AZRA 4OV4A 5D9OA 4IPIA 2DZVA 1EQCA 3EWBX 4FXJA 5C9XA 3V75A 3F2BA 3TK7A 2PODA 4QG8A 4RDVA 3FFSA 3H55A 1S5MA 3DFHA 4DF0A 2HXTA 3MPGA 5E70A 1F4HA 3TZNA 3EMQA 4L1XA 3SSJA 2I57A 2QUVA 4XZMX 2QV5A 1OZQA 1FDJA 1QUMA 1R3VA 3PPHA 3B0VC 2VZTA 1ODUA 3DZ1A 5BXTA 4IM4A 1EC8A 2XDFA 3D46A 2BHUA 3M0KA 4V28A 3MCOA 1KWGA 3NQCA 1LG2A 4OE7A 1BKSA 1G01A 3KBJA 1LRQA 3A12A 3TUUA 1CYGA 4JEQA 4XIMA 1G94A 4N9EA 3WLTA 2BP1A 4Q4OA 3D5HA 4M7SA 3T81A 9CGTA 3S5SA 1HUVA 1XD0A 3KL5A 4HYWA 2Y8KA 1TREA 4AZHA 1DV7A 1OQFA 5G1YA 1W9DM 1QO5A 1JUBA 3KL3A 2PDLA 3H70A 2ASHA 2W3ZA 4N02A 1JZ6A 3IJ8A 1QFEA 1FP9A 1P48A 2C1HA 3CHCA 4GVHA 1O60A 4XZNX 4J2PA 3R2GA 4O17A 4B91A 2ISSA 3T4CA 4LF1A 3H2CA 1E0TA 2J8FA 2QAPA 2XSBA 3W86A 1JDEA 4OKDA 2QGHA 3RITA 3MO7A 4B3ZA 5JUVA 2Z0IA 4TX9A 5A6TC 2CKRA 3BV7A 2G0WA 1QTWA 1B2YA 3QR0A 2BHZA 3E5BA 5MKGA 4BWLA 4BI5A 3UG5A 1UC5A 2FB3A 4RE3A 2BDQA 2VGFA 1RJPA 4GLEA 1GVS