2A3JA

Structure of urndesign, a complete computational redesign of human u1a protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
96
structure length
96
Chain Sequence
TPPHTEPSQVVLITNINPEVPKEKLQALLYALASSQGDILDIVVDLSDDNSGKAYIVFATQESAQAFVEAFQGYPFQGNPLVITFSETPQSQVAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title High-Resolution Structural Validation of the Computational Redesign of Human U1A Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2005-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2a3jA00
4YB1P 5DDOC 5LSOA 1F9FA 2KG1A 2ADBA 4UY8T 2KRBA 1K73T 1AUDA 1WF2A 1VC0A 3VAMA 5GADU 2KXNB 3SXLA 2DITA 4YUDA 1H2VZ 1N8RT 5H1SV 4J5OA 2MXYA 3VAGA 3L3CA 2ZJRQ 2MKSA 1U1QA 1JJHA 3NS5A 1M5PC 2M9KA 3BS9A 1M90T 1BY9A 2DIUA 3CC7S 2OJ3A 2DNQA 5FJ4A 2U1AA 1D9AA 2A3JA 2M0GB 4WCEQ 4QPTA 1OWXA 2VOOA 1IQTA 1VQPS 3CCLS 1L3KA 3ZZYA 5GAGU 2OTLS 2RNEA 1UAWA 3LPYA 2M52A 2RRBA 1ZH5A 3THTA 3MUTP 1N88A 2D9PA 2RT3A 5LJ5Y 2ZJQQ 1VQKS 2MSSA 2DISA 1JJ2R 2YWKA 1B7FA 1YI2S 1U1RA 1VQ9S 2M8DB 3UD3P 1HD1A 1R8PA 1FJEB 4A8XA 5LXYA 2WBRA 1VQOS 1KOOA 2RS2A 1X4EA 3VAIA 3Q2SC 2XS7A 2EK1A 2MQMA 1G2EA 3MI7X 3CCSS 2MQPA 2MKKA 2QA4S 2MQQA 2D9OA 3CXCR 1DHMA 2DGTA 1H6KX 1KD1T 2JVOA 3NMRA 1HD0A 4F26A 5DM6Q 2DHXA 3RW7A 3K0JA 4ED5A 3I55S 2CQHA 2LA4A 3MURP 1WF0A 2MB0B 1U2FA 2F3JA 2J8AA 2PEHA 1Q81T 3CCJS 2LYVA 1A9NB 2KHCA 3BO2A 2K3KA 1KQSR 4V19X 2DHGA 2KFYA 2LMIA 3IWNC 5GAHU 4WFBQ 1U1MA 3G8SA 1OPIA 5GMKa 1U1NA 1DBDA 1YWXA 1S72S 1K9MT 4IOCQ 2MJUA 2F9JA 5HL7Q 2AD9A 2VOPA 3G8TA 1WHYA 2MMYA 2M8HA 5ITHA 2X1FA 1WG1A 4P6QA 5DM7Q 3G71S 2EVZA 3EGNA 4F02A 2DH8A 5MLCV 1W2BR 2ERRA 3S7RA 3HI9A 3MUVP 2XSFA 1WEZA 2CPFA 3UCUP 1X4HA 3NNCA 3CD6S 1JJ4A 5DDQC 1WHXA 2KU7A 3VALA 3CCMS 2KXFA 4OZ0A 2B0GA 2KVIA 4QQBA 1M5KC 2HGNA 1X5OA 2E5HA 1K8AT 2LXIA 3CMAS 3CULA 3G4SS 2CPHA 5CYJA 2DGSA 1P1TA 1WG4A 2KN4A 3MD1A 3R27A 1FO1A 2LCWA 2RRAA 3P6YC 2V94A 1UFWA 3NNHA 1HA1A 1VQ8S 2O3DA 5IM0B 2KG0A 2X1GA 3UCZP 2OTJS 1X4CA 2XS5A 4CIOA 2MZ1A 3CCES 1FXLA 1M5OC 4CH0S 1YTYA 2LEAA 2CPYA 3B4DA 4U67Q 3J7YU 2AYBA 3FEXB 1A7GE 2DHSA 2YH1A 2MZSA 2KRRA 2XNQA 4UQTA 3N9UC 2XB2D 1NO8A 2FHOB 1VC5A 4PR6A 3R1LA 2MZRA 3BO4A 3CCVS 2MY7A 3S6EA 1X4DA 2N7CA 1SJRA 2MZTA 5DETA 4LIRA 1SJ4P 2G4BA 2DNOA 1X4FA 2AYEA 2E5GA 2MKIA 3RW6A 2DO0A 3MXHP 4Y00A 2DNZA 4OZ1A 1YJWS 1VC6A 1SJ3P 1H2UX 1S79A 2LKZA 2AYMA 1VBXA 2RS8A 1NU4A 2CPZA 1U6BA 3U1MA 2DGUA 2HGLA 2I2YA 3OW2R 2CJKA 2L08A 2M88A 3S01A 2DGOA 1P27B 2FC8A 2CQPA 1YJ9S 1WEXA 2JRSA 3TYTA 2CQIA 2DGVA 2CQ0A 2CQCA 3EX7B 3MDFA 2Q79A 3CCRS 2CPIA 5CXTA 3P49B 1CVJA 3CC4S 5GVQA 2CQGA 5LXRA 4C4WA 1YIJS 1VQNS 1WHVA 2CQ2A 3G9CA 1X5TA 2QEXS 2J0SD 1FNXH 1VQ7S 4WFAQ 2FY1A 3TO8A 1OO0B 2DGXA 2MYFA 3V4MA 1FJ7A 2DNYA 2G1DA 5JVGQ 2M4MA 2ADCA 2KYXA 3ULHA 2VODA 4FXWA 1X5SA 2DNHA 1YITS 1WEYA 2L41A 2UP1A 1X4BA 2RQ4A 3CUNA 1D8ZA 2MQLA 3R1HA 2RU3A 2CPDA 1DRZA 1URNA 1U1LA 2MJNA 1FT8A 1ZZFA 5IM0A 3IRWP 2M2BA 2MPUA 2BZ2A 3FEYB 3CCQS 1Q86T 4F25A 2CPEA 2RUGA 2N3OA 2D3OR 1WI8A 3VF0B 5CA5A 1UP1A 1WF1A 1RK8A 1KOHA 4WF9Q 1SXLA 3SDEB 5IFMA 3P3DA 3B4MA 2OSQA 2DNPA 1WWHA 4M5DB 4WKRA 2XS2A 2RQCA 2DNKA 4TU7A 2HVZA 2MSTA 3G6ES 4ZKAA 3D2WA 2GHPA 2L9WA 2MKCA 4Y0FA 3UCGA 3PIOQ 4CQ1A 2I38A 4PKDB 2QFJA 2KXHA 2MKHA 1VQLS 3MD3A 2DO4A 3MUMP 2DK2A 2CQ1A 2K8GA 5BJRA 4Z2XA 4PRFA 1X4AA 2E44A 2DGWA 2DNMA 2KT5A 4FXVA 1U1KA 4LMZA 3EGZA 2LA6A 2MKJA 2EK6A 2JX2A 2NZ4A 1SJQA 1WHWA 2DB1A 1QVFR 2DIVA 2LECA 1H2TZ 2PE8A 2MGZA 2HGMA 2N3LA 2LQ5A 5D77A 5LJ3Y 4BS2A 2J0QD 3CCUS 3UWTA 2MZQA 2CQDA 4RU2A 5EN1A 2NLWA 2DH9A 3US5A 1Q82T 1SJFA 1VQ6S 2F9DA 4LJMA 2GO9A 2AYGA 4IUFA 2YTCA 2DH7A 3BO3A 2DNNA 4IOAQ 2HZCA 3H2UB 1U6FA 2OSRA 2KH9A 2ZJPQ 1ZZNA 5HO4A 2RVJA 3CPWR 3VAHA 2OIHA 1N54B 2J76E 2DNRA 2MHNA 2BOPA 3TP2A 1VBYA 1R8HA 3G96A 1M1KT 4TLQA 1N52B 1QM9A 2VONA 1RKJA 4C7QA 1X0FA 2M7SA 2YH0A 3CF5Q 4TU8A 2MGZB 1YHQS 4YOEA 2LXUA 4QU7A 2KI2A 2CQ4A 1FJCA 3JB9k 3PIPQ 3LQVA 1VBZA 3DXBA 2CQBA 1M5VC 4EGLA 2CPJA 3Q2TC 3SMZA 1U1OA 2E5IA 1DZ5A 1JMTA 5DDPC 3VAJA 3VAFA 1Q7YT 2DNGA 3H2VE 3SDEA 1VQMS 3CC2S 5GAEU 3I56S 1QVGR 2G0CA 3P5TL 5D78A 2CQ3A 1WELA 2FPHX 1U1PA 4WIIA 5IQQA 3MOJB 1YJNS 1OIAA 1WI6A 3NS6A 1VQ5S 2N82B 4CH1A 4W92B 3S8SA 3CMES 4IO9Q 5LSLA 2LEBA 2FC9A 1NJIT 2KM8C 2SXLA 1HL6A 2YKAA 2MQNA 2XNRA 1XN9A 1X4GA 2DGQA 2U2FA 2MY8A 3BEGB 1PGZA 1O0PA 2MZJA 2M70A 3THPA 3J7ZT 1UW4A 3HHNB 2X1AA 3UD4P 4QU6A 3NNAA 2E5JA 1FHTA 1WG5A 3DLLQ 3VAKA 1PO6A 2JWNA 2MQOA 2X1BA 3UE2A 4TU9A 2DNLA 1VQ4S 1KC8T 2HYIB 5JVHQ 3CTRA 3ZZZA 4W90B 3U1LA 5DDRC 2DHAA 1WTBA 1X5PA 4ERDA 4WFNQ 2KM8B 2CPXA 4C0OC 2JVRA
chains in the Genus database with same CATH superfamily
4RNNA 2KRBA 2V8PA 1L3VA 4UOCA 5KFUA 3TVYA 4IRCA 3RGIA 3MM6B 3HF5A 4IR1A 1H2VZ 4P72A 4DU7A 3GIJA 3CO9A 3G6YA 4PUOB 2QC3A 4ZPBA 4XAKA 3EVOA 1OYEA 2ALYB 1JLEA 2ROEA 1T0TV 2ZZTA 1IJEB 2HHSA 3D66A 3D0GE 3ZTPA 3M7VA 2FHJD 1T9YA 2EW9A 4NMXA 2FJXA 2PFDA 1Y3JA 4K4VA 3AA9A 1RAAB 2D9OA 5KG4A 1SH2A 4CLKA 5RUBA 3Q8PB 2QMWA 1LK7A 4HKQA 1YRXA 1GX5A 2PC6A 2IYGA 3MURP 1WF0A 3CDWA 2DPIA 2PGCA 3DRSA 2KFYA 2LMIA 2XYHB 4UT4A 3KK2B 3V6DA 1T95A 2AJFE 3KNGA 2HMIA 1S72S 1VR6A 2YNHA 5EGYA 3PTWA 1DQ8A 2FVRA 4DR6J 5J2NB 3SV3A 2HHUA 3MM8B 2CWKA 2XZWA 4K5SA 1X4HA 3VCDA 2FIUA 2QN6B 4DZ6A 4HVZA 4XPCA 1PILA 5A6WA 5JMNA 4ZPAA 1REGX 3AXKA 4A8QA 2OKQA 3UCZP 3KLVA 2GX8A 4ZN1A 2IBOA 3DDKA 1RTJB 1UVKA 2AYBA 3KK3B 2ZH9A 2XNQA 2F5GA 1VC5A 3BO4A 5FDLB 4RW8B 4QR1A 3MR5A 3CJ3A 2E5GA 3HVAA 5GMEA 4XDDA 2YKOA 5IT0A 1T9XA 4AQYJ 1D9DA 1HHSA 2GVZA 1S7IA 2XY7A 3TZYA 4LFBF 3OW2R 3LUYA 2FB0A 1LW0A 4DQSA 4PPDA 1RTIA 9ATCB 2F40A 4DV7F 1RWXB 1KTVA 5KT7A 4Z7CA 3AD9C 4LF4J 3RR8A 2CQ2A 3F0NA 1R0AB 1XEZA 4ZOSA 3TO8A 1E6VA 3SFUA 2V9KA 2UXBF 1HBUB 3IWXA 4WPAA 1IBMF 3FGVA 3ZTRA 2UP1A 2R7XA 1E6YB 3L7OA 5DS7A 2FJDB 3HDSA 2HRYA 1Q79A 4HTIA 2KZZA 3W5YA 1JLAB 3RRGA 2YWHA 1PC4A 3QIPB 2V4QA 2HVZA 2J6UA 2B7CB 2Z57B 2RB7A 2VD3A 1EQ0A 3ZNUA 1W2IA 4ED6A 5DQHA 4XO0A 3DLKB 2Z2LA 5KFQA 1TKXB 3M8QA 2W9BB 1PYTA 2QSFA 3UVJA 4JI7J 3F44A 3SFGA 4M94A 1VK3A 2KT2A 3FCWA 2K2PA 4G1QA 2C3UA 3M6VA 2D7SA 4MYTA 2BDPA 3UPFA 4ZPTR 2NLWA 5H9EK 5J2PA 4LRFA 3KHRA 1GNKA 4IUFA 3HVWA 1M0SA 1TL1B 3GE9A 4ER8A 2BVZA 4DV1F 1U6FA 3R7BB 4DQRA 4EO6A 2RVJA 4LSZB 1Q78A 5D6GA 2HHPA 2W01A 2ZBPA 3V81A 1RAJA 4NYPA 3K5MA 3TQEA 3MEKA 4R8UA 4AL7A 3BSAA 2LXUA 4QU7A 1NDCA 3MM9B 1VBZA 2K3IA 2CQBA 3ET6B 4KGMA 4BBYA 3Q2TC 1U1OA 2GCFA 3KFWX 2BKNA 2UVVA 2PA3A 3A12A 4ILMA 3ZNJ1 3BV8A 3KLHA 1NUEA 3NCRA 3VQSA 2C22A 2O66A 1RA6A 4USUA 3EGVA 4J7CA 3TI0A 2R9LA 3VGVA 1U8WA 1XN9A 3OJUA 3D68A 4OYZA 2MY8A 3THPA 4ECZA 2XHWA 5E2QA 1WACA 1FHTA 5KFPA 3PW7A 4YY3J 2BR0A 4DG1A 1DY3A 4N8OA 4OFZA 4KY3A 2NQPA 1HWIA 1TMMA 2YQ1A 1JJCB 3BYRA 3HHEA 5KFVA 1DURA 3RAQA 3A8KA 3IRXB 3TZXA 3KJFB 3OPKA 5KG0A 2B3TB 2AIRB 5DRKA 1OSDA 4DV4F 4F4WA 2IVMA 1JJHA 3W3SA 3BS9A 1N34F 2OJ3A 1U2CA 4FDFA 3ZTOA 2DNQA 3TARA 1D9AA 2A3JA 2M0GB 2H4YB 3JXOA 3UQSA 5MAOA 1JXLA 4ZPCA 2ZD1A 4X65J 4P2XA 1S9GA 4JI8J 4NL5A 3U27A 2OEJA 3CCSS 2MKKA 1UPPA 4DV3F 5AXMA 1KD1T 4ATNA 1K1QA 3DC2A 4DV6J 4H4KA 5HROA 4F0HA 4M5HA 4H4KC 2AKWB 3U7JA 3FBEA 3D28A 3ICLA 4ZLJA 2ZM6F 5T7LB 1C0TA 5ETNA 2EKYA 3AHPA 4W98A 1NHUA 1UZDA 1TU0B 1Y00A 1WG1A 5D4LA 3WIVA 3G71S 2GA7A 4O4GB 2XGQA 4RW6B 2CZ4A 1Q7LB 4IG3A 2MLXA 2R8HA 1WEZA 3UCUP 5M2PA 2ZHOA 2FZKB 4K4YA 4I69A 1JJ4A 5CD4H 3OR1B 4NLRA 1YGYA 4OZ0A 4DSJA 3HCXA 4CNZA 4GKJF 2E5HA 2XMTA 2HG4A 3CULA 3GV5B 4K8RA 1B4SA 4KHPJ 3TAMA 2GC8A 1BUXA 1FI4A 3KHHA 3P6YC 3NNHA 4B3SJ 2V34A 3D3CJ 1S1VB 1SC6A 3O5TB 1QE1B 1S6PA 4E0DA 1T3NA 2CVIA 4J9MA 3FEXB 5E0OA 4UY85 2HBQB 3GIMA 1S1WA 1OS5A 1GT8A 1U2RA 2HFVA 2E1PA 3AOBA 4LFAF 4TQRA 3QRQA 2AYEA 4ID5B 3JYTB 5HLFB 3BN4A 2GHVC 3HHLA 1LWEB 1RT3A 2XM3A 5KFGA 1U6BA 4NMLA 3HHLC 2LQ8A 5CABA 3MCMA 2Y3YA 4NYOA 1MU2A 2HW3A 2DGOA 3M8RA 4EK2A 4ECTA 2ZH8A 3GJRB 2VZ9A 3BGFA 3MDFA 4RKUC 3W8GA 1RWNB 4IG0B 4CP5A 2LQBA 1X5TA 1H72C 4KV8A 3ZZOA 1FNXH 2I6WA 2H3EB 1J5EF 3CGIA 2J8SA 3OV7A 1NDKA 2ZVIA 4RNHA 4USKA 3RUBL 2RQ4A 4O3QA 3FJ2A 1URNA 2GMLA 5KFEA 2B6AA 2WTFA 2VBWA 3EDQB 1P9YA 1HNZF 5K5MA 2V68A 2UUCJ 2R7RA 1UP1A 1UZHA 2DJWA 2L3MA 4ZJOA 3P3DA 1RWWB 5A8KB 1S59A 3MZIA 2RQCA 3MR3A 2JNJA 2ACYA 4ZVOB 3SIPB 2HVDA 1TKTA 1CQMA 2YNIA 2LEPA 1FKAF 2CQ1A 3OHAA 5BJRA 2E44A 1PIEA 2MKJA 2B51A 1HLWA 3GFYA 1XERA 1P6TA 1FRLA 2LQ5A 3NGKA 1JLGA 3NAIA 3TEGA 2HFOA 1GX6A 2J7KA 3R6GB 4U9RA 3ZO7A 1Y7PA 4DBQA 4R5PA 4F04B 3UDLA 2IRUA 2ZWPA 2R7QA 3C14A 2RILA 3EYZA 2UVRA 3BGRA 4I2QA 1W26A 4OZ2A 4OV1A 2J7UA 5AE2A 3M2VA 5J1EA 5AT1B 2R7VA 2YX4A 4IH6A 4DV5F 5A8WB 2GMJA 2VPZB 4UUWA 4ELUA 3MEEB 3M8ZA 3A3NB 4UW2A 2DD8S 3T5LA 1T03A 4DR7J 2V0NA 3WQPA 4W92B 5BR8F 2B9YA 3AY0A 2V2QA 1N36J 1KKHA 3BPDA 3J7ZT 4RO0A 1WC5A 2VG5B 1C1CA 3NNAA 1WSRA 3W62A 2VG6A 2X1BA 3UE2A 4CYUA 3RBDA 2BJDA 3BQ1A 1G1XA 5DDRC 3VWSA 2W2OP 5IS2A 2ZOGA 2CPXA 1N0VC 5IZHA 3LAKA 5E33A 1F9FA 4DS4A 2FLNA 1NNDA 2Y0BB 5LOQA 2ASLA 3J7Z5 4JI1J 4DV0F 1VRTB 5LL6d 1S49A 2BRLA 4J5OA 2MXYA 3MM7A 5M2UA 4ZHRA 1Y5NB 3PR5B 4FS1A 1KHWA 4X66F 4DLEA 1TV6B 1S1UB 2JFDA 2C3PA 2RT3A 2WW8A 1JJ2R 3T5HA 3GIIA 1EQMA 4DDFA 2XZTB 2ZITA 3G82B 2CYYA 1LWCB 1S9FA 1X4EA 3Q2SC 3E51A 1IKYB 3DGPB 2RDIA 1QUPA 1FFGB 1R8AA 3BSCA 1NPPA 4CRJA 1U26A 3B82A 4RLEA 2BKPA 3CT9A 2FJAB 2F3JA 3HXMA 2KFZA 5A2QU 4PZVA 4RZRA 4KGXB 3BO2A 1KVKA 2LVWA 5CYMB 2OMLA 2ZH1A 3PDNA 2IC3B 4ICLA 3LP2A 3E3XA 5ITHA 4PWDB 5AE1A 4DL7A 3V5RA 1AA1B 5K8MA 1LWXA 5KTQA 4B3RF 4AL6A 2OPPB 4K2XA 1R3NA 2C2DA 2B0GA 1ZPVA 4LF6J 3LPEA 1X5OA 1MROB 2RIJA 3MGJA 2DR5A 2KN4A 2YWFA 2V8GA 1XBWA 2EG2A 2C42A 4O3OA 3I4PA 2AJ0A 4O3RA 4OZLA 4EMDA 4CIOA 2XWYA 1MWZA 2JDJA 4ZPWR 5E3PA 4ZCLA 4JI5F 4H54A 3NG8A 1HMVB 2Z0GA 4B9NA 5EWEA 2EFQA 3IMQJ 2AV5A 2PA8D 3S6EA 5C2CA 5DETA 1K1SA 1S0NA 2UU9F 1IKXB 2DNOA 1JB0C 3RW6A 3MXHP 4TYBA 2DNZA 4RW4A 4JV5F 4H4MB 1S1TB 3D67A 1NKEA 4Y2IA 2I2YA 2GVDA 3POTB 1FRJA 1LW2A 4P2MA 1ZBTA 1VHFA 3JTOA 3CCZA 3TA2A 3IXQA 5KG6A 3CDEA 2CPIA 4FS2A 1D0EA 3S1TA 5GVQA 4OI3A 4K50A 4C4WA 5KFOA 3DI6A 4NXMF 4A8OA 3D6MB 4P7VA 1S76D 3C19A 4NLSA 2IDEA 3X3UA 4LBPA 2VB6A 3HHLD 3AJ1A 4ITSA 2CPDA 2FTRA 3QNWB 4NCBA 4LF8J 1HNIA 4EBEA 3CJ2A 4KH0B 4MH8A 4LRBA 7AT1B 1RK8A 4C97A 2KL8A 2ZHBA 1ZYQA 1I94J 4LREA 3KUHA 2F8EX 4M5DB 3CJSA 3BGOP 4YR0A 4LR7A 2JLFA 3OQ2A 1VIOA 4AXJA 1GMVA 2L9WA 4GVBA 2I38A 5KFYA 5E3AA 3OVSA 2JEIA 2K8GA 4Z2XA 1RSCA 4U8VA 5DJBA 3ILJA 3NP5A 2WVBA 4B3OB 2DB1A 1IJFB 2C2KB 2JEFA 2PE8A 3MPVA 3AT1B 3UN3A 2H1YA 4C8ZA 2FJVA 1F2HA 2OPRA 1UKUA 1S48A 4DCJB 2DNNA 4IOAQ 4NLVA 2OSRA 5D3GB 5HO4A 4F2RA 3J80U 3CPWR 5ETPA 2OIHA 3NMAA 2PO4A 5FIIA 1ICEB 3KLFA 4PYDA 4HACA 3BKFA 5C7PA 3C6UA 2YH0A 3MECA 2RMLA 2P6SA 2CPJA 5BYRA 1ELOA 4EUVA 2QO3A 1VQMS 4PG6A 4IO1A 2OPSA 2RSQA 1TL3A 1RUSA 1C2PA 3NS7B 4DQPA 2FPHX 4L73A 2HAFA 4RW7B 1DTTA 1YJNS 3J81j 3DLEA 2VPWB 3M8SA 2MKYA 4USIA 1UWAA 2FC9A 4GMKA 3SCIE 2SXLA 1HL6A 1X4GA 1TVRA 4LSNA 5KT5A 2M70A 3R5JB 2ZWOA 5C5JA 4ZVUB 1S1XA 1SV5A 4C0BA 2K7JA 4ED2A 4FKYA 2VJVA 1DARA 2HYIB 5F8GA 3JTPA 4W4MA 4WBFA 3DYAB 1MWQA 2ZDPA 4C48A 1SH3A 4CTAA 3IR6B 2B7BB 4F4KA 4UF4A 4DPYA 1FVSA 1S7HA 5H1SV 3V4IB 2ZJRQ 1U1QA 1M5PC 3HT3A 3PYGA 1OWXA 2VG7A 1HFEL 1RBLA 1RT5B 2G1HA 4N5SA 2EXUA 2CXEA 4LR8A 2W1BA 2MSSA 3MR6A 2BJ8A 3EZUA 5KT6A 4ILLA 1O6XA 1HD1A 2H9ZA 1SI9A 3VAIA 2AGPA 3HMJG 5FLXY 1BD6A 2Z2YB 1YKWA 2MQPA 1SPBP 3SSRA 2NPIA 4Y2AA 5H9FK 3M2RA 3NGTA 1TK0A 4DFMA 4DLGA 1N5QA 1PYSB 2QL7B 5SUHA 1C4AA 2Q6BA 2K3KA 2Q66A 4QYZJ 1UWBB 4CO0A 1DBDA 2ZH6A 4IOCQ 3C15B 2F9JA 3F73A 3IG1A 3OT9A 2MMYA 3FQKA 2OP5A 1N33F 2HWHA 3DM2B 1DLOB 2F4VJ 1HI1A 2ZBQA 4HH1A 1R27B 4TKTA 3TOQA 1YJRA 3GG1A 1REVB 5I42B 3SCJE 3D9BA 1FK9B 2DEIA 2UUBF 2XYPB 1NK6A 1VDHA 4K4TA 1YJUA 2LXIA 2R2RA 2WSCC 5E3QA 2OELA 3G4SS 3M2UA 2DGSA 4LUBA 2IVYA 2LCWA 1KP6A 4IFYB 4BDPA 1JLQB 1UMJA 2X1GA 3H42A 2ZFHA 3KLGB 2FQQB 4KYZA 3ENAA 3IGVA 3DRRB 5C24B 1A7GE 2HQGA 3N9UC 3Q23A 2LLZA 3CCVS 1DJ0A 3UO0A 5HATA 1X4FA 3JAMU 4Y00A 3DNCA 1OMSA 1S5ZA 3H5SA 2ZEJA 2LKZA 1RBOB 1VBXA 2CPZA 1Q5VA 1FXDA 2CIMA 2CJKA 4F4YA 2KT3A 3MEDA 3G87A 1N32J 2M88A 2WK4A 2XSJB 2ABYA 4O3SA 4DEZA 2FVQA 1YJ9S 1EHWA 3TYTA 5K14B 1QTNB 4K4UA 4FYVB 2VUGA 2QYGA 3HJFA 2Z58B 1UVJA 1YIJS 2XI2A 1WOOA 4LF7J 4UQGA 2XMMA 3V4MA 1RB0A 2M4MA 2AQ4A 2W9AA 3OLBA 1S57A 3SCLE 5IM0A 2AZ1A 1J27A 4ZCMA 1DTQA 2RUGA 4LSLA 3W64A 2MLZA 1S10A 3UNGC 5B0EA 5CYQB 5ETMA 3B4MA 2POKA 3AA8A 4DUZJ 4C8OA 1H7WA 2E5LJ 1YJVA 3O6QA 3M6WA 4KFBB 4O0NA 4DR2J 4FF2A 1WDTA 3PRVA 4X4NA 2R7TA 2E29A 1CS4B 4HH0A 3D1HA 2ZOMA 2V50A 1WHWA 3MR7A 1QVFR 1JK9B 3WBZA 3CD0A 2JLEA 2ZH2A 3MAQA 1VRUB 2EEYA 3EPGA 4EZ6A 8RUCA 1LNQA 4MMOA 4HR2A 3W2WB 2ZJPQ 1UEKA 2CADA 2H4WB 3HJVA 2R7UA 3KDOA 2MHNA 5HSPA 3GQCA 1OY8A 1RKJA 4TU8A 2UXDF 3Q8YA 2IA6A 4ZP9A 1IKVB 1PYOB 1HBMA 3OTEA 3MTJA 4FNHA 4ENOA 2QSWA 2AW0A 2G0CA 1TKDA 2KHDA 3I0RA 2CQ3A 2AJQA 3SZ2A 3MEGA 4DQIA 1HQUB 5IQQA 2VFUA 3OSPA 3MOJB 3NS6A 3FFIB 5L9XA 1CJKB 2GIFA 3PX6A 4HT7A 2KM8C 4QIEA 3T1AA 3TA0A 2MQNA 2XYGB 3FSYA 4BWMA 3JTNA 2O67A 2CJ9A 2G13A 2QA1A 3L7PA 1NJWA 4ZN3A 2DNLA 5ETRA 3T9NA 3MMAB 4IH7A 5ETQA 5JJBA 2E1CA 5L46A 2KXNB 1IWGA 1RTZA 2ACMA 3HFVA 2O01C 4X4UA 3CEDA 3L3CA 1QY7A 3MTKA 1YVFA 4YHHF 1JQGA 3EVWA 3BQ2A 4Y2KA 2VOOA 3G6VA 3CCLS 9RUBA 5KFNA 4B3TF 4Q8EA 3R8YA 2RNEA 4QCLA 2RRBA 3MMBB 5LJ5Y 3TW0A 3TUJC 3I9V9 1UJ5A 3T1HJ 1ZM2A 3HM9A 1R8PA 1VIXA 2HWTA 4G3IA 3K5NA 1KOOA 1P1LA 3C6TA 3ZZPA 2PT0A 4DU8A 2YXLA 1H6KX 2MLYA 4LFBJ 3IAM9 2D3ZA 4DR5F 3UDCA 4CO4A 4RU9A 5L9NA 3FDSA 2AT1B 2IBKA 2J8AA 3FNNA 3RRHA 4PAAA 2FD2A 2LYVA 1A9NB 5BYSA 2V63A 3N6LA 3CVKA 4MKAA 1U1MA 2VIHA 3HHDA 2AD9A 1NB2A 4FF4A 5HBMA 4P6QA 1TL7A 3TJ8A 2EVZA 1EB0A 3PEJA 3ITHA 4F02A 5HMYA 4JB8B 5KFWA 3SQOP 3Q8RB 4B9VA 1S0OA 2DRBA 1B70B 5F8LA 3TZWA 2L9DA 3ETOA 2BJEA 3OFFA 2CPFA 4USHA 4B17A 4ED3A 1LWFA 3AFGA 1O8BA 4WZMA 4B3MF 4P75A 2UV8G 2KXFA 3BR8A 5KFRA 1K8AT 4LVNP 3WC2A 2YNHB 4C98A 4DSKA 4FN5A 3O44A 1FA0A 2R2SA 1HA1A 1RT4A 3NBPA 3A3OB 3BSNA 3DLGA 2JJ4D 4FKXA 1MSWD 4K4XA 2YH1A 4QWBA 1A0OB 4UQTA 2XB2D 3BGUA 2FHOB 2HHXA 2FJEB 4M5KA 4XK8C 2UXCJ 1RI7A 4P74A 3WX8A 1I3OB 1G3OA 1GFWB 4DV1J 2WOMB 4KO0A 1TQLA 1HW8A 2IMOA 4QIGA 3DOMA 1N5TA 4MIAA 1EETA 3O8WA 5D4NA 3PHTA 2VA2A 2C3OA 3T6JA 2AEMA 3PXGa 2CQCA 2OI2A 4OHXA 1JLBB 1CVJA 2APOA 5LXRA 3NLCA 4WYWA 1X7VA 3KTQA 4X4OA 3BH6B 3PFOA 4WU2A 1OO0B 4Y2CA 2EFGA 1Z2ZA 1JLFA 1T05A 1NH7A 1EP4A 3EDRB 1FKPA 1PAEX 4ECXA 4USJC 4KPYA 4CLSA 4KPCA 2J6SA 1VFJA 1X31C 1N0UA 2KO1A 1UTAA 4F0MA 3SDEB 1LFWA 3MMCB 2OSQA 3M32B 3Q8QB 2R7WA 1EIYB 2N4DA 1FKOB 4EFAC 1VI7A 3EMTA 3W61A 1ROFA 2VQFJ 1HHQA 2RQKA 4YB6A 1ZA2B 1FCAA 2O5DA 2XMJA 2J9CA 5M2RA 3EGZA 3PV8A 4RPFA 3SV4A 1B0PA 2HGMA 5HMXA 3T41A 1SJFA 1KLMA 2AYGA 2R4FA 2HZCA 2KH9A 4QWEA 3M8QB 2G0JA 5A8RB 4L75A 3FUYA 3QGGA 1MMDA 2Y1JA 3T1YJ 2UUAJ 2CZVC 3AQOA 1HKAA 5I3QA 4ED7A 5H9EJ 3HO1A 5DZ7A 3N6NA 4JI3F 2UVWA 1YHQS 3PR4A 4OX8A 1GMWA 3LQVA 3M1VA 1O5JA 3VAJA 3BREA 3VAFA 4J9NA 3HKWA 3MPWA 5CCLA 3HVTA 1CULA 1NZ8A 4M95A 1U48A 4TVAB 1RGVA 4WIIA 4IDKA 2GQCA 4R8UB 1ZAVA 1ZTWA 2ZE2A 2GNKA 1AZSA 5F9LA 4JBCA 2IJFA 2X3DA 1UW4A 3UD4P 1T11A 1F6TA 3DOLA 4DJBA 1BXNA 3CJQA 2GFFA 2CNOB 2CNKB 1J5OA 4MJKA 2F8MA 2LDYA 4E8UA 2QA4S 1KSPA 4GKJJ 1NHVA 5LSOA 2KG1A 2DCUB 2Y8YA 2ZHAA 1IR1A 1BQXA 2QA2A 3RG6A 3OUYA 5DG8A 1T9UA 3GYNA 2GQ2A 3KK1A 3QYYA 4ECWA 3R5CA 1R6YA 5KOXA 1PJ7A 5KFDA 3CNQP 3QT5A 2XMAA 1Q16B 1A6LA 3L9ZA 2YWKA 2V67A 4C9DA 4QOTA 2B5JA 2BMBA 3E8OA 1RDRA 2R2TA 3NMRA 1VLYA 1S4FA 3KLEB 2W9CB 2MEWA 2Q3PA 3T6BA 4CLFA 3OJSA 4B9TA 1HPZA 2ZD1B 2FVPA 1NK7A 1B3TA 4O3NA 4MKVA 1T3OA 4M5IA 3GYXB 1ZA1B 2HWIA 4FZVA 1HNWJ 3D4JA 2ALZA 2CDRB 3ZZRA 1RHKB 3OXGA 3MM6A 4K0KJ 1JNRB 2CFXA 2MDAA 1FRXA 5ETLA 5HROB 3HI9A 5K8OA 4PUOA 5KG3A 4Q0BA 4ECQA 3KG0A 3ENWA 3NOCA 1C0TB 3AD7C 2WVCA 2A2DA 2B4UA 4WXWA 4YQWA 1FERA 2GJ2A 4U7CA 4IKAA 3PCOB 1P1TA 2JOQA 2QG9B 4OV6A 4IG3B 2V94A 4N77A 1FESA 3TVZA 4DX8H 2W4PA 2HBZB 4ED0A 4U67Q 1EAYC 4RJVA 3UW1A 2OEKA 2RDDA 2MY7A 5B08A 2G4BA 4DL2A 3FCHA 2A6MA 2HZVA 4QYRA 4OHWA 4QWCA 1BWVA 3HVRA 1R0CB 2CJXB 4LFCJ 4L76A 1Q5YA 3OSNA 1FDAA 5J2NA 2V8HA 3EX7B 5K8NA 1R6VA 4M63A 4YR3A 2FVCA 3HHLB 1RT3B 3N0VA 1HWUA 4JI6J 1KQGB 4ANCA 4O4RA 1TAQA 2JC1A 3D6TB 3H8YA 1X4BA 2B9EA 4ZVEA 1GXTA 2IM1A 2J0WA 2LDIA 5BR8J 1RTJA 1RHQB 2D3OR 2QLBB 1BLUA 5E41A 4QBUA 4XTTA 3KK3A 2AHOB 2CJQA 2WBMA 2BM1A 4K2JA 4RNMA 3HP6A 1AFIA 2W2PP 4FPRA 1AYEA 2UZAA 3DMJB 2ZH5A 3IS9A 3MD3A 1YSJA 2C28A 2W2NP 1X4AA 2DNMA 3CDUA 3EGWB 1XQIA 4DV0J 4DR4J 1Y5LB 4OX9F 2N3LA 3M9OB 2DEJA 3CCUS 5IT9Y 4RU2A 1N5SA 2HHQA 3H4BA 4UZCA 4L6V3 4X66J 3CDBA 1TL5A 3M8YA 1L3SA 1W25A 1R0AA 3HK2A 2YNIB 3OL6A 3W60A 3CJ8A 1HBUA 5G4DA 1WC1A 1FJCA 6FD1A 2R2UA 3BF4A 4ZA1A 4JI4J 1EZZB 3AOCA 2C3YA 3PKYA 3SMZA 4USMA 1RXOB 4QW9A 1T02A 3E01B 3Q86A 1F0XA 4OYIA 4LRAA 1JLAA 3C2PA 1ZETA 4F2SA 4F67A 5KFLA 3OTCA 1CJVA 3LP1A 2P9EA 1N5VA 4L74A 3LH2S 3DLKA 2FLLA 2W9BA 4CH1A 1RTHB 4OI2A 3SSSA 1N48A 1F9HA 1TK8A 1GMWD 1WSVA 3HHNB 3M2VB 5J1EB 3I5AA 2W2QP 1OQ3A 4NA1A 2H5EA 4PCQA 1DAXA 4HDHA 4LQ3A 2KZMA 1VQ4S 1S9EA 1TL1A 5HK4A 1T03B 1RJJA 3U1LA 4HDGA 4TXSA 1WTBA 4ERDA 4UUXA 1WUUA 1AUDA 1TMJA 3A1YG 4ED4A 5GAEI 3TVKA 1C1CB 3ZTQA 1VYAA 3R5AA 4NLDA 1MN7A 4DL0C 2P8IA 4NXNF 1HWJA 1VMBA 1BQNB 4ZS6A 1YG0A 2H51B 1VCTA 1WKJA 2HQDA 3ZZYA 5HVHA 5CQGA 3RB6A 3CJKB 1WKKA 4NLUA 1PSDA 3F56A 2XO6A 4F3MA 1TELA 5KT4A 3UD3P 4MKYA 1GMUA 2RE1A 5F3ZA 4TLRA 1LK5A 3ZC4A 3MM7B 4JV5J 3KHLA 3IR5B 2V2KA 1L3UA 5E3CA 3CD5A 3J81Y 2B43A 3NKYA 3JS9A 3QBCA 4DL6A 1FFWB 2ZUAA 1FD2A 5IV3A 4XDCA 5DQIA 3KWMA 4NXMJ 5GAHU 5KFZA 3IA0A 1RAOA 1OPIA 2CRLA 5HMWA 5D15A 3TQ1A 1UL3A 4ZCIA 3R3TA 3F41A 2ZOFA 5AXLA 3HSDA 3FBFA 3S7RA 4N76A 4WU3A 3CD6S 1R7IA 1RT6B 1FE4A 4CLUA 3VALA 1CC7A 3GCWP 3BGLA 4QQBA 2FHMA 4JI7F 4ICLB 1WG4A 2V8DA 3R27A 3KJQB 2B8QA 3MCSA 3C16B 1AT1B 2QL5B 4FF3A 3WZ0A 1RWOB 1NMEB 4YB5A 1MLAA 2KRRA 4ELVA 5HQMA 4AL5A 1U0HA 4BHQA 5DLFA 5T7LA 4LRDA 1R89A 2RS8A 4ZDNA 1GTHA 3CE8A 1RCXB 1QSLA 2IRYA 1X9MA 4O4GA 4RW6A 3TJ9A 2CQPA 2CQ0A 2I5JA 3CCRS 1HNXJ 4QJVA 2I0XA 4DF8A 4X4QA 4DX6A 1NM2A 4E98A 2FZCB 3OR1A 1NJZA 1QD1A 1WHVA 4X4SA 2NCKL 2DNYA 4RX6A 4DR1F 2GV1A 3CCWA 1T9TA 3BDEA 1YITS 3BSOA 1LW2B 4ZCKA 2VICA 4YY3F 3FEYB 2BZ2A 1MW7A 4NI2A 1VS3A 3K5OA 2N3OA 3GWCA 3B6BA 3QWUA 4MAKA 1R43A 5KG2A 5IFMA 1XTZA 2BE2A 4LIWA 3G6ES 3D2WA 3UCGA 3JYTA 1FEEA 4KE5A 1EKSA 1LWEA 3PFEA 1HNIB 2DY9A 1YRUA 2DO4A 3UN5A 1HBOB 4PRFA 4DQQA 7FD1A 4NCGB 2BEFA 4FXVA 1H2TZ 3N01A 4IYQA 1T7PA 3OXFA 1LV5A 1T8EA 2Z30B 1CBKA 4X65F 4IG0A 4JI8F 1Q0NA 1SCJB 1SQEA 3JSMA 4MYUA 2Y8WA 1HIYA 5E5NA 3PYFA 3CW2C 2ZZNA 2BOPA 1F2GA 1FX4A 4DV6F 3CF5Q 3J7AN 1NBEB 3GIKA 4YDXA 2HZAA 1DZ5A 1JMTA 1K44A 1Z1ZA 2AZ3A 5A8KA 3I56S 2VL1A 5D78A 4WJBA 1PG5B 4KKOB 2Y0SD 3C6UB 4FF1A 2ZBCA 2AF6A 2PI4A 1MNEA 5LSLA 1WC6A 4CH7A 1RHUB 1N33J 2RJZA 4DSLA 1RE1B 2MZJA 4A8WA 1WORA 3VAKA 3LO3A 2MQOA 3UFCX 1TL3B 4KHPF 4TU9A 3AH6A 2DHAA 4B3SF 1DTTB 3K59A 1X5PA 3R7SB 4DUYJ 3AODA 4KAIA 3N5BA 2DRDA 4HHJA 1JX4A 2D3O1 2XLKA 3BBBA 1B0TA 3PM9A 4USVA 3GFZA 2VKRA 4LF5F 1R8BA 4XIUA 1H7XA 2XLIA 3GR0A 5LT5A 5AXNA 3KG1A 5HP1B 5A8WA 4HHHA 2DISA 4OI4A 2YNGA 3MEEA 1MMNA 4I64A 2IYIA 3CXCR 2VF3A 4I7FA 1B0VA 2JVOA 4YB7A 4V1Ak 4KGVB 2AU0A 2VJUA 4JV2A 2NXEA 2MB0B 2L48A 4AT1B 4X4RA 1NDLA 4J37A 2W8KA 3CCJS 1TKZB 1HARA 2W7AA 1G4CA 2GJIA 4LQ9A 2BA9A 3PHEA 4YMEA 1C0UB 2MJUA 2UUCF 1GXLA 2M8HA 1RLDA 2IJNA 3M2RB 2DH8A 4MTPA 4ZVQB 2E9RX 2XSFA 1V9OA 4OYPA 3QJPA 4FP9A 3KYLA 1TV6A 1RWUA 2GGPA 1F3FA 2HS3A 3BYPA 3M30B 3CMAS 3IG1B 5D0GA 2FJWA 3MD1A 3W5XA 4B9UA 4RNOA 2DBBA 1IR0A 3JQKA 2AEFA 2R3VA 1IKYA 2GMHA 4L3NA 1FXLA 1M5OC 2LEAA 2KTQA 2ZC3A 4USWA 3R1LA 4YFUA 2MZRA 3MHYA 3FBBA 2OAUA 4O44B 3M2UB 3IO1A 2NYIA 3OTDA 2Y9HA 1IBKF 4OJ1A 4CCHA 4OYOA 3DU5A 4WWSA 5CYMA 4C8LA 1H2UX 2AYMA 3HKZD 2IC3A 4PWDA 1BWEA 1FD8A 2KB2A 5HAOA 1L3TA 3ENQA 3CJTA 3LOUA 3AQPA 2A0FB 1PAUB 3PO5A 4ANDA 4DR7F 3IBFB 1RAIB 2OPPA 3G9CA 1QAJA 4Y34A 1VQ7S 1MROA 2R8JA 1FJ7A 4GRSA 1SQGA 2YKPA 2C2RA 1N36F 2CJAA 6FDRA 2GS8A 1WEYA 4ZVPB 5DO2A 3MFHA 3R1HA 2EPIA 3BZQA 1ZZFA 4JI2F 3M6UA 3TJAA 4J9SA 3UI3A 4C0HA 1HMVA 4WF9Q 4LBHA 1FEHA 3LALA 1SKSA 2OPQB 4JI1F 4OMFG 4ZKAA 4IRDA 2HFSA 2QZ8A 2MKHA 4H4MA 1S1TA 5L39A 2BQRA 4UOGA 2ROPA 4LSLB 2HVEA 2GJFA 2LECA 2IFXA 5SZTA 1XNQJ 3A8JA 1XK8A 1WC4A 5EN1A 2BX6A 4LJMA 3TUZC 1LEOA 2DH7A 3KXDA 4QWAA 3H2UB 1UCNA 3I5BA 2IM2A 3BM7A 1NJYA 3BBCA 3GJSB 2IM0A 5E3RA 3TP2A 4DXLA 1RHRB 3K5LA 3TRGA 1J2VA 3NAHA 1RHMB 3D6HB 4M5LA 2V4JA 4EGLA 1XWLA 2DXDA 1TL4A 3UR3C 2BKOA 3H59A 4M5DA 1RADB 2BABA 2BJ1A 1ZM4A 2IJRA 1V5IB 2HBYB 4WK3A 2G2YA 1OIAA 1VQ5S 2NXJA 3SBMA 2HNYB 4B3OA 4E2FB 3LGNA 1HBMB 1KLNA 4C8YA 1F3VA 4LF6F 3KNAA 4MT1A 4OYXA 2JWNA 5F8IA 5A6PA 3A4TA 2W7PA 2DPJA 3PRDA 5D3GA 4WFNQ 2KM8B 2V2VA 5EDWA 3MAHA 4UY8T 4WK1A 1RA7A 3PX0A 1YBAA 1ZS6A 3H98A 2CJBA 3EPIA 1BY9A 4Y2MA 4J9LA 1VQPS 2UV8A 1ZH5A 2PFFB 1LXJA 1B7FA 1BMQB 1VQ9S 1SUQB 2M8DB 1HBNA 1FJGJ 2Z2MA 4RW7A 4F4AA 5LMNF 2E9TA 2RS2A 1G2EA 5C25B 3PRBA 4I67A 2WVEA 3GIRA 1XR7A 4PWWA 3P8BB 3M8WA 5DM6Q 4NRUA 5IT4A 1H38A 3I9ZA 2NSBA 3K0JA 4WZQA 2DR7A 4KJIA 4EEYA 5E7OB 1U2FA 3PACA 1CLFA 4WYLA 1NPKA 2W2MP 3DYAA 3QJLA 4PQUB 1UFKA 3C6TB 3D1OA 4RBUA 1ZPWX 3QT8A 4GKKJ 3QIDA 3V2UC 5CCMA 1RZMA 3PYDA 2X3GA 4Q2MA 3EGNA 3PW5A 1I94F 3IWLA 1ZM3A 3W9IA 2IAJA 3V4IA 2ERRA 4JV1A 2HNDB 3MUVP 2IMWP 1QUVA 2ROGA 1RT5A 3CCMS 4A48A 3IAS9 2HGNA 5KG5A 5KFCA 3QJJA 3CD7A 2QLXA 5HBMB 1FX2A 2WAQD 3ITHB 4I56A 4U7UK 4P10A 2KG0A 2OTJS 3CCES 1XMQJ 4XPEA 3DDIA 3H2LA 1RT7B 1JKHB 3FMBA 4PR6A 2GHWA 3MFIA 2YKNA 3A8IA 4LIRA 1NSPA 1XMOF 3PJXA 2W4CA 2VA3A 1RT4B 3I6PA 1UWBA 2ZBRA 1PCAA 3C15A 2QLWA 4LR9A 1F5CA 4EU0A 2FLOA 3DM2A 1DLOA 1P27B 3HZEA 4JI3J 4ALZA 2DGVA 1REVA 1SKWA 5I42A 3VTIA 2IPOB 1FK9A 2CQGA 1SIWB 2YVSA 1GTEA 4WFYA 1EETB 2KYXA 2VPYB 5F8NA 3EM1A 4IFYA 3N28A 1JLQA 4CLLA 5AJ3F 4UOFA 2GW8A 4F25A 2CPEA 4QZVB 3FK4A 5C24A 4GO7X 2E7VA 5CD4A 5J2QB 3OFGA 2ZNYA 2C3MA 3FQLA 1RABB 5DLGA 1T05B 3EVMA 2COLA 4Y6IA 2GHPA 1EP4B 4X64J 1FKPB 3PIOQ 2KXHA 4QR2A 5D0HA 5EUHA 1HNVB 5IWAF 2BQUA 5CHCB 4J9PA 4X2BA 2KT5A 2B4PA 1KDNA 2LA6A 2JX2A 1SJQA 4DR3F 1D09B 2C2MB 2XSJA 2DIVA 1M1GA 1X9WA 2QTWA 2YX1A 5K14A 1HYSA 1PBUA 1CC8A 3D54A 5K20B 3AB2B 3DGVA 4ZITA 4DFKA 3SQGB 4O0IA 3TUIC 2QYCA 1IM6A 1M1HA 1M5HA 1SC4B 3LW5C 2XI3A 3BBFA 3DLHA 1RAGB 1RT1A 4G6VB 4RNFA 1ZOTA 5IQ6A 1Y9OA 2B4OA 1XMBA 4TLQA 4DV2J 4A8SA 1SL2A 2J5AA 4ZMMA 4NLWA 3ZZUA 5HQ8A 2KI2A 5K8PA 1KLMB 1Y0HA 2E5IA 2R42A 2WONB 3KKFA 2DNGA 1VQYA 5CYQA 2CVEA 1JLCB 3CJ4A 1TAUA 3P5TL 1NK4A 3DRYA 5G0RB 2F4VF 3IM8A 4I4BA 1S6QB 2J9DA 4KFBA 1WI6A 1WD6A 3K17A 1G6BA 2E7WA 4IO9Q 3O1LA 2CA9A 3GLJA 3H25A 2OD4A 2XG8A 4PABA 2B4VA 3HX9A 4QU6A 2G0IA 5B0FA 3PW2A 3QAUA 2K06A 3I0SA 3QWPA 2HBRB 3W2WA 2ZUGA 4C0OC 2G2ZA 2ZE2B 2ADBA 1K73T 1K0TA 1AZSB 4KIAA 5ETSA 2XGPA 3HFKA 2EI5A 1N8RT 5HMZA 5AE3A 3QPIA 2QT7A 2I8EA 3NXZA 4OX6A 4QPTA 2H65B 5GAGU 3IM9A 3TX0A 5A2QY 2VQEJ 4EYIB 1KN6A 2ZJQQ 5LSRA 1IUJA 4K7QA 1XR6A 1RWMB 3IN5A 3PX4A 2HK2A 1K0VA 3M8PB 2AX1A 2A2CA 3HPOA 2BQ3A 1RT2B 3OUYB 2XY6A 1CJKA 4P2SA 3KK1B 1KS2A 1RAHB 2PN6A 4EWTA 4LF7F 4ZP8A 5HJXA 4AUKA 3CWJA 2NUHA 3G86A 3OLAA 4PG5A 1C1BB 3DFEA 2BV3A 1HQ2A 2B5JB 1GEHA 2B8PA 4WFBQ 5F41A 2UVUA 4PWUA 4PQAA 1AW0A 4CT9A 3MR2A 2VOPA 1FDBA 2NREA 4N7TA 2HHHJ 4QIVA 3ISNC 1OYDA 2BRKA 2BYCA 4IRKA 2BW7A 1BQMB 2QMXA 4DUZF 5KFMA 3QQCD 5CZXA 3NNCA 2AP6A 4IFVB 2EFNA 3QMQA 2F8HA 3DRPA 3ILLA 4J9UE 4IH5A 1FDNA 3MMBA 2CPHA 5CYJA 4DMZA 3A3PB 4NLTA 4DPOA 2CUYA 1OPZA 1FWKA 1VQ8S 4KH1B 2DYAA 3U1NA 1RACB 1CJUB 5THWA 4Q0BB 4B9MA 2O1PA 3DOKB 4ZPVR 1EARA 1C4CA 1KWMA 4KB7A 2HVIA 2RF2B 1RLCL 4OX9J 2MZTA 1SJ4P 1CPZA 3QAEA 5DG9A 3OVBA 2FY8A 4CLTA 2HGLA 4RR5A 5I4MA 4X4TA 2NR0A 2HNZB 5ETVA 5HANA 5C42A 4ECYA 2QJ3A 2C2NA 1RCOB 4RUCA 4Y65A 2G1DA 5JVGQ 3UDVA 1YBUA 5LMUF 4WFZA 4A8YA 3GV8B 1IKWB 5GAHI 2MJNA 3DXSX 2VDHA 4EYHB 4F4XA 4FPIA 4DL5A 3CCTA 4NA3A 2Q6CA 1KOHA 7FDRA 3GFXA 1U45A 3ONQA 3VZIA 4M5GA 2IVFB 1GXUA 2XS2A 3IP0A 2XLJA 2MSTA 5L1KA 4CO5A 4A4JA 3J80Y 4G65A 4Y0FA 4NYZA 1U02A 3H4DA 2WOMA 2WVDA 3MOZA 3N79A 4LMZA 1SQFA 2QRRA 3G8QA 4JI0F 3Q83A 4BS2A 2G2OA 2ASYA 2J0QD 3UWTA 2EBEA 5D0RA 1YBTA 4NXNJ 1JLBA 3GU0A 3US5A 1VQ6S 3T1HF 3K7RA 5D8HB 4CDIA 1N6QA 1HWLA 1QJHA 5IC4B 3BB5A 1VISA 3VAHA 3IS9B 4U7UD 2VKZG 5ETOA 2J76E 2BXJA 4QIFA 1S12A 3RRKA 3RU0A 3M4XA 5EWGA 1VOMA 1CQNA 2VDIA 1M1KT 2DTJA 2M7SA 1RU2A 2K7KA 4JYAF 3ZTSA 3DXBA 1IWAA 1XNRF 3FVYA 4HI1A 4HLBA 1LXNA 3GZ7A 4N56A 3SDEA 3MMCA 3M32A 2KFNA 1PJ5A 3P45B 4RUHA 1FKOA 4KTQA 2PD1A 4ECUA 3KJVB 1N5YA 3CJ0A 5HVFA 4YS2A 3K89A 3R2DJ 3H5YA 1OQ6A 2DGQA 5LM7E 2VHGA 1Y3KA 5F0WA 4G1IA 3DLLQ 2YNFA 1CJVB 3LP1B 4RBTA 4N8NA 5L1IA 2VFRA 5KFHA 4PG8A 3Q8SB 1NAQA 3O3LA 4S0MA 3CTRA 4DI6A 3KOAA 4YB1P 1WNEA 5A8RA 3SI8A 3DLJA 4MFBA 4DL3A 3C46A 1VK8A 5GADU 3A13A 3QSIA 2FYXA 2UXCF 4ZVFA 3BN7A 1M90T 3OHBA 5F8MA 1IQTA 2JEJA 1ZAWA 1S9EB 3PJ9A 1UAWA 3LPYA 5DGAA 2RKIB 2D9PA 1KQKA 3K57A 4ZLPA 4BLGA 4A8XA 5LXYA 2WBRA 1IN0A 1WKLA 1RAEB 3QZ7A 1FNOA 3VV2B 5J1PA 1HD0A 3QGPA 1HI0P 2QFIA 3OTOJ 2CQHA 3L4BC 1Q81T 3V6HA 3EXCX 4H4OA 1NK8A 3HD2A 2F65A 1Q8IA 3QO9B 1RWVB 1AUSL 1YWXA 3TAQA 5HL7Q 3G8TA 4C3LA 4DR1J 1F5BA 1WC0A 4HHUA 4NCAA 2C2ZB 4ZK7M 1W2BR 1FRHA 1D9FA 4KHRA 2OD6A 1SL0A 4TNOA 2DXEA 4MIWA 2VQFF 1VLOA 4F8RA 1P9QC 4AXIA 2CNNB 2V8VA 1M5KC 3I31A 3JAMY 1EKRA 1UEVA 4C3KA 1D3WA 4ES3A 2EFPA 1HQEB 2GIRA 3NY0A 4WE1B 2VASA 4DL4A 3ISND 5CH7B 2HHVA 2XS5A 2EC2A 4X62J 2NYHA 5F9NA 2VV5A 3FBCA 3KLEA 2W9CA 2WW4A 1SB6A 1ITPA 3C66A 3T1YF 5KFTA 1SH0A 1UJ4A 3JSBA 2UUAF 1Q53A 3UR0A 4F50A 4WP8A 2DO0A 4TY8A 2B9XA 2Y1LB 2MHEA 1S79A 2HIQA 2KJVA 1NU4A 4EI2A 2CZ9A 4USTA 3H5XA 5EHHA 2J9DE 4OIXA 4ZPDA 3QLHB 4GO5X 2P5VA 1U0HB 5CXTA 2HS0A 1IR2A 2R8IA 2J0SD 2QEXS 2XEXA 1YX2A 2FDNA 2DNHA 4LF9F 2MQLA 4Q45A 4NE9C 2PMZD 1Q8KA 1FRIA 2M2BA 2DXFA 2I5JB 5A0YA 1CJTB 3I82A 2R7OA 2BANB 4NZ7A 4P73A 4RW9A 1LQ9A 5KFAA 3MCNA 2D74B 4ZVSB 4EO8A 1XC9A 2VH7A 3PZPA 5K9FA 3M6XA 3ILIA 5KFJA 3GR1A 4I6WA 1V3SA 5KFKA 3D6FB 2WSFC 2EFVA 1QTMA 1VQLS 4NI2B 3MUMP 2C2EA 3OBIA 3AOAA 1RBAA 2OGUA 3ZZ0A 2ZH7A 3L09A 3KDNA 1V3RA 3EWGA 2GAHC 5U47A 5J2MA 5F8HA 2BE2B 2DH9A 4LF5J 4I2PB 4PXBA 2YTCA 1UJ6A 1H0HB 4DX7A 1U6ZA 4ZJLA 3MAAA 4I1TA 1R8HA 2EWHA 3RZAA 4KBIA 4C7QA 1WDDA 2UUWA 3VHQA 4JP8A 2YWGA 1NSKL 3I96A 4M5MA 2ZH3A 3KJNB 4URGA 1JLEB 1NSAA 3WIUA 1I6JA 3JSMB 3CC2S 3GP9A 2YKQA 1HNWF 1RTDA 4DV7J 3FZBA 2HFUA 4K0KF 1WELA 4HEA9 3DMJA 4PEOA 2F63A 2DY1A 2LEBA 4WP3A 2UXBJ 2QGFB 2XNRA 2YKAA 1IBMJ 1L5UA 3BEGB 2LP4A 1PGZA 4DF4A 3T5JA 1ULRA 3GCXP 3GSIA 2J0XA 1WG5A 2GQQA 3W1YC 3DRSB 1KC8T 3NGUA 1FRMA 3V6DB 1YLXA 2HMIB 1AB8A 5DDOC 3JQJA 1DQ9A 4CO3A 1D1UA 2DITA 2ATCB 1SC1B 2V9WA 2LXFA 1WC3A 3MM5A 4YP3A 1F1BB 2MKSA 2M9KA 3W7BA 4A46A 4PXEA 5FJ4A 2U1AA 1WJ9A 3RAMA 4WCEQ 6AT1B 4B02A 2CG4A 3E01A 2LQJA 5KFSA 2M52A 4B9SA 1OJ4A 5B09A 1KR4A 1VQKS 4LFCF 3PYEA 2EFOA 1IBKJ 5ADZA 3R5BA 2ZVSA 5HJYA 3LANA 2XS7A 1R8CA 2EK1A 1RTHA 3MI7X 4C8KA 3LP0A 4Q43A 4KRWA 4WP9A 2VBXA 3KLIA 4ED5A 4JI6F 3I55S 1SVDA 3GYGA 2YKMA 4BWJA 2YNGB 2H48B 4I6AA 3BJYA 4WKYA 1KQSR 4PG4A 4V19X 2DHGA 4N47A 3NCQA 2XCPA 3D0IE 2GVZB 4I7FB 4OYAA 1IQZA 4OYWA 3HD1A 5DM7Q 1NB7A 3PJWA 1LW0B 5DGBA 1IM4A 3FRYA 1RTIB 4JI2J 1BQNA 5GMDA 3QATA 3HSGA 2XTJP 1QAYA 3R7NB 2BJ3A 2KVIA 3CJKA 1KVIA 4DSIA 1E6VB 2RD5C 3W2VA 3RYLA 2XO7A 3L95X 2OFGX 5KFBA 4DR4F 4PYAA 3LAMA 2RRAA 1UFWA 3PO4A 4K59A 4ES2A 3IBCB 1X4CA 4CH0S 3B4DA 3E2EA 1NH8A 2HFNA 1FFSB 2GGPB 2XCAA 4UTGA 4DV4J 3NEKA 1KBRA 1SJRA 3TAPA 1N34J 4C11A 3PW0A 2ATLA 1B99A 2OEMA 2P9CA 1VC6A 1TUWA 2VC1A 3HT0A 3W63A 2BW2A 8AT1B 3GFHA 3IC1A 4JI4F 1T94A 2JHEA 3UVJB 2D41A 1ZM9A 3OD2A 4RUBA 4F36A 4G1QB 2XHCA 3CIMA 5J2PB 1RT6A 4DV3J 3R97A 4ES1A 2Q43A 2BOAA 4YR2A 4G1PA 1HW9A 4DWIA 2DR6A 4MIBA 2IDLA 4TQSA 3V81B 4CO1A 1K47A 4OHYA 3CUNA 2IM3A 2NS1B 1DRZA 1U1LA 2ZM6J 1FXRA 3C16A 2FLPA 2YY3A 3IRWP 3CCQS 1Q86T 4QWDA 3FSIA 1WF1A 4C8MA 3CJRA 4O23A 4FVCA 1WWHA 4WIQA 3KLHB 4OJ3A 5I3UA 3EZOA 2QV6A 2FVSA 2FUG9 4CLPA 1YJ7A 1NSQA 3P4UB 1V5VA 1UVNA 1U49A 4Z37A 1HR0F 3VVUA 3K2YA 2MGZA 1TUVA 3GONA 5D77A 4RWXA 4DG1B 2VU5A 4GC6A 1RISA 1DQAA 1LOUA 4DUTA 3MPDA 3IGNA 1Y5IB 3GJQB 1KONA 1ZZNA 2KKHA 4ZP7A 2DNRA 1TFWA 4LFAJ 1FVQA 1N52B 1QM9A 4NWBA 2VONA 5LMNJ 4YOEA 2YQ3A 2CQ4A 4C8NA 5JUMA 3SEOA 2HLTA 5EX0A 2WHOA 5HI7A 2H5IB 4URSA 1IBLF 2W25A 3BH7B 4K4SA 4CNYA 3RBZA 1LKZA 5L1JA 2CNLB 2F7VA 2K1RA 1S9GB 3OR2A 3DKDA 2V4JB 5KFIA 2N82B 1ACMB 3S8SA 1HBOA 1J5EJ 4NCGA 4ZIVA 3KHGA 2U2FA 1O0PA 4WXOA 3H40A 2AMCB 2XMKA 1PO6A 1RP5A 1BC6A 2P9GA 3LGMA 3X1LB 4OQJA 1HNZJ 4UOHA 2RH3A 3MPYA 1SC3B 4Q44A 5GAEU 3WHIA 4BCAA 2EKNA 3VGUA 2CJYB 1S0MA 3SXLA 1NLKL 2HAIA 3NGDA 1YQHA 3DDNA 3AXMA 2XZDB 1S6UA 2PSZA 1L3KA 4HL9A 3B8HA 1Y11A 4DHVA 3LWMA 3D0HE 3JQMA 4BC7A 4KKOA 1XMOJ 3TAMB 4WTOB 3KK2A 3PY8A 1HNXF 3RAXA 2MQQA 4YDDB 4ZVGA 1S6PB 3AB4B 4AYBD 3RW7A 1N56A 1S1WB 1OY6A 4Q2LA 3MM8A 4FVMA 5KG1A 3UDEA 3K58A 4RBVA 1HBNB 2KHCA 4M5JA 2ASDA 3D7SB 3VR1A 1U1NA 1K9MT 4DV5J 5B0DA 2X1FA 3DN9A 5FLXU 1MU2B 1VRQC 2C2OB 1PKUA 3MF5A 4ETZA 3TZZA 5AJ3J 5BXIA 5DDQC 1WHXA 3Q24A 4KV8B 2PMWA 3THVA 3OXLA 5FDLA 4RW8A 5B7WA 5HP1A 1HHTP 4QPXA 3GJTB 2WB4A 2ZKUA 1S99A 4NASA 2NXNA 4TYAA 2IAJB 3EE3A 2RRNA 1T9WA 2B6AB 3VGSA 3NCPA 5IWAJ 2MZ1A 4J9KA 1QDUB 1OSCA 3V6JA 1YRTA 3J7YU 1QAXA 3PKMA 4DR3J 2AX0A 4OX7A 1FTCA 2XMUA 1B64A 1X4DA 4J9VA 5GAGI 2GAGC 3DCAA 2AGQA 1TKZA 4BC9A 4IOBA 3EXYA 5FD1A 4Q7AA 4OLOA 2RU9A 4OZ1A 1TKTB 2VFVA 1SJ3P 1C0UA 2Q1LA 2EC0A 3U1MA 1KNZA 4K4WA 4K4ZA 2L08A 3SCKE 4DCOB 3LWLA 4C3MA 4NZ6A 4IQMA 2W8LA 1E6YA 2FC8A 3R5DA 1NJXA 1U25A 2CQIA 1JLGB 2YKNB 2Q79A 5DZ6A 5ETKA 4KGKA 3P49B 2B9WA 5KT2A 4A47A 4DS5A 2HKEA 2IY5B 4R5PB 5B0GA 1QAIA 3CDAA 3M30A 3QIPA 1I51B 4FXWA 3C14B 4IR9A 3D1QA 3QGHA 3TX8A 2L41A 4DR6F 1V6HA 3NWRA 4MK8A 4AD6A 3BGRB 1TKXA 4I2QB 4EZ9A 5T41A 2BUNA 4DSFA 3TUPA 4MK7A 1WI8A 4ECRA 1S4EA 3VF0B 5KOWA 2IIHA 4DUYF 3TANA 2DNPA 3NRBA 4WKRA 2DNKA 4O44A 1P8GA 3J7A1 3OL9A 4EBCA 4OZ3A 4FNIA 2YPYA 4B3RJ 2C1EB 2XMVA 2BJ9A 4DCPB 2R8KA 4URQU 5HN0A 2VBYA 2DGWA 1U1KA 4M5NA 2EK6A 4ZIWA 3NGSA 3FZ2A 4ED1A 3TNVA 3MM9A 4TN2A 2CQDA 2HQCA 2VG6B 3ET6A 1Q82T 1O51A 4CYUB 2F9DA 1NPRA 3QT7A 4JI5J 4DN0A 2IHR1 4AQYF 4AFFA 3KMSA 2EG1A 2Z8QA 3CSKA 1JXEA 2UU9J 2VFSA 1UEUA 2FZGB 1HYSB 4QW8A 4FXDA 2N4CA 4ZHRB 2XULA 4NLXA 1B7YB 4LF4F 4JUZA 5CAAA 2HK3A 2KYZA 3D5MA 1BGXT 1RT1B 2A1BA 2OPQA 1NK9A 1TTHB 1NKBA 2BACA 1M5SA 5DQGA 1KFSA 3BKUA 1CSJA 3IRXA 2ZH4A 2BM0A 4ZLLA 2OHDA 1U0SA 2X1AA 1DFDA 4CLYA 3QSYB 1XR5A 4R0EA 2DR9A 4OYMA 3DRXA 2XY5A 3TWZA 1S97A 2QX0A 4LBIA 3LP2B 5D4PA 3MWBA 3VAMA 4L3KA 2DHHA 4KSEB 2OO4A 1GH8A 4KHMA 3CC7S 1Q8LA 1NKCA 2GIQA 3RR7A 4R0JA 3I0SB 3CMQA 4M8LA 1VJWA 1N88A 2NPFA 3HULA 2I9SA 1YI2S 1U1RA 2HEKA 3H7HB 2V5HG 2WRMA 3HFZB 1FJEB 3Q8UA 3M05A 4AE5A 1FDDA 4F3OA 2QMUB 2HNYA 2DGTA 3R6LB 5L8RC 4FYWB 3CJ5A 1N4LA 4CZCA 4PPZA 3M9NB 2PEHA 3AAWB 4J91A 4RW4B 3AJ2A 4I6YA 4N41A 2LU2A 1SKRA 5IV4A 1SBRA 2XMWA 3SYZA 4ZVRB 4UZBA 3Q22A 5LMUJ 2GVDB 4ZLNA 2WSEC 2A18A 3L7UA 2V2ZA 2MTLA 3HSZA 2XWXA 1TK5A 1S1VA 4CM2A 1QE1A 4D3HA 3QRPA 2H54B 3PG9A 4ZVTB 2F1FA 4FBUA 1F9EB 1URRA 3DI6B 4PXDA 1HWKA 3VVTA 3C8YA 2CAJA 1YDLA 1SUQA 4OHZA 4ID5A 4NLGA 1XNQF 5HLFA 1VGYA 3JSRA 2O3DA 2RHQB 2CG8A 4CM0A 5GADI 1T9VA 4OI6A 5C25A 4J9OA 3NWGA 4HI2A 1RU1A 1V3ZA 4ILRA 1YTYA 2VFTA 2CPYA 1JIHA 3TA1A 1QSSA 1NDPA 3DRPB 4CO2A 2CWXA 4JI0J 2FHKA 5T14A 2N7CA 4QIWD 3UN2A 4GVBB 1UFLA 4J9QA 1YJWS 1NK0A 4PQUA 2LU1A 2R8GA 2UUTA 3B78A 3S01A 2M5YA 1CG2A 2JRSA 1MN9A 4OL8A 2HNDA 3MPUB 4NLPA 2OPRB 4JYAJ 4X4VA 4NOHA 3CC4S 1KTQA 1XNRJ 3QRRA 3K8WA 1EJ7L 3GMGA 2DGXA 2MYFA 3CB4A 3ULHA 2VODA 1S0VA 2PIIA 1X5SA 1ZTTA 3UD5A 2W7OA 3Q0AA 3KLFB 5KAKA 1D8ZA 4HACB 3GG0A 2P2CB 3MECB 2IRXA 1MG7A 1UVIA 4HT5A 2ZZMA 3D3BJ 4U96A 4ECSA 3EICA 3EUNA 1AFJA 2BJ7A 3IBWA 5CA5A 4RWWA 5J1NA 3Q89A 1RT7A 4YN3B 5C42B 4KR0B 1JKHA 2WB1D 2OPSB 3T19A 3OFEA 2MKCA 5B0CA 2UUBJ 4C6AA 3DLEB 3TEHB 2ZC4A 2WVFA 1TVRB 4LT6A 2NZ4A 4LSNB 2V4RA 3R9LA 5L1LA 4NA2A 2VBZA 3T9ZA 2YBVA 2X51A 1S1XB 3PEHA 1SV5B 2MZQA 4OYBA 2GO9A 1FJGF 1UA0A 1Z2LA 3KUEA 1HI8A 5JXSA 3BDPA 3QZ8A 4CTAB 3RTVA 8ATCB 2W24A 1PBAA 4B9LA 2VG7B 4DFJA 5DDPC 1N6QB 3I4HX 1Q7YT 1OY9A 3FC9A 3H2VE 5J2QA 3W65A 2VG5A 4GKKF 4NEZA 3Q8VA 2JLGA 4I0WA 4C2MA 4FBTA 4NPOA 5H9FJ 3FKBA 2AJ1A 3W9HA 2F4FA 4P7TA 1HNVA 2EBGA 3CMES 2JZ5A 2ZBIA 1H98A 4WTYA 3VZHA 1NJIT 4L72B 2HQ3A 1WTFA 1VRTA 3H0PA 2HURA 2OUGA 1YK9A 3GPAA 1JXVA 1CEZA 2V6AA 1F60B 3RB3A 2HSEB 1N5YB 3I5CA 5JVHQ 3SQGA 1RAFB 1RHJB 1S1UA 4LF1A 3FMWA 1XMQF 2M3DA 1IXKA 2KDOA 2AJ2A 1WF2A 3H5UA 2XQCA 3G82A 1LWCA 3LF0A 2AJ4A 3PW4A 5IOLA 4ED8A 3VAGA 4RL1A 1I5OB 3NS5A 2YNFB 3DGPA 3NGRA 4I68A 2WONA 3FRZA 2OTLS 2J9EA 2FGOA 3DLBA 3EJMA 3THTA 1GQEA 1JLCA 5KFXA 4F4ZA 4MFBB 5G0RA 4PG7A 1S6OA 1Q8BA 3RB4A 4DOZA 4DX5A 1S6QA 4NLOA 2MQMA 2PDAA 2NZCA 2JL9A 2YWEA 1X8DA 1BHNA 3MCOA 3QT6A 4F26A 4ETXA 1D8YA 3ELHA 2LQ9A 2DHXA 4ID8A 3GILA 3QGIA 3ILOA 2A6OA 1Y10A 2UXDJ 1NZAA 3IFEA 4ELTA 3PNIA 2QL9B 2V69A 1RYRA 1QLNA 3G8SA 1WHYA 4FYXB 3MEDB 4X4PA 5L38A 4LF9J 4Z7YA 2D3UA 2OMOA 4DSEA 4ZP6A 4H4OB 3TR5A 3O2IA 3W5ZA 2NUUG 2CKWA 4X64F 3M9MB 2KU7A 2MQ8A 2Z56B 1U4BA 2PEBA 3DU6A 4EBDA 4A8KA 4A8FA 1U8SA 1H3DA 1Q95G 5KFFA 2OLWA 4B08A 1IKXA 3A8EA 4A8MP 1FO1A 3M8PA 2A10A 3ZXWA 4J9RA 1RT2A 5IM0B 2QA4G 2DRAA 1EX8A 2J7WA 4DZDA 1U24A 2AGOA 4CI0B 1G7CB 1DTQB 3OVAA 2G9OA 3POTA 2DHSA 2YX7A 3HLUA 4U6PA 2JFKA 1NO8A 1F5AA 4YHHJ 1C1BA 3OL8A 4DV2F 1AROP 4B3TJ 2YQ0A 3R5GA 2D1CA 1FE0A 5F3TA 3HSJA 2ZKTA 4NLYA 4P9SA 3QFWA 3DHXA 1BQMA 2ZDOA 1UPMB 2HS4A 1WEXA 1KQFB 3OFHA 4IFVA 3NL0A 3BPSP 4KGZB 2OFHX 1VQNS 4TY8B 4DR5J 2R7SA 3P5BP 5IXUA 3ETMA 2HHWA 2NXCA 1KVJA 4KT0C 5I3PA 3K5PA 2Y1RI 2Z4PA 2RU3A 2HFZA 1FT8A 2ILZA 1CJUA 3CIZA 2ILYA 1Y4ZB 3DOKA 2J6TA 4KQZA 3B54A 3WX4A 2RF2A 2W4DA 4TU7A 3I0RB 3W66A 4OI0A 2WZ1A 2LFVA 3MEGB 5EWFA 1TUGB 4CQ1A 4PKDB 4B3MJ 2FJBB 3KMQA 3LA0A 5A0YB 1UW9A 4OJGA 2JEGA 1NXIA 4RW9B 2DCLA 2VQEF 1UETA 3BR9A 3NOGA 2HVHA 4M1KA 2HNZA 3BO3A 3UNYA 5F8JA 2DT9A 5C2GA 1TFYA 4DN9A 3OL7A 2NXUA 4V19J 1N54B 3U02A 1IKWA 5HQLA 3RB0A 3G96A 1RWKB 2KJWA 3W8PA 1X0FA 1H74A 4P71A 5J2MB 3JB9k 3KG4A 1M5VC 2HQFA 4J90A 2RAQA 5IT9U 4FYDA 3WC0A 1QVGR 2QLJB 1RQ0A 4U95A 2HHHF 3MAAB 4DPWA 1XJWB 3C3LA 4RUAA 1U1PA 2YPZA 3EZ5A 4LF8F 3ADAC 4IQXA 4P52A 1NK5A 1YZ6A 2AWZA 3FSXA 4CWBA 4KC5A 4ECVA 1TP7A 3AJDA 1FWLA 4NEYA 1IVZA 2GO8A 1AXQA 2DR8A 1U09A 4DPUA 1RTDB 4WFXA 1QSYA 1SIZA 4FYYB 1R31A 4Y28C 1FWPA 4ZJQA 1Z4UA 2FHJA 3IR7B 3QFHA 4HTJA 1VC0A 1TL7B 2Z2ZA 4NX9A 3V6KA 1APSA 2QIFA 4Q5VA 1Q1KA 4YUDA 2WCXA 4NLQA 4MK9A 1LFPA 2DIUA 4YEAA 4Q8FA 2DKOB 1LWFB 1TZ0A 4ANEA 2IA0A 3ENVA 3MUTP 3BKTA 2HPUA 2PMHA 2XC9A 3KJVA 3FEZA 3GTYX 5EX3A 1SL1A 1GK8A 3H90A 1VQOS 3VQTA 3MM5B 3NBPB 2P6TA 2VC0A 3DLGB 3HHKA 2NSCA 1DHMA 2JSXA 1RYSA 2RUSA 3PVXA 3T3FA 4QYZK 3FCVA 2HRUA 2X7IA 4Y3CA 2LA4A 4DFPA 3CO0P 2HLUA 1X60A 3K8VA 4O3PA 4OZNA 3HZGA 2ASJA 3IWNC 1X0PA 5GMKa 4KO0B 3KUGA 3DOMB 3ISZA 1FNMA 3LP0B 3RBXA 4TY9A 1NEEA 3P96A 3KLIB 2JH3A 2H5JB 5MLCV 2E1MC 3W9JA 4X84A 3BQ0A 2YKMB 3J81U 2E1AA 3KLGA 3DRRA 3R2CJ 5ETTA 3GB0A 5IC6B 1U7LA 3I32A 2E9ZA 4CLZA 1KRPA 2RKIA 1UVLA 1JLFB 1KEKA 4CLWA 4CT8A 1WOSA 4LF2A 1U47A 1Q4RA 1SKUB 1UA1A 1SJ1A 4ZVHA 1VQSA 2KVQE 3ZFVA 3MMJA 1RKIA 2MZSA 1KHVA 3SSQA 2HIYA 1RWPB 3AD8C 1HR0J 1UVMA 1XIQA 3W2VB 4P2FA 2ZNZA 2MKIA 1I1GA 1PC5A 4NZ0A 4K5RA 3QO9A 3T5KA 3ZZTA 2DGUA 2PI5A 2RDJA 1PJ6A 5BYQA 4U8YA 1JWWA 4QR0A 4OHVA 5CZVA 4C11B 1FTRA 1W7WA 2OH2A 3DHWC 3I87A 4DPTA 1VBKA 1FRKA 3GSDA 4WFAQ 3LTOA 2FY1A 4OLPA 1WOPA 2ADCA 1IBLJ 5A76A 1HQEA 4D3GA 2QE5A 4WE1A 2YWWA 3G2XA 4MKBA 4F3QA 2HQIA 2MPUA 4DPXA 3H20A 1MMLA 1CS4A 3M1VB 4LVOP 1NHKL 3N4WA 1KFDA 1SXLA 2XBPA 2HHTA 4HYKA 3HVTB 4GVLA 3RJMB 1VRUA 1CULB 1YZ7A 1NRKA 2BE9B 4IDKB 2QFJA 4F7VA 2RQMA 2BBEA 2DK2A 1GAOA 3WDOA 1BE4A 2I1RA 3JSYA 5DG7A 2FGCA 3QLHA 5B0BA 2AEJA 3DOLB 5LJ3Y 2GZOA 3J7YI 1YJTA 5I3UB 4GC7A 1IKVA 1J5OB 1S77D 5F0UA 2B56A 4OZ5A 2D69A 1TR0A 2E1RA 4JV0A 2E66A 1VJQA 1MWYA 2DVIA 1NCLA 1N32F 1VBYA 1IBCB 3GV7B 1H73A 3OTOF 3LGHA 1HQUA 1ZAXA 4JOUA 3RBEA 1R0BG 4OJHA 2VPXB 2MGZB 3FFIA 3PIPQ 1CJTA 2BANA 5AXKA 4R25A 2N7YA 2E7XA 5B0AA 3G6XA 3VGTA 4PXCA 2HRTA 4OI1A 3MMAA 3N6MA 4LRCA 2QLFB 4OZJA 1X9SA 1VHIA 5HVGA 2RHSB 1JNZB 2JC0A 4NRTA 2L9NA 4F0KA 3OTBA 5KT3A 5D0EA 2E5JA 2CDQA 5D4OA 2E5LF 4I2PA 1HPZB 2Y1IA 2BE7D 3ZZZA 2K1RB 3OR2B 4W90B 5KG7A 3N5FA 4DR2F 1FF2A 4X62F 2JVRA
chains in the Genus database with same CATH topology
2E1CA 4RNNA 2KRBA 4UY8T 4BCAA 4WK1A 1L3VA 4UOCA 5KFUA 2KXNB 3TVYA 1S0MA 4IRCA 1RA7A 3PX0A 3SXLA 3MM6B 1YBAA 3HF5A 4IR1A 1H2VZ 2HAIA 2O01C 3H98A 2CJBA 4X4UA 3CEDA 3NGDA 3L3CA 1YQHA 3GIJA 3DDNA 3EPIA 1BY9A 3CO9A 3G6YA 1QY7A 3MTKA 1YVFA 1S6UA 4YHHF 4PUOB 4ZPBA 4XAKA 4Y2MA 2PSZA 3BQ2A 4Y2KA 2VOOA 4J9LA 3G6VA 1VQPS 3CCLS 1L3KA 4HL9A 5KFNA 4B3TF 4Q8EA 1JLEA 2ROEA 2RNEA 4QCLA 3B8HA 2UV8A 1IJEB 2RRBA 1ZH5A 4DHVA 2HHSA 3LWMA 3MMBB 3D0HE 5LJ5Y 3TW0A 4BC7A 2PFFB 3D0GE 1LXJA 1B7FA 4KKOA 1VQ9S 1SUQB 3TUJC 2M8DB 1HBNA 3I9V9 2FHJD 1UJ5A 3TAMB 1ZM2A 3HM9A 1R8PA 1VIXA 2Z2MA 2HWTA 2EW9A 4RW7A 3KK2A 3K5NA 5LMNF 1KOOA 4G3IA 2E9TA 2RS2A 3PY8A 1P1LA 1G2EA 3C6TA 2FJXA 3ZZPA 1HNXF 1Y3JA 2PT0A 3RAXA 4K4VA 3AA9A 2MQQA 4YDDB 5C25B 2D9OA 3PRBA 5KG4A 4I67A 1SH2A 4ZVGA 1H6KX 1S6PB 3Q8PB 1XR7A 3IAM9 3AB4B 2D3ZA 2QMWA 1LK7A 5DM6Q 4NRUA 4AYBD 5IT4A 4HKQA 4DR5F 1H38A 3RW7A 1N56A 3I9ZA 3UDCA 1S1WB 4CO4A 2NSBA 3K0JA 4RU9A 1YRXA 4Q2LA 1GX5A 2DR7A 4WZQA 3MM8A 4KJIA 2PC6A 4FVMA 3FDSA 5E7OB 5KG1A 2IYGA 5L9NA 4EEYA 3MURP 1WF0A 2IBKA 1U2FA 2J8AA 3FNNA 3RRHA 3PACA 3K58A 2FD2A 3CDWA 1CLFA 2DPIA 2LYVA 4WYLA 5BYSA 1A9NB 4RBVA 1HBNB 2PGCA 3DRSA 2KHCA 2ASDA 2KFYA 2LMIA 3N6LA 3CVKA 3KK2B 4MKAA 3VR1A 3V6DA 3DYAA 3QJLA 1T95A 2AJFE 1U1MA 4PQUB 3KNGA 3HHDA 3C6TB 3D1OA 4RBUA 1U1NA 1ZPWX 1S72S 1K9MT 2HMIA 2AD9A 2YNHA 3QIDA 4FF4A 3V2UC 5HBMA 5B0DA 5CCMA 2X1FA 5EGYA 3DN9A 4P6QA 2X3GA 1MU2B 1DQ8A 2EVZA 4Q2MA 3PEJA 3EGNA 2FVRA 3PW5A 3ITHA 1I94F 4F02A 3IWLA 5HMYA 1ZM3A 5J2NB 5KFWA 3SV3A 3Q8RB 4B9VA 2IAJA 1S0OA 2DRBA 2HHUA 3MF5A 3MM8B 5F8LA 2XZWA 3V4IA 2ERRA 2L9DA 4K5SA 3ETOA 4JV1A 2HNDB 3MUVP 4ETZA 2BJEA 3OFFA 2CPFA 1X4HA 3VCDA 4USHA 4B17A 4ED3A 1QUVA 1LWFA 2ROGA 2IMWP 1O8BA 2FIUA 1RT5A 5DDQC 1WHXA 3CCMS 4WZMA 4B3MF 2UV8G 2KXFA 4HVZA 4XPCA 4A48A 1PILA 3Q24A 4KV8B 3BR8A 3IAS9 2HGNA 5KG5A 5KFCA 3QJJA 5KFRA 3THVA 3CD7A 4LVNP 3OXLA 1K8AT 5FDLA 4RW8A 5A6WA 5B7WA 5HP1A 3WC2A 1HHTP 2YNHB 4ZPAA 2QLXA 4C98A 4QPXA 5HBMB 4DSKA 2WAQD 4FN5A 2WB4A 2ZKUA 3O44A 1S99A 4A8QA 3ITHB 1FA0A 2OKQA 4TYAA 2IAJB 4I56A 2RRNA 2R2SA 1HA1A 4U7UK 2B6AB 1RT4A 3NBPA 2KG0A 3UCZP 3KLVA 2OTJS 2GX8A 3BSNA 3NCPA 2IBOA 2MZ1A 3DLGA 3DDKA 3CCES 4J9KA 1RTJB 1UVKA 1OSCA 2JJ4D 3V6JA 1YRTA 1MSWD 4XPEA 3J7YU 2AYBA 3H2LA 4K4XA 1RT7B 2YH1A 1QAXA 3KK3B 2ZH9A 4QWBA 3PKMA 1JKHB 2AX0A 2XNQA 3FMBA 4UQTA 4OX7A 3BGUA 2XB2D 2FHOB 1VC5A 2HHXA 1FTCA 2FJEB 4PR6A 2GHWA 2XMUA 5FDLB 4RW8B 4QR1A 4XK8C 3MFIA 3MR5A 3BO4A 1X4DA 1B64A 2YKNA 1RI7A 5GAGI 4LIRA 3DCAA 2AGQA 1XMOF 1TKZA 4BC9A 3CJ3A 2E5GA 4IOBA 3HVAA 3EXYA 5FD1A 4Q7AA 1G3OA 3PJXA 4OLOA 4XDDA 2RU9A 4OZ1A 1TKTB 2YKOA 2VFVA 2W4CA 5IT0A 1SJ3P 2VA3A 1RT4B 2WOMB 3I6PA 2Q1LA 1C0UA 1UWBA 4KO0A 1TQLA 1D9DA 1HW8A 1HHSA 2IMOA 4QIGA 3DOMA 2EC0A 1N5TA 2QLWA 3U1MA 4MIAA 2XY7A 1EETA 3O8WA 1KNZA 4K4WA 5D4NA 4LFBF 3OW2R 1F5CA 4K4ZA 2L08A 3SCKE 3LWLA 4EU0A 3LUYA 2FLOA 3DM2A 1DLOA 4NZ6A 4C3MA 2VA2A 2FB0A 2C3OA 3T6JA 4IQMA 1LW0A 1P27B 3HZEA 3PXGa 2W8LA 1E6YA 2FC8A 3R5DA 1NJXA 4DQSA 4ALZA 1U25A 2CQIA 2CQCA 2DGVA 4PPDA 4OHXA 1RTIA 2F40A 1JLGB 2YKNB 4DV7F 2Q79A 5KT7A 1KTVA 1JLBB 4KGKA 1CVJA 3P49B 1REVA 1SKWA 5I42A 2APOA 3VTIA 2B9WA 5KT2A 1FK9A 2CQGA 3NLCA 1SIWB 4WYWA 5LXRA 1X7VA 4A47A 3KTQA 3RR8A 2YVSA 1GTEA 2CQ2A 4X4OA 4DS5A 4WFYA 1R0AB 1XEZA 3PFOA 4WU2A 4R5PB 4ZOSA 5B0GA 3TO8A 1E6VA 3SFUA 1OO0B 1QAIA 3CDAA 3M30A 2V9KA 3QIPA 2UXBF 4Y2CA 1HBUB 1EETB 2EFGA 2KYXA 1Z2ZA 3IWXA 2VPYB 1JLFA 4FXWA 3FGVA 1IBMF 1T05A 5F8NA 4IR9A 1NH7A 3D1QA 3QGHA 3TX8A 2L41A 2UP1A 4DR6F 1EP4A 1V6HA 4IFYA 1FKPA 2R7XA 3N28A 1E6YB 4MK8A 4ECXA 3L7OA 1JLQA 4USJC 4KPYA 3BGRB 1TKXA 2FJDB 5DS7A 2J6SA 3HDSA 5AJ3F 2HRYA 4I2QB 4EZ9A 1VFJA 5T41A 2GW8A 4F25A 2CPEA 4QZVB 2BUNA 4DSFA 4MK7A 1N0UA 1Q79A 1WI8A 5C24A 4ECRA 3VF0B 2KO1A 4GO7X 4HTIA 2KZZA 5KOWA 1JLAB 5J2QB 3OFGA 3SDEB 1LFWA 2ZNYA 3MMCB 4DUYF 2OSQA 2C3MA 3M32B 2DNPA 3NRBA 3TANA 3RRGA 2YWHA 3Q8QB 1PC4A 2R7WA 4WKRA 3QIPB 2DNKA 2V4QA 2N4DA 4O44A 1P8GA 2HVZA 3FQLA 5DLGA 2J6UA 1FKOB 1T05B 3J7A1 4EFAC 1VI7A 2B7CB 2COLA 4Y6IA 3OL9A 4EBCA 2RB7A 4FNIA 2VD3A 2GHPA 1EP4B 1FKPB 3PIOQ 1ROFA 1W2IA 4ED6A 5DQHA 4XO0A 3DLKB 2KXHA 4QR2A 2RQKA 2XMVA 2Z2LA 5KFQA 1TKXB 3M8QA 2W9BB 4YB6A 5EUHA 1HNVB 5IWAF 1FCAA 2BQUA 2R8KA 4URQU 5CHCB 2O5DA 5HN0A 2QSFA 4J9PA 4X2BA 2VBYA 2DGWA 2XMJA 2J9CA 2KT5A 5M2RA 2B4PA 1U1KA 3EGZA 2LA6A 2EK6A 2JX2A 1SJQA 4DR3F 3PV8A 3F44A 2XSJA 2DIVA 3FZ2A 3SFGA 4M94A 1VK3A 1X9WA 3SV4A 2KT2A 4ED1A 2K2PA 2YX1A 1B0PA 2HGMA 4G1QA 5K14A 2C3UA 3TNVA 1HYSA 1CC8A 3MM9A 5HMXA 3M6VA 2D7SA 4MYTA 2BDPA 3UPFA 4ZPTR 4TN2A 2CQDA 2VG6B 2NLWA 1Q82T 1O51A 1SJFA 5J2PA 3D54A 2F9DA 1KLMA 3AB2B 3KHRA 1GNKA 2AYGA 3HVWA 4IUFA 1M0SA 1TL1B 3GE9A 4DFKA 4DN0A 2R4FA