2A3TA

Cu-containing nitrite reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the oxidized and reduced forms of nitrite reductase from Rhodobacter sphaeroides 2.4.3 at high pH: changes in the interactions of the type 2 copper.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA02
3NJMA 1JVOA 1SDDB 1PLAA 1RZQA 4KNTA 2DYRB 4P5SA 5FC9A 2EINB 1PNDA 1KBVA 1PY0A 2PP9A 2R7EA 1AIZA 1M57B 3NJJA 4G72B 2P80A 1ZIAA 1SJMA 1BEXA 1XB8A 4E9VA 2XV0A 2IH9A 4A2DA 1NPNA 1W8EA 3KW8A 5IY5B 3C75A 3PAZA 3T9WA 3UAAA 1TKWA 2MRYA 4DP4X 1ZDQA 5B7MA 1WAEA 3OM3B 2UXTA 1GS7A 4BDVA 1AOZA 1WA1X 2A3TA 2VSMB 2HZHA 3H56A 1DYZA 3FT0A 2B08A 2UXFA 5I6PA 3GYRA 1MZYA 1PLCA 1WS7A 3ABLB 1SHXA 1JZGA 2IWEA 4GP4B 2BP8B 2IWKA 2OCCB 1J5CA 2Q5BA 2VW6A 1ADWA 3FS9A 1WA2X 2FQEA 1FWXA 1CURA 2FQGA 1NIAA 1QHQA 4NB7A 2EIKB 2RACA 2AVFA 1JERA 4KNSA 2H3XC 4KOBA 1AANA 1KDJA 3AY2A 2HXAA 1AZRA 1E67A 2N0MA 3L45A 1PCSA 4A2EA 1ET8A 1AZNA 1ZPUA 4DP7X 2TSBA 1AS8A 3ABMB 3MX0B 1AZUA 2YAPA 2XV2A 1NWPA 3QJSB 4W1TA 3NJHA 3DIVA 3V9EA 1E5YA 3HEIB 5I6MA 4HIPA 2CUAA 2J57A 2W8CA 2EIJB 3AG3B 3RYMA 2PLTA 3FU8A 3FPYA 1WS8A 2ZOOA 3BQVA 3CVDA 5AFAA 1IBYA 1AZBA 4DP1X 1NINA 3U25A 2Y1AA 2YAOA 2BW4A 1L9PA 4G7RB 2BZCA 2VSKB 4P5RA 2AFNA 2XXGA 1NPJA 4YSTA 1CYXA 4W9ZA 2NRDA 4F2FA 3UGEA 4A68A 1GS6X 4DPBX 3X1GA 5B1JA 4HHGA 5B1BB 3ASNB 5I26A 5I6NA 5TK4A 1BXVA 4WKXA 9PCYA 1MG2C 5B1JC 1ETJA 2X88A 1IBZA 2IWFA 1AR1B 1E30A 1NICA 2FT6A 2HRGA 5D4JA 3NJKA 4YSRA 1M56B 1KV7A 1RKRA 4FAAB 1L9TA 2BWIA 2I7OA 1MDAA 3FQ1A 4BDVB 4E9SA 1TEGA 2CJ3A 2QT6A 3AG1B 4PCYA 3EF4A 5B7EA 2FTAA 4DPAX 4JHUA 1PMYA 2I85A 3OQRA 1L9QA 1GSKA 4NERA 2GC4C 1IUZA 5B1AB 4WTQA 1AACA 4HCIA 1JVLA 3G5WA 2WSDA 1ZV2A 3GDCA 3S3DB 3TBCA 2QPDB 2J56A 2DV6A 2FT7A 5F7BA 4L0PB 1GY2A 2DY2A 2E86A 2YARA 2ZXWB 3CDZA 1OE2A 2EILB 3WNIA 1ILSA 2GIMA 3EH3B 1JXDA 1JZEA 1SNRA 1BYOA 3NJGA 3S3CB 3WKQA 2IH8A 4F2EA 3H4HA 4AZUA 5B1KA 1J9RA 1OV8A 1NIFA 4KOCA 4BK5C 1EZLA 2HRHA 2I7SA 3TA4D 1RZPA 2YAHA 3T6WA 1N68A 3PAVA 2H5UA 1JXFA 3NSDA 4GXFA 4A2FA 3T6XA 5I6LA 1A8ZA 4HCFA 1BAWA 2TSAA 4KO6A 1A4BA 4ENZA 1L9OA 2IDSA 3CVBA 2QPEB 3TASA 2UX7A 4QLWA 4E9QA 1NWOA 1J5DA 4Q89A 1JZHA 3QJTB 2QDWA 3JTBA 3S8GB 3S3BB 2XU9A 3AW5A 1KBWA 2UXGA 4YSCA 1E65A 3PXLA 2BHFA 3NP3A 3FQYA 4DP9X 3SBQA 1AG0A 1GW0A 3NSFA 6PAZA 3FYIB 4DPCX 2OV0A 1A4CA 1ZIBA 4MFHA 4RH4A 4GYBA 1IKOP 1V10A 4AI7A 4GP8B 1A4AA 1YLBB 1CC3A 1HAUA 1NIEA 1T5KA 2Q9OA 2PPFA 1JOIA 3FQ2A 1W6WA 2PP7A 4JKNA 4M3HA 3SBPA 2YAFA 3HB3B 2R7EB 2VW4A 1AQ8A 5EHFA 1FA4A 4TXVB 2PP8A 3TBBA 2XWZA 4M4RB 4YSQA 4A66A 4G70B 3NSYA 2YAEA 1DZ0A 3IEAA 1ASQA 1N70A 4X4KA 4DP0X 2XXFA 3T6VA 1PF3A 4HALA 5I6KA 1AAJA 2VMJA 3FSZA 2XLLA 4CSZA 5I5JA 1ET5A 4YL4A 1AS7A 2QDVA 4E9TA 2PCYA 1JZIA 2X87A 2GI0A 3UACA 4E9XA 2IDFA 3AG2B 3TU6A 4YVNA 2OJ1A 3ABGA 1BQRA 4G7SB 1OOWA 3EH4B 3GXUB 1HAWA 2UX6A 2ZWNA 1OE3A 1TU2A 1JZJA 4K9JA 1JXGA 5I6OA 3QJUB 4YSUA 4HAKA 5I5MA 1CYWA 1ZDSA 1ASOA 1NDTA 3ASOB 4GP5B 4YSOA 1BXAA 1SF5A 2PPCA 3OMIB 1VLXA 4A2HA 3NT0A 4N4YB 2BWDA 1ILUA 1M9WA 3NJLA 4DP8X 1L9SA 4UAHA 2YQBA 3PCYA 1NTDA 3UAEA 7PAZA 2FWLB 1SFHA 2JXMA 1BQKA 1I53A 1XB3A 4HCGA 1SF3A 2DWTA 3T71A 4KNUA 3QPKA 2PCFA 1ASPA 2UXVA 2PPDA 1J9QA 1J9TA 1OCZB 2YXWA 1WA0X 2PPEA 1OCRB 2YAQA 4EF3A 5B7FA 4G71B 5PCYA 3X1NA 3NJIA 3FSAA 3QJVB 1GY1A 3ZX1A 4KO5A 3N2JA 1NZRA 2DYSB 1PNCA 1KCWA 4YVUA 4BWTA 3EH5B 1AZCA 1RCYA 3SQRA 1PZCA 2BO0A 3IE9A 1PZBA 1SFDA 3QJQB 2IAAC 4BXSV 3WIAA 4HHWA 4DP6X 2GSMB 4YSSA 4YSPA 4DP5X 1URIA 1PLBA 3FU7A 1QLEB 2BP0B 1KGYE 3PPSA 1NIDA 3WI9A 2WO2B 3OMAB 3CG8A 4PAZA 4QKTA 4AKPA 2LLNA 1SHWA 2BW5A 3WG7B 3DTUB 1BQ5A 1CUOA 2P80D 4BWWA 4YSDA 2VN3A 3NJFA 3ZDWA 2CBPA 4E9RA 1PZAA 5PAZA 2IDTA 3OD3A 5LDUA 1ET7A 3X1EA 2XUWA 2AANA 2CCWA 2GB2A 3ZBMA 1J9SA 1KCBA 1EHKB 2HLEB 3WNJA 1L9RA 1FFTB 1NIBA 2J55A 1GS8A 1V55B 3SBRA 1OE1A 2GHZA 1OF0A 5A7EA 3WKPA 1BXUA 2JFCA 1AS6A 3PAUA 1W6LA 2YAMA 4UANA 3CVCA 4KO7A 5I5IA 4F7KA 5F7AA 4DP2X 1ID2A 3NP4A 1GYCA 1X9UA 2FJSA 2VW7A 3D12B 1X9RA 3JT2A 4N8UA 1KYAA 2YXVA 1AG6A 4Q8BA 3CZUB 2VM3A 4AX3A 2JKWA 3QJRB 8PAZA 5I28A 7PCYA 1V54B 2VM4A 5D4HA 3OMNB 1XMEB 2XYBA 2GBAA 3FPXA 2BP0A 6PCYA 2FT8A 3FSVA 3FU7B 1QNIA 1E5ZA 2XX0A 2AZAA 2XX1A 4KO9A 3IN2A 1OCOB 4NAJA 3N55A 2CALA 2XVBA 1A65A 3EHBB 3FYEB 1A3ZA 2AZUA 2WO3B 3X2QB 3UADA 2CAKA 2W88A 5AKRA 4BWUA 4AKOA 4YSAA 1R1CA 3UABA 2XV3A 2IDUA 2DWSA 5ANHA 3FSWA 3PLYA 3MBWB 2FNWA 4BXVA 1UATA 1XB6A 3V9CA 3NJNA 3NYKA 4YSEA 3S8FB 2Y69B 3IBOA 3DKHA 4E9YA 2ZONA 1KDIA 1JZFA 2IDQA 3H4FA 5AZUA 4CSPA 3ZIYA 4HZ1A 4FA7B 2BZ7A 3ABKB 3T6ZA 3X1BA 5E9NA 4GY4A 3NSCA 4UF7C 2FQFA 5TK2A 4ZK8A 1HFUA 3AZUA 1GR7A 3KW7A 3X1FA 2HX8A 5D4IA 4A67A 1TEFA 1MZZA 1SDDA 2GC7C 3ERXA 2HX9A 4JHVA 1PAZA 4AKQA 3BVDB 1MG3C 2H47C 4A2GA 2J5WA 2EIMB 3AG4B 3QQXA 5B3SB 2PPAA 1B3IA 3FU9A 1OCCB 2MTAA 3IN0A 1IC0A 4G7QB 2B3IA 3CDZB 1F56A 4E9WA 2HX7A 1BYPA 2FQDA 2BP8A
chains in the Genus database with same CATH superfamily
3HS8A 4QRFA 1UM6H 4KNTA 4KZ0A 3TH2T 5C0GA 1D2OA 5FIEA 4L8SC 4X50A 3UZVA 1KBVA 1R5VA 1QQDA 2JCCB 2MOGA 3GSUB 2F8OA 1WZ1H 1UT2A 4MD5B 4MMXC 4LSSL 2IWGA 4P9ML 4TMPA 1QBLL 2GQHA 2FJHB 3AQXA 3E80A 4B97A 3OB0K 3S3SA 4PWJA 3O8XB 3VFVB 2IALB 1HL4A 4ESKA 4U33A 4WFGD 1OGTB 3RTLA 2KBGA 3A4FA 2GUOB 3D2UA 3O41B 4IGBB 4Q52A 3OKLB 4Z95H 5LBVA 3NCFB 1TTCA 3M45A 2UXTA 1TZIB 1AOZA 3MRFB 3AAZA 2J3SA 5AKTA 4GJTB 2UXFA 4NRXA 2ATPA 4UOZA 3OKDA 1BA9A 3GYRA 3KWUA 3CXHK 3EYOA 1MQ8A 3ARDC 4GG8B 5D1XC 4BFGA 1GHFL 1KOAA 3BKCL 2IWKA 3VFSB 1KIPB 2VLJE 4XN8A 5DCCA 5EO1A 4ZUTB 3KM1A 1WFOA 5I0YA 4UOQA 4JVPA 4PJ5A 2WZ6A 4P2OB 1V7NL 2NY7L 2WZ0A 4WGKA 4ZRGA 4XP1H 2RACA 1Z6JT 4NJ9H 4PS8A 3K3QA 1EMTH 5DHYB 4NM8L 2WQAA 1E5CA 2CUHA 4L5FH 4XBGA 2VWEE 4K7PH 3EDDA 1O5PA 3HZKA 4N2EA 3RNKB 1AZRA 4AJVA 4NO2A 3QDME 3JTTB 4JZJC 3M7OA 1IAIL 5TDNB 3BIKA 5FYLD 1ET8A 2D2OA 4B9JA 3DECA 1RZ7L 1F0LA 4UTAA 3IMRA 2YAPA 5C3TA 5T1LD 3THML 1F86A 3F7LA 4K3HA 4QDGA 4Z7QF 2OMYA 4JM0A 4LPWA 3HMWL 1ZVNA 1QFWL 4HIPA 4H0LC 1G7QB 1JNLH 4X5WB 2Q3AA 5HDLA 2ZWYA 1RURL 5D7SL 2VXUL 4JL1A 3FU8A 1MIMH 1BVZA 5IMKB 1A1NB 4IKLA 5H8DA 4M00A 5DD3H 2ICWJ 2L7JA 3D0LB 3TCLA 4GSQA 3U25A 5IB3B 3FFDB 1HH6B 4NNXB 3SEPA 4Q2ZB 4JX0A 2DDQH 3EJJX 3GSVA 3LRLA 4JQVC 1RJYB 1UOVA 2ADIB 3A22A 3MJGX 4C54A 1XVSA 3FQRA 4Y5VA 4FXKC 1FO0B 2HKFH 3DMMC 5KVGH 4AMXA 5DGRA 4JRXD 2A6KA 1XR8B 2H2SC 4JN2B 3X1GA 2A9DA 5AW1B 3IDJB 3U2SA 1S9WA 5IF0A 2HMIC 5TK4A 4KZDH 1BD2B 5GS0H 2X28A 4OFQA 1EDHA 1IX2A 4JFFE 3VXTA 2VXSH 1F3RB 2RQ8A 4G1MA 3FTWA 3WY2A 2Q7YA 2QPUA 5C0RH 1VKXA 4X9FA 1ETA1 2PF6A 5DC0A 4BDVB 2WSPA 3B83A 1ZEAH 2P24A 2WN3A 2YA2A 4Y9GA 5F6HI 1LQSR 3KR3H 1UD8A 3GSNA 3WKMH 3MJ7A 1CPUA 4FNQA 4NRZA 2YRPA 3D30A 2HRPL 5TDPB 4PI2A 1ZEAL 4D8PB 3O6KL 3DTXB 5J11C 1MCCA 3MRMB 4HUXA 3UG5A 1MAJA 2VR4A 5EOCJ 4H1LB 4MDJB 1OD7A 5IFJB 2M26A 2P8MA 5E7BA 5KVEH 1MCPH 1WGOA 2DQHL 3U7YH 5F9WC 4XO9A 1M1XA 4J1UB 4LPCA 3AM8A 1CK0L 3LHAA 3UDWC 1K3ZA 3QCVH 3SE3A 3OLDA 4KKQA 4V33A 3HRZA 3VH8A 2XQYA 3RVXD 3GJEB 5E8NB 5KSAC 3ARXA 4URKA 1HJCA 2Z7WA 4FYTA 1IIKA 4XWOC 3KLLA 3H4HA 3QJHB 1QWHA 5AZ2H 4S1RH 5IW1B 3WTUA 4PHZA 3V5DA 2GK2A 2Y6SD 1OSEA 4OFPA 2X10A 1EZLA 4N24A 2I7SA 1NAMH 1NBZA 4FXGA 4MBRA 4YC2B 4KZEH 2I24N 3VGFA 5E2VH 4W81A 3WJLA 4JE4B 2YRBA 5DRWA 4I5BB 1BDYA 1GKOA 3RFZC 3UMTA 1DQJA 2HT3D 3N50A 5C0JA 5I1JH 1U3JA 2R29H 4MJ6A 4Q89A 1S5IH 3OHXA 3RIFF 4Y1SA 3SDXE 2IG2H 2BXYA 2WV3A 1HQ4A 3OJVC 1KBWA 3E6FA 2GVYA 1G9NL 2IAMC 2J4WL 2Y7OA 4HLJA 4MNHA 1N12A 4HS8H 2QKIC 4D3CL 3NSFA 2K3TA 3LQZA 2B0SH 4BGLA 1MRCH 4XMKH 1YQVL 3QUMB 4PJ8D 5EU3B 3CXFA 1HH9A 1SOSA 4FG6D 4PJCA 3MNWA 3NCCB 2EIDA 4ODTL 5GPRA 3T3PF 3IPBA 2B1HH 1NCOA 3WFCH 1UD2A 1K5NB 2QR0A 1UT1A 3GI9L 32C2A 4TNWF 3W2DL 3INOA 2VC2H 2DBLH 5HDBB 1ORSA 1QI3A 3H9YA 4HGWB 4MMZC 5IJVB 4TXVB 1TEYA 3ZTJH 3EG9B 4TSBL 3OHXC 4XBPB 2Z8WC 4Y8DC 1WTGT 5C6TH 1I9JH 1VERA 1I85A 1N70A 3CLWA 1S8DA 4X4KA 3BKJH 4XN4A 4WNQA 1I1FA 1CD1A 4ZNCD 2AQNA 5I6KA 2CIIB 1AKPA 1S4IA 2VMJA 3FSZA 5ITBL 1YYLH 3LEVH 5GGTL 4FQJL 4WJG3 1U3NA 5JHDE 1PZ5B 2OTPA 3OAZH 1V3MA 2XJKA 4HJJL 2OXGA 4JRYD 2GI0A 4L37A 1RZJH 5BQDA 3BX7C 3QFJA 4AH2B 3RZCD 3ARFC 3MV9B 3ULUE 2QQQA 4P3CL 4KTYA 2VXQA 2Z9TA 1T03L 5ICXB 3QDGB 4U6XA 3QWRD 4QKXB 4N1HB 4YSOA 1I4FB 3S97C 3HC3L 3D5OF 2ZE0A 2J1XA 4KMQA 3W2DH 3WHXA 2V7NB 3WIHH 2BVQB 1FVDA 4RGNB 2B1HL 3QC6X 1I4FA 2PXYB 4P5MA 4FQLL 3T2NH 4JFDB 4L23A 1ZS8B 3ORJA 4N22A 3UAEA 2D7TH 3KCPB 4L9LC 4PJAA 5CLYA 5EIIB 4A1RA 2Y6TE 3E8UH 1A1MB 2N1TE 3CPLA 1ECZA 4LHJB 1HYSD 3SPVA 5CJBA 2C9SA 3L1OL 2YQ2A 4FLHA 4NIKB 2VDNB 4ZUWB 3KPRE 3LS4L 3QFJB 2FECI 4UINL 3ZVVA 4UT9H 3FH8A 4Q58C 3DDFA 3UYPA 4E5XA 1EAOA 4QCIA 1RZGB 5KSVA 1DQIA 5ITFA 3DVFA 2PYFA 2YBRB 3RY6C 1TOXA 1NLBL 4KROB 1SYVB 4Z7OF 1GGTA 1MRFH 2QMKA 1E4WH 2C4XA 3B3IA 4N0UA 1C16B 3D09A 4NHUB 5J9PB 1MW2A 1QFUH 2XZCL 2V3FA 1H6EA 2O93L 3KPMA 4DEUA 5EDXA 4Y2OA 4DH2A 4X99A 2ZCKL 2DQUL 1B88A 5ACLA 3UO8B 1C12A 3PHOA 1HI6A 1PLBA 4OZGA 1WFIA 4J4PA 1A6AA 4EDWH 2OZ4L 3UJJL 4Z6AT 5A6IA 3LHPH 1LP9E 4N2HA 4PJEB 5EZLB 3KXFA 2ENSA 5I6XB 3KPPA 3FTGA 2HTLD 3RL2A 4XPBH 3EUUA 4PJCB 12E8L 5TE7L 4BFFA 1XH3B 4LGPB 4V1DE 1CUOA 1Z0MA 3WXWL 5DHYA 4PLNC 1KB5A 4AJWA 1S6NA 3O2WL 4GUQA 2WK2A 4WWKD 4JPVH 2PCPA 1KCRL 4PY7A 5CD3A 4WO4D 2PR4L 4IHBA 2WXQA 2K1MA 5A1AA 5DQJB 4LRIA 3HCVA 1OANA 2O5ZL 3FN9A 1THAA 1PKQA 1GS8A 4RAVB 1PY4A 2GK0B 3BW9A 4A38A 2P46B 5H94B 2DW5A 3GKWH 1UXLA 5JORB 1Q9KA 1W6LA 4ETQB 2DLHA 2VDOH 2N1KA 3LKSA 4FFYA 3UAJA 3LEVL 3FT3A 2Y7QB 4Z7UA 1RULL 5JHLL 1BQLH 3APMA 3UAJC 3U0TA 4XMXA 5JDSA 4LKCB 4ZX5A 2X4TB 4POYA 4GKNB 5JHDD 4C4UA 5BUGA 1FGNH 3BN3B 5I15L 4U6YB 4EO5A 4GXUN 2H1LM 4JG9A 1MF2H 2EIEA 3QJXA 1JUFB 4Z7QB 2QEJA 5DVNA 5GJSH 1KTDA 3CFCL 1HI6B 4U3XA 2DDQL 4TPRL 3MUUA 1T04B 2XX0A 4X9GA 3BWAA 4G11A 3LCYA 2DQFA 3QNZB 1GTFA 1XHHA 4YHYC 3HLAB 2CALA 4KJPD 1L0PA 4FNUA 4MNQD 3VRJA 2LAGB 3O2VL 4Y16C 3M17B 4QRUA 4OFIA 3FYEB 1A3ZA 3T08A 3BPCB 2YZ8A 5C2BH 2J8UB 4ICXA 2P8MB 1ZMYA 5AKRA 4PP2A 1DJXA 3R7QA 3GNML 3FZUD 3VRIA 1R1CA 3ARBB 2XV6B 1HHKA 2CZNA 1KUMA 1G9NH 1IC5L 3MHZA 4PY8J 3ZHNA 4KRPD 3VG0H 4IOFD 4YSEA 3S8FB 2AJ3A 3UPRA 4F8NA 3UIYA 4IU3A 1UM4H 5K1VA 4ZUWA 4F5CA 3L3JB 5I1HH 3NSCA 2ATAA 1TQBC 1IFGA 3MYJB 4JCWA 2HX8A 2PTTA 4OGYH 4KX9A 1RXLA 4RCAA 1CFSB 1T2JA 4EI5B 5LNGA 1ZGLP 4JHVA 4CW1A 3LZLA 5C6PB 1HS6A 4JMXA 3PDOA 4PM1A 4UIMA 1MW3A 3RY6A 1BVKB 3QEGH 4AW7A 1QSZA 4JFEE 4S1QL 4ZFZB 3F6IA 4G9FA 4GUPB 2LTQB 4OI9A 3OR7A 4MNQA 3LDBB 4I9WE 4K71C 2X3CA 2VDLB 4M61A 3Q8AA 4IQHA 4XMLH 4N20A 1DQVA 3OJDA 3UGUA 2F7RA 2FLMA 4G1EB 5IB3A 4PRPB 1IQDB 2PP9A 1J1PL 4ZUVB 3H85A 4QD2E 5EBGA 1XSIA 1JD9A 5IBUB 3FONA 3L5XL 4ZO8A 2VMEA 5DZNA 3ISRA 2D7QA 3SDCA 3PNWB 1FIGL 5DJ0A 5HTSA 2WBXA 3AREB 3NRQA 1IC1A 1UQSA 3VXMA 1ZA3B 3I9IA 5HD8D 1T1ZA 2Y3AA 3GD1C 3UAJD 2BDNL 4OLUL 3D0LA 3ECQA 1YYML 5F1OB 4PY7B 4XMUA 2J12B 4V1DB 5EIIA 2E7HA 4CU7A 1KTRL 4RVBA 3HG1A 5DMIL 3M1BA 3CFUA 5BPPA 3ABLB 4P59H 2XKSA 1RHHA 1MY5A 1F6FB 1FNSH 1WCBA 1T66D 3HNVL 3EW3B 5TE6L 1IKFL 4GOSA 1JRHH 3FQXB 5LCVH 4R0LC 2R69L 3ROLB 1X4ZA 5J6SA 5IROD 4TLSA 4RMSA 5JO5A 2WKOA 3WTSA 3HRZC 1WITA 5ANME 3ZHDA 2WWOA 2HTKC 5B38G 1R3KA 3H9ZA 5CMAB 1VRSA 3PG2A 2C34A 2WC7A 1PY9A 5T3XE 3QH3A 2OR9H 1I85C 5D7JC 4G80B 2DQTH 2OFQA 3X13A 1E4XL 4NHCL 5H35B 1JNHA 2FDBP 43C9B 3QZWA 4DF9A 3VI3A 2DQ6A 4A2EA 2EUWA 1U95A 3B9KC 3CLEH 2YQGA 3MRRA 3LRKA 3O6FB 5F8RC 3FQTA 4ADGA 3N0AA 2P1YA 5KW9L 3DRQB 4ZD3L 4N68A 1WD9A 5L8KB 1UFGA 4OD3L 1U3HD 1ZCRA 2YRLA 2HWZH 2V3DA 4X7CC 3HEIB 4CVUA 5F1SA 4K94C 3SHSA 2VZ3A 2NDGA 4W4OA 4X8XA 1QFWH 1YC7A 2X5PA 5FUZL 3NDZE 5BS0B 1U3ZA 4PUBH 2DWXA 4X5RA 3MRFA 1B6UA 2FZ3A 3D3VD 2VH5H 3D9AH 3ARGD 5FV1L 3P1VA 2NSXA 4S1SL 2P47B 1BFVH 2WGNB 4UQ2A 1NBYA 3SGDH 3IJ9A 5IQ9A 4W9ZA 3MRHA 2AI0H 4NM8H 2XA3A 1DQQB 3QDGE 1E9QB 5G4NA 5I66B 3JWNC 2VLRB 1FFOB 1XF5B 4AVHA 2R29A 2F68X 2ZJSL 3A67L 2R2EA 3D6GA 2QSCH 4QIRA 2V8MA 4MYWB 3C5JA 2BWIA 3K8KA 4HJUA 3RBSA 2DLFL 3VTAA 5IREA 3AJ7A 2YQ3A 4R8WH 5BZDB 5EBWB 1DJZA 5B7EA 3WD5L 1JZ7A 1ZT7B 1BV8A 3L48A 1NLDL 3ZXAC 4KROC 3GBML 5CUSL 5ACZA 2APWA 3DX2A 3FT2A 3HNTL 5IR1A 1II4E 5ILTH 1FG2B 1PZ2A 4IIZA 5B3JE 1AHMA 5J56B 2X4NB 1R3LA 3W9DA 4ZMYA 1LO2H 1JVLA 3NZUA 4WHCA 2KLSA 1IGJA 2QVFB 2WP3T 4HW6A 1CIDA 2P5WB 4U3SB 3ARDB 5D1XB 2VITB 3QAZC 5T5NF 1LD9B 3IPEA 5L7XL 2GABA 4FRWA 1AGCA 3JWDH 1BZ9B 5ADOL 4KXCA 4B9IA 4XZUB 1GGBL 4GXVH 3TZVA 3T0DA 2P5EB 5HDBF 3TOPA 15C8H 2Q10A 2P7TA 3QI9A 2VC2B 4OBSA 2GG1A 2FSDA 3CQQA 3T6WA 3BUPA 2EEBA 5HJDA 4WGVB 4NLHA 3TESA 4PVLA 4CMMA 4K3EH 2J6EA 3GEWB 1PBYA 2P5EE 4Y1TA 5KANG 3D0VA 5T3ZH 4M9PA 5HI4C 1ZXQA 1A4BA 2GJZB 1I7RA 3L8QA 5D7IA 5MEQB 2QPEB 3ZLQC 4NGHH 4DVBB 5C70A 1E4JA 1JRHI 3LPGA 4NZRH 3KJ4C 2N4IA 1U8OA 3X3FL 3TEYA 1IFHL 3PXLA 5IVXB 1G0XA 1D7BA 1V27A 5TDNA 4HS6B 4DKEH 3ME0B 1OHZA 3FYIB 2H6UA 5K9QI 2YGOA 1KPVA 2ADJB 1IM9D 1I8IA 2YMTA 3DX1A 4N1EA 3BAIA 4R97C 5A6LA 1FL5B 2VDQH 3RDTD 2ZWZA 2Z31B 2G5BA 4M1CD 2HLAB 1CICB 5EPMB 2PPFA 4J7RA 4XPAH 3V95A 4PP2B 5A40E 1J8HB 3DMMB 3QI9D 1UA6H 4QOKB 3TC9A 1Y1DA 3ZHKA 3K72B 2R7EB 4DZ8A 1SM3L 3RZWA 3TO4C 4DUXA 3T2QA 3UPCA 2ZP0T 2PP8A 1TUPA 1MH5A 3HVDA 3VD7A 3MRKB 1Q9OB 2OM5A 2WLIA 2Y24A 5F7MC 1GYUA 3IEAA 5FAAA 3U9UA 3JQOB 5AUMB 5IMMA 4ZDHA 3KPLB 4QHNA 1U0QA 1Q9WB 5I30L 5ESVA 3HN3A 3OQ3B 3P0YL 2E7LA 2OJEB 3VGHA 3APNA 2CHWA 3LKRB 1WHPA 4JY6A 1I1YA 2PYFB 4YXKH 3MC0A 1TETH 2QDVA 2XQYK 2A83A 5FDWB 4R2GB 1QG3A 1CR9L 1IVLA 5J6HA 2R0WL 3GBEA 3TJEL 3WN6A 3TT1H 4WW2F 1FZMA 4LCIL 1ETB1 4ERSH 4QI3A 3QUXC 3BZEA 3BP4B 2E59A 3GMPB 1XF3B 3FKUS 4KTEL 2I9LA 3O81A 3ILPB 4OZ4B 4PB9L 5GGQL 2CXKA 2D3LA 4FNLL 1JAEA 4RZKA 3HS0B 3N1QC 1KWKA 4RMWA 4FQ2H 3RWCB 4DP8X 3T6QC 3EIFA 2JQMA 3OWRA 2W0FB 3TEUA 4O00A 3U6RA 3EYFB 5DZPA 4K5PA 4PQXA 3WEMA 5L2KD 1C5DB 3L16A 1Q72L 4K94L 4NN6B 4TTDD 3W9EB 1BM3H 2FJFA 1NCGA 2IPTL 5AVQB 4WEBH 3VQMA 4NZJA 3KYKL 2HVKA 3JVFC 4HZLB 4CNIB 3TA3A 4P2QA 3V0HA 5FB8A 3IJ8A 4N2DA 3DIFB 3ESMA 1ZK9A 4P99A 2YAQA 3ULAB 5B7FA 2EVIA 5PCYA 3FTXA 4DJMA 3FSAA 2BOCA 4O4YH 3T4YB 1NZRA 4XC3L 2EDQA 1QUNA 5HJ3B 3KYMB 4PJ9D 4AQAB 2A1WL 2DLIA 1GYAA 4NKMA 1XGZA 3S36L 4P5TB 3T4YA 1KXHA 2ADGB 4OLUH 2X2HA 2VDOB 4NQVB 3GIVB 2YLKA 1XD0A 4IIQC 1MVUB 4M5TA 4BKLB 4HWNA 3CFCH 3QZLA 4QCIB 3RKDC 1YPZE 2FCBA 3IWVA 3OPZL 1MNNA 3LZNA 4HIHB 2BZDA 3SGJC 5E99L 3T4AB 3V6OC 1FBIL 1QP1A 1YNLL 3O3DB 2WO2B 2XQBH 3WAJA 3B2UD 1NMAL 1FFNA 4OT1L 5AW6B 3UCQA 5EU3A 3T8VA 2J20A 3MYJA 4L3AA 3IFNL 1IAOB 5DUPL 4QJ5B 2FBJH 2VRAA 3RWCA 2WINA 3RDTA 1KBPA 4ORZC 1SEQH 3MV8A 2CBPA 4S10A 5CJQH 2BLFA 2DB8A 3T5WA 5AB2A 3LQAH 1QD0A 1RSYA 2X41A 3O6FC 1IC4L 3IXTB 4A7UA 1DJGA 2GB2A 1DBAH 1K4CB 3JV5A 1WGVA 3OKLA 1P5UA 3VWKC 1XMWA 4U2YA 1IAMA 3G08B 3SBRA 3GMPA 1HZHH 2P9RA 2D9QB 3FQUB 5EN2B 2FIKB 5T1DL 1HNYA 4UZSA 1KCRH 3D87B 4D7BA 3QIBD 1QA9A 4L0YA 3NP4A 1HSAA 2A73B 2F19L 2FJSA 1KYAA 4K3JH 3ULUC 2FBOJ 5D1ZC 5DR5H 3HG4A 2WIMA 3IDYC 4AX3A 4GIPD 3OG6B 2K8MA 1IC5H 1MFUA 3CZSA 3KVQA 5GJTH 3RIAK 3VTMA 3W39A 1SHMA 3HNSL 4X0KA 2KUTA 5GGVY 5C8JA 4Y4KA 3RX9A 4LLWB 1A4JA 3FPXA 3UIZA 4HJ1A 2E5EA 3LMJL 4GRLC 4X0KB 4K9EC 2XN9D 3AUVA 4TLKA 4AT6A 4LPXA 3VRJB 3AC0A 2K6YA 2K7QA 4FL4C 3N55A 1SVZA 3VGAB 1MCWM 2APSA 1WYJA 5BOJA 3K1KC 4OW6A 3UFIA 3TS8A 1HYRC 1FV1A 2G4GA 2VDLH 3UADA 1TVBB 4JFYB 4R96A 3V0VA 4TVPD 5DD1H 3F12B 3CFMA 3FB8A 4Y19B 3V8CA 4PJ6A 5DRZB 3RGHA 1HYSC 4Z7WF 1ZHNB 4KXDA 1CVRA 4PIBA 3L3KA 3PLYA 2NY1D 4XAWL 5JIPA 1TYEB 2TRHA 3AT8A 4QJ4B 2WTPA 1IEHA 1TNMA 4PS3A 2ZONA 2ITCB 4AGMA 2XVKA 1YUHB 2IDQA 3HG1B 4Y9BA 2WCPA 3DJTA 4FA7B 1SY6A 1QHOA 3SDYL 5I24A 4P3WA 3HBPA 3VG9B 4D0BA 3UJIL 4P4KB 1G6RH 2VQ1B 2VR6A 3DK0A 3TA3C 1HESA 4DOHE 4QRRE 4GLRI 1AI1H 2FJGA 3TH4T 4JN2A 2O5ZH 3DC0A 4N8CH 3AG4B 5GSVB 3ALPA 3PWPA 5IP4A 1YJDH 1CL7I 1WWAX 4TUKL 4E9WA 1BYPA 3UCRA 4JFQB 4X5XB 2GIXA 4JO2L 4M7ZB 3KLHC 1P7KA 5IIEA 3O8XD 4R7VA 1AC0A 1DVTA 1YMMD 1YY9C 2YHGA 2R23A 3K80A 4KX7A 1M57B 3VXPB 1GPOH 3GMRB 3MLWH 5DJ2B 5HYJE 1YEFH 2BIMA 5FX3A 5AAPA 3ARPA 3EFFA 3PDOB 1NPNA 3QK0A 1JHTB 2EICA 4QXUH 4A6YL 3PAZA 4XNMA 3BQUB 2AAVA 2MRYA 1HEHC 4NCC2 4FFWD 1JPTL 5IHHA 1KN4L 3CFKB 3P9WB 5F7FA 5A2KH 1WA1X 2VSMB 4DTGL 3HRPA 2QVTA 4DETA 1UM5L 3F2LA 4I18C 4BUQA 1U8QB 5JXAH 4ZUSA 1WS7A 3FRUB 3SJVD 1HKLL 2P49B 4OTXL 4QRAA 5EN2A 3LTVA 4JJ5B 3RY4A 4EE2A 4P2OD 4BA8A 4FNSA 2BP8B 5D7LA 4HK3N 4HSQA 4F2MA 1T83A 2F2HA 2YA0A 2ICEA 2AK4A 1BFOA 1ADWA 4HV8B 2YMOA 4HPOL 4WWKA 3ZKNC 3U2IA 1FCCA 2YSSB 5F9WB 1DQML 2EEFA 4NB7A 3ZDZF 2CMRL 2KH2B 2QLVB 2X44D 3KPQB 4BCXA 1R17A 1R3HA 2ZOWA 1TYJA 3SE9H 3RG1C 4NUMA 3ROOA 4XOAA 2H3XC 3KXFD 1LNUA 2WNWA 3MLYH 1ETZB 4KTGA 3JZ7A 2CDFA 2VB5A 3P30L 2FZ3B 2Z65C 1DEDA 1MLCA 2O72A 4OM1L 5CXPA 2WWMD 2FX7H 1D5MA 3ZDXF 5FO7A 1I9RL 4Z7UE 3G3LA 1OK8A 3MX0B 1X5FA 4Y1AE 4YXLH 3WEBA 5E0FA 4PWKA 1ND0A 3DIVA 1S9YB 3ARBC 3BEWB 5DUJA 3CD4A 1WBYA 4B3EA 1E9PB 5CCKH 2WO4A 2WJ5A 5K9KA 1JG9A 4OCYL 5KBPA 3ECWA 1CDGA 4OB5H 2ICWB 2DQEH 1I1FB 2NMSA 1JPFB 1OSYA 2A9CA 1HZHL 1NC2D 1HX0A 4X6DA 1UWGL 1CLOH 3QDMD 1QUNB 1UM5H 3ZQWA 4NQDE 1X7SA 4N2KA 4NKDA 2ZXCA 4MAZA 5JW4N 3AXHA 5CS7A 4KHXH 1XGPA 5CSBA 4HJJH 4P5RA 3PNRB 1ZS2A 4LQFH 2D0HA 4EI5C 4NT6B 1CTMA 1NPJA 4MJIB 3ARSA 3PHAA 4XPGL 1GS6X 3EDKA 3I9AA 2NX5E 1HWWA 4HHGA 3P2DA 2XBZA 3W1ZA 2G2RA 3TVMC 1JF5A 3LDBC 3LN4A 4Y4FD 5EF0A 4NQEE 5JXEC 1RHHB 2CPCA 4OQTH 2IWFA 1SMOA 1KPVB 2HRGA 4JDEB 1TZHB 4KKCD 4JDVA 4LPUA 5TE4L 4MMZB 1RLBA 2VC2L 4N9OB 1PFCA 3GSWA 3PABB 4AIEA 1FRGH 5L2JA 1DBKL 4ACPA 1GJWA 3UXFA 4HJTA 5IQOA 3BFWA 5I2IA 2XY1A 1IUZA 2BNRB 4ZPTB 3WCYA 1NANH 1UJ3B 4YXHL 4TVPH 4FD0A 1IAII 2X12A 3IDNB 2J56A 5JXEA 2QKSA 2GAZB 3E38A 2DY2A 1T3FA 2V9UA 4JY6B 1YRKA 2ZXWB 1PG7W 3MRLA 4AIZA 4G9FB 1T0NB 5KS9A 4Z7QE 3WKQA 2YEZB 1WISA 2OJZH 3D25B 4GS7B 2W07A 4XX1G 5B1KA 2I60L 3B6SA 2WLIB 1ZANL 2NW3B 1PPIA 2QADB 3BESR 3CH1B 4MKTA 5C09B 1QSFA 4BK5C 3DA0A 2HRHA 1MH5B 3Q01A 3TA4D 4YAQA 1KYFA 2CDGB 5JR1L 5IW6B 4LHUA 4ZFFB 5EOCL 2OKMA 3NSDA 4GXFA 4XH2A 5J4MA 1KZQA 4A2FA 1EEYA 2PXYC 5IFJA 3TPUA 2Z7ZA 2MOQA 2V7NA 1HCVA 1K2DB 5I71B 1A7OH 1BJ1H 2FLRT 5D93C 3QDJE 1E3ZA 3GHEH 4W70A 3RPBA 4X6CA 1GW6A 3TASA 4R5TA 4J6IA 1G7MA 3BCFA 3TO4D 3BT0A 3B56A 3S8GB 1G7IB 2A6IB 4LCUA 2VISB 1NAMA 4V11A 1HXYB 3D39B 3FQYA 2ZP8A 2X2JA 3ZZLA 4WI8A 2A9AA 3L3GB 4MNGB 2WYIA 3VXRD 4MFHA 2EDKA 2AERT 3QCTH 1A6TB 2VIRB 4X4MA 2X7LA 2D7NA 3HE7B 2HRPH 1SYSA 3FAXA 2CBOA 1IBFA 3HI5H 4UT7H 5ABZA 2GJZA 2IANE 1EJ8A 1JGDB 4ZTPL 1HINL 1YEJH 5EZPA 3D52A 3A24A 3FMGH 4DO6A 4M3HA 5CLZA 3LKNB 2BOBB 2BY1A 1FI8C 1X5YA 2ZX8A 5L6YL 3C6LB 1PZUB 4WEEA 4N5UA 2W9DH 3R19A 4KGJA 1EJ6A 1VIWA 3LKOA 4KZDL 4P9HL 1KZYA 1KCUL 5F9AC 1I9IH 1OAXL 4DP0X 2BNRA 3PPEA 2A6KB 3EJTA 4XZUA 4XVUC 5AVYB 4AYEC 3FAWA 4RIRB 3NMEA 5GGVH 3EYUL 4D9LH 3QISA 5I5JA 3WFEH 4AMKH 2MHAA 1J48A 1HH9B 1OLZA 5ICZA 5BQ7A 5JDSB 1SXZA 5LWYH 4MSWA 3F7PC 3W9DB 3KYMA 1CLYL 2R1YA 3GXUB 5IJCC 3BAEL 2ODIA 1S9XB 5EOQL 2ITCA 5FW8A 5ISZD 2ZOLB 4OB5L 3RWIA 5E5LA 4DKFL 5T3ZL 1PX4A 2MWCA 3VI3E 5HVFB 4XCCL 3V7AG 1BSIA 3CAFA 3QEUA 1VFAB 5KS9E 1TENA 1TJXA 1VACB 4DO5A 2DQGH 2IPKB 4NNYA 4ODVL 5KVFH 1T5WB 4Q4EA 4YWGH 1ACCA 1EA9C 2DJUA 2LR4A 3P4MB 4XVTH 3H3PH 2OX5B 1SLXA 3HZYA 4KH9A 4POZD 5JOPD 1O0VA 3SE3C 3VUAA 5MEOB 3I2CL 1FFOA 3GSNH 4YK4B 3T77B 5FCUL 3L3OA 4LARH 4XBGB 1U8CA 2C8NA 4LP4A 3VXSE 5ADOH 1EDQA 4LLUB 4PJDE 3HBZA 5DU7A 1RUPL 3HG5A 3CZGA 1JHLL 5AW7B 4YUEL 5JW3L 1PS3A 4HCGA 1SF3A 5T3XL 3TBSB 5BRZE 3CHPA 1ZLWH 1AR1C 3VAEA 1J9TA 1M71A 4Q7DA 1BIIA 1GIGL 5DURD 1A7PL 1ND0B 4FNRA 3Q2LA 4DGUA 3G7TA 3FB6B 2JK5A 3DO3A 3PE9A 1NBVH 3GS0A 3MLTA 4GXUM 2OSLB 3MRQA 4XI5D 1QSEB 3ASWA 3CDYA 1JDCA 3AXIA 1WT5C 2H6OA 4ODWA 3Q9QA 1OAJA 3U0WL 3EXJA 4WUUB 4GBXD 1KN4H 4HC1H 4XPHL 3VACA 1Z5HA 2JJVA 4HHWA 4YH6A 3RHWK 1J5HA 2EE3A 4UV7H 2PXYA 2OMZB 4FA6A 1URIA 1K4CA 4YHOL 5LLIC 3OR7B 1VFBA 3TNNA 3GHBL 2UWEF 3ESOA 4QHLA 3T2PA 4PJGF 3GB7B 4F8QA 1MCKA 4LASL 1VB9A 5IMOA 2F8XC 2ICEB 4LK4A 3ZSTA 1OAZL 4ZSOB 1SYSB 1FN4A 3UEQA 3VXOB 4AEEA 3IXAB 4PD4J 2ZKMX 1IAOA 1Z9MA 4M5ZL 3SO5A 1TZOA 4TN9A 1MDTA 5INDA 1HT6A 2ADFL 2BVUA 1R3HB 3IDJA 3REVA 5SWQA 5CLXA 2E9IA 4PJIA 4YHZH 4U1IB 5JO5B 3WL9B 1CGTA 5FKPB 4ZSOE 2NUPB 1INEL 1J9SA 4KJQC 1S7QA 1L9RA 1T20A 1JYXA 3GSRA 3ZE1F 4ZYKA 7FABL 4BYHA 3LRGA 5EORL 5LGYA 1ZLUK 1H8SA 4MQ7A 4QRPD 4LEXL 4IK7A 3BMWA 4AUJA 5SWZD 3RFZB 4FADA 3NTCL 4EPSA 3TBVB 3PV7A 2Q87A 1AG6A 4Q8BA 1S3KH 4NZRL 5EUOF 3DV4A 3BISA 5T3XH 1MJ8L 1NKGA 2FVNA 3O3BA 2OR7A 3BH9A 5D7IB 3Q8CA 3O6LL 4AQEB 4ZXBA 5MEQA 1SBSH 4NZUH 2DWEB 4DN4L 4N6RB 1NFDA 2JQZA 2DWDA 3PWPB 1HE7A 2QFPA 3GSNL 1L7IH 1GSMA 1KT2A 2Y36L 3QEUB 5SWSE 2JWYA 5A2JH 5FYLH 3U6RB 3H55A 1GCFA 4A37A 1ZRUA 5ADPL 4TVPE 2Q7NA 3GEFA 1DBML 1INQB 5IBTH 2W95A 3QUGA 4XOBA 3HNVH 5D2NC 1A3RL 1HEZA 2H8PA 3ATBA 3MBED 1U41A 4PLKC 1DE4A 3CC5B 4XNYH 2XV3A 1FJ1B 3IRCA 4FNTA 4YIQB 5DVKA 4X4ZA 3ZDZB 2R51A 3BP5B 4Y4FA 5HY9B 3P3SA 5JHMA 1NEZA 1J05A 3OHMB 4OF5A 3NCXA 3I84A 4NQSA 2MH4A 1H0DB 4OLVL 3WTWA 4PREA 1KG0B 3I02B 3CSTA 1TTFA 3QW9A 4GY4A 4UILL 4LVOB 4IBUA 2A9MH 3GIZL 1JGEB 3LAFA 4IU3B 3AZUA 1HHHB 5FGSA 1HQ4B 4M93C 4WWID 3X1FA 4ELKA 1R46A 4A67A 4LVHB 3UTSB 1NLDH 1TXKA 3P2TA 4KMTL 4F15C 3GMOB 4LCWD 3FBQA 4PRDA 2MCG1 3HR5A 5GS2H 1PZSA 2D3VA 4KFZC 4A2GA 1A7BA 4RMRA 1TIUA 3KNBB 4ZS7L 4UQCA 5KYYB 4F3FA 1OALA 4O02A 4JFVA 1CD0A 2DM2A 4OLEA 4WI4A 1YYCA 1N59A 4GS7C 4JB9L 5FECA 5I74C 2VL5B 5C07B 2JI2A 2QADC 3SDXF 2BNQB 1C7SA 4YDVA 4ABQA 1JN6A 4ZJ9A 3LNIA 4AT6B 2R4SH 1LHZA 1ZT4B 4YHNB 1T04A 3VB9A 5DJZB 2EABA 4RGNC 3RFZA 3C5XA 4YX2L 4XXDB 3B34A 1RJCA 4LCCA 4NN5C 4LLWA 4YGVA 2C9VA 4K73A 5E99H 4ZBJA 3K5SA 3GXFA 4MCZB 2IH9A 3CVHA 4AC4A 2CCVA 4L9LB 3OBAA 2XNAA 2XZQH 2R4RH 1KGUA 2NCEA 3UTSA 3IDUA 3NGBB 1K6QL 4E5XB 1FZKB 5SWZA 5BW7C 1OTUC 4WFFE 1RIVL 3T0XA 1EO7A 3RAJH 2VABB 4FF9A 3MA7B 3EDEA 1HSAB 2A73A 3OL2A 4NIYE 4LBEB 3SE8H 4AITA 4MNGE 4MWFA 4PRIB 2PTVA 1MZYA 1TQTA 2H41A 3UTTB 1XH1A 1J0KA 4XO4A 2VERA 1SHXA 1SJHA 2J72A 3TEXA 2CLZB 35C8H 1O6VA 1MUJB 3MGTB 1WF5A 4FLOA 3IDYB 2X4PA 3Q5OA 3C8DA 4DK3A 3V5KB 4XBEL 1VGKA 4MQSB 1P4LA 2EIKB 4XP5H 3B9KD 4NZFA 4PJEF 3RVXC 5DHMC 2AVGA 4KXZI 1WBZB 2J88L 4YBQC 1NDGB 4JBSA 4I0PA 1ZLSH 4BQ6A 2Q8BL 3KLQA 4KJQD 5GS0D 4I77L 5HHNB 4MZRA 3IU4L 4ZUSB 3VQLA 4DK6A 4F58L 5D2LE 1RSFA 3V4PB 1UH2A 3RVTC 4CDHA 4PJFB 1AZNA 4WFFD 3ULUF 2D31A 5I0XA 4QRTB 3L95A 3FK3A 4IRZH 3RDTC 4PJBF 4QAMB 3TO2B 1GL4B 3L4YA 5ICYB 3DIDA 5JMRA 1XXFC 2ZAHA 5D8JL 2W8CA 5DJXA 2Z7UA 2H32H 1MCDA 4H26B 3FQWA 4N0FB 3BQVA 1FNEB 3BD4A 3M07A 2WN2A 3QIBC 3DXAE 5CO1A 1QW9A 4ZUUB 1HDMA 4H26A 4PJXA 1UZ6F 3RAJL 2X6CA 3MODL 4LZKA 4ZFGH 5D7JD 1OAUH 3VYNA 2VSKB 1HILB 5C0AB 1HK6A 4FQQA 5CJXA 5D4QA 4I85A 1AQHA 3VW3L 1OSPH 3ZL4L 3CMOL 1AQDA 1MJ7L 3B7UX 3E8VA 4UDUB 2NLJB 3WFHB 3QORB 5D1ZA 1U2CA 4PV1C 1D5IL 3VGGA 3AQDA 4NI3A 1G7JA 3AFLA 5I26A 4PSPA 3DBXA 2EKSB 5MERA 2K8QA 3AS0A 4TLTA 1LM8V 3RU8L 9PCYA 1ETJA 3S8WA 5HYQA 1RAMA 2WYHA 1FDLL 5E23A 3AWGA 5AG9A 2G3XA 5AYUL 1K4DB 3CSFA 2P45B 4KI5C 2VERN 2MPAH 4MZ2A 5EZJA 3PFQA 2MCAA 5AW2B 4PB0L 4GEJA 2IFFH 1GJIA 2V2TB 2LU4A 3FT1A 3EF4A 1E42A 2YN5A 4C57C 1QFUL 3JVGA 3MLUL 4OZHF 3WIHA 5BXFB 4Y4HD 3VSQA 3CTTA 1FAIL 1SLUA 3KLKA 3GC3A 2I69A 3L3DA 4JG1H 4XXDA 1YEEH 2R2BA 1KIQB 4TNGA 4GAAA 3F5WA 5I19H 4X6EB 1VFUA 2EO9A 3PDDA 3T0EC 5FGBC 5K5YA 1P9MA 2W65A 1IFHH 1N7MH 3RPKA 4ELDA 3QO1B 5T1KB 2ISDA 3RP1A 2E6QA 5E9DB 1UYWL 3QPXL 1CD8A 2MMXA 4FHJA 1F2XK 1WZAA 2JELL 2WNGA 4ZT1A 5LGHL 2FX7L 5FCSH 4X6DE 4JJHA 5CFHA 4GAYA 5F9OL 4MAYA 4ORGB 1C1EH 1G9MC 3DX3A 3KPNA 1JFHA 2W9LA 1YAIA 5TGBA 4GAYB 4Z78B 2A2QT 5JUEH 2ZXEB 4NO3A 5BZWB 3T2NL 5K9OA 1XSJA 1N5YH 4BD4A 1NIFA 3HC4H 4MJ5A 4ZQKA 3EG9A 4XBPA 3OAYK 3V6FB 5JQ6H 1F1DA 2DQCH 2W1NA 3S37L 3SGKA 4BFIA 3L3HA 5FYLE 3CMGA 4RESB 2VN4A 5FHAL 4BCZA 4MAUL 4FHKA 1MFDH 3FCBA 5I6LA 2CO1A 1JGUH 5KAQF 4XRCA 1NJ9A 5F0LB 4N3TA 4FC3E 1DUYA 3AREC 3UYOD 2ORBL 1FGNL 1FJ1A 3QUXD 1WIOA 3ML9A 3SKNA 3V6OA 1YECL 3VXRE 2F5AH 1R3JB 3D2UD 4GNKB 2ZCHL 1BCIA 1MRDH 3B7RL 3VH8G 4FZEH 2LV4A 2VM9A 4MJIE 2R23B 4AMKL 2GJ6D 3BSZA 3HPJB 5EO9A 2H6PB 3CBJB 2YS4A 1CFVH 2ZYIA 1NGQL 4EI6B 5HYQB 2O61A 4JO3L 3L7FA 2P7TB 4W93A 4FFYH 5J5EA 1NCWH 5GGTA 4XNZC 2UUDH 4R0LB 4O51A 4F93B 3BGAA 4P2RE 4YE4H 2ZPKH 4JKNA 3ULSB 3ZIMA 1QSFD 1EZVY 3SY0B 1IGML 3IJ7A 3IAPA 4WEMB 2UVFA 1UD6A 4YDNA 2VR3A 3TBBA 5EEWA 3RLSA 3VM5A 4DGYL 4I9XA 2BC4B 1XF2A 1ZA6B 3GXIA 4JUTA 5M94B 1IJNA 2LFEA 3GBNH 3OKYA 1JF6A 2XOTA 1R3JA 4IGBD 3Q6GL 2AEWA 1A6AB 4YBLB 3RJQB 3ZY7A 3R0MA 4YL4A 1QRNE 4KAQL 1JPST 3B1UA 4R3SA 3ZKQD 2YPKA 5HJGA 5BRZD 5JOPE 3SCMD 1S5IL 2OJ1A 4QT5A 5J9PA 4NUPA 3RGVD 4C56D 4HFUH 3MA7A 1JZ8A 3M86A 4WKZA 4G3YH 3EO0B 2ED9A 4YLCA 3LXCA 1A7OL 4ZQKB 4YSUA 1U9KA 2PW2A 5CGMA 1DBJL 1ZT7A 2KQMA 4YBQD 1GIGH 3K71B 4M8QA 4M8UA 4U49A 4X4XA 4N2BA 4DAGL 4M6MH 3V4PL 3VQ2C 1VLXA 4LCCB 3VO0A 1VGKB 3A4DA 2XACC 2D03H 3S5LB 1NCBH 4UQ2B 4JUSA 1A7NL 2ZCLH 4RISL 1DL7H 3Q5TA 1PGRB 4RFEA 3VI3F 3BEVB 3E6HB 4QGYA 3U7WL 1XBRA 1N59B 1SFHA 4WFEE 4PRIA 5EBMA 2Z93A 5BV7H 5KOVC 2ZUQB 3KPNB 4Q6IC 1XCTB 2XTLA 3GTTA 3ULVC 1KJMB 1RUKL 1A4KA 1AQKL 1OO2A 4L8BA 2XG5B 1QSVA 2FHFA 3DETD 4GW1B 4TVPL 3U7YL 2OS7A 5G55A 3IF1A 4JPKL 2X6UA 4L8BB 4P5TD 1H3GA 3IGLA 1O9VA 3UTPD 5K59F 4P59L 3CFTA 2W9EH 3QUML 5TTRA 1SEBB 3MLRH 4YVUA 1WFTA 4PR5B 3BCDA 1FRGL 1OXYA 1W0WB 3NCEB 1LO5B 1I9RH 4OIBA 2VDNH 4JRXB 3MV7B 4OM1H 4YJZL 1GYWA 3I75B 1HHJB 3EFDH 3RWJA 3MLYL 3D3VE 4BGDA 2ARJQ 4FQ1H 4GW4A 3X12A 3PPSA 4KV5E 1NIDA 4UDUA 3WFHA 1NCBL 5I8CA 3HE6D 2D03L 4NO2B 3VFPA 4G8FB 3WGUB 1L3NA 2X05A 3V4PH 1F4XH 1CQKA 2EDOA 2GCYA 4HIIA 4BFNA 4R26H 4PV8B 5ANMA 3FRPB 2WWMC 3ME0A 3SKMB 4NC1E 3EO1B 1BBDL 2XFXA 3UPAA 2DQDH 3CSPA 3NUKA 1T5WA 3NRPA 3OD3A 5G2NA 1UADC 2Q86A 2OAAA 5BNXD 2WZPA 3MRIB 3O3BB 1R19A 2X40A 4YIQA 3X11A 1HILA 3FOMA 2GHZA 2L7QA 1QAWA 1DSWA 3UMNA 4QRTA 2K3HA 2AV1B 1I7TA 1MFNA 4W4NA 3U30C 2GSIB 5I5IA 5JYLA 3RI5K 3PAYA 4LGRB 4W9HC 4JM2B 4OU3A 4CN1A 1TZGH 4NUJB 3JT2A 5AYUH 1FYTE 3V0FA 4GMTL 3UBXB 1PDKA 2IQ9L 1G9ML 1UGKA 1YEFL 5GGUB 3QZBA 3SKUD 3NCJH 1YJDC 1B4LA 3LKNA 1Z5LA 4LIQL 1JD7A 4YDIL 3QPQD 4PJBB 1XCTA 5CGBA 3RL1A 3GNMH 4G9DA 2QSTA 5HYIA 4BSVB 3QDHA 4NZDA 4R4NC 1DL7L 2BSRB 1XGQA 4P23A 3PUCA 4XP1L 2GFBB 1NAML 1YEGL 4M6ML 2EVJA 3L5WB 1GGUA 3IGKA 1NDMA 3E1F1 2WO3B 5JYMA 1JPSL 3UC2A 3X2QB 4OLXL 1OZTG 3P4LA 3GB7A 4N26A 2YSSA 2G5RA 4G5AA 3WHXB 4Z7IA 1CB4A 2J8OA 5BMFL 1H5BC 3P02A 5ISZA 1QFOA 3UABA 3D4GA 1A9BB 1E43A 1S7VB 5CP3A 3KGTA 1TCMA 3SKJL 3TT1L 4F7MB 5JIMA 3QUYA 2WZAA 4IRZL 5ANHA 2OSWA 4B9ZA 3TF7C 5AW0B 5CJXC 2Y69B 1UB5B 2R0KH 1LWRA 5IVXE 3BMVA 1P9MC 4ODWB 2E46A 1U8MA 3WU1A 5A16A 4FP8H 2AK1H 1ZT4A 3SYPA 3WV0A 3MRKA 3ML8A 4HDIB 4UQDA 4MAUH 2ADYA 4Z3EA 2FUQA 2IADA 1BIIB 4LRNL 3C5ZB 4AKQA 5DA4A 1X6NA 4PG2A 4S1DC 5M7QA 1CDIA 3L9YA 4X7SL 3C09B 1XGYL 4CMHB 4DWHA 3IFOB 1MCJA 3CIQA 3IN0A 3BE1H 4JFXA 4L3ED 1Y0LB 4AM0B 4C8XA 1OPGL 1JGIA 4YDVB 2VXSL 5L0QC 1Q8MA 1JIBA 1OT1A 2VL5A 4YDLC 1PZ3A 4WI6A 4PWEA 3SQBA 1BYNA 1BZ8A 1YEKH 2WVVA 1J86A 1KXQA 4FQXB 5DHVA 5DS8B 1RIVH 1SJMA 2BCMA 3VB8A 1BEXA 4JRYB 4FN0A 4E9VA 3FB6A 3LKQA 4JREC 2IQAB 3C75A 1MJUL 3NCYS 3UGXA 1L4IA 1TKWA 4WNJA 1FAIH 2EVFA 2B4CH 1Q1JL 3RX5A 2DJSA 2O5YL 2ZCKH 3S96B 1GS7A 5EN3A 1UJ3A 1M05A 1JDAA 1UXWB 4YX2H 2Y7QA 3GMLA 4XNBA 5FGRA 1RIUH 2PCPB 1DBAL 4LLUA 3RNQB 4J3OD 4M8RA 4EIUA 4IBWA 4XP6L 1RVFH 5KVMC 2IWEA 2WWNA 3VI4A 4HWBA 4WVRA 4YGAB 1RU9L 4HP5A 5FLVA 1K5WA 2KLTA 4NS0A 4DVRL 2FBJL 4AMWA 6FABL 4LHUD 5GRUL 1XR9B 3G5ZA 3PGDA 2AQRA 2OXHA 2WKOF 4PGEA 4XMTA 1P5VA 2V9TA 2JVUA 3FZUC 3ISWA 4EUPA 1G4MA 4PJEA 2FQGA 1A8JH 5DSCB 3FXIC 1B0RB 4K8RH 4FQXA 4OGQC 3K2MC 5DHVB 3VJ6A 4ANVA 1ZAGA 3NCYP 4RETB 3NIGE 5JUEL 5J11B 5FPIA 1SJXA 4FQ1L 5EU6B 4PJXE 4I1NB 4PJXB 1OTSC 5DS2A 3HAEA 3GTVA 1A6PA 2QQLL 1A4JB 2F5BH 5MENE 1UH4A 1BW8A 1NCNA 3WN5C 1EHXA 1ZA3A 2A74A 4F7EA 3V9EA 4QHUA 4ZYKB 5DZAA 5F0MB 3VFNA 1AKJD 2H26A 4HZLA 4CNIA 1T03H 1LLAA 5BZXA 1I8LA 3ATFA 3I3DA 3L3GA 3RYMA 4EN3B 3FPYA 5IBTL 2QHLA 2ZYSA 1KIQA 4Q56A 4WDIA 3FCUB 4N0CD 4YHKL 4OVUA 4ZFQA 3MRMA 4HUXB 3L3IA 1LWJA 2YAOA 4HSAC 2HA1A 5I74B 1AY1L 3CPUA 1AH1A 1ACXA 4LFHD 1S7QB 2QSCL 4F15B 1QTSA 2C3HA 4YBHA 3GSXB 2ZNXA 5FW7A 1A6VH 5G5DB 1XL4A 1F4YL 1MJ8H 1MLCB 3CPLB 4ZMOA 5I1GL 1UKSA 1FVEA 4IMKA 1XL6A 1GXEA 5BV7B 4DFHA 4DAGH 1CXFA 1CXHA 1Q1PA 3VXUE 3VU1A 4UDTB 4XCYB 1FVEB 1F42A 1MJ7H 3KGUA 4RAUB 2OTWA 1BQSA 2XSKA 3FN0L 3BFOA 3I6KB 3W82A 5IJKA 2I7OA 1JI1A 3EBIA 3FQ1A 1BOYA 5DMKB 1F58H 4X6FB 1KULA 3HR6A 3GUFA 3L54A 2A1WH 5TPWL 3STZA 5E4IA 1INDL 3K91A 1JK8A 1WDAA 4U31A 2Y0SA 4XE5B 1VHPA 2YD1A 5LNEA 3NGBC 4HUKB 3OQRA 1SDAB 2B39A 3O45A 4PLOB 3MRRB 3LPPA 2A6JA 4Q9RH 3GDCA 4M1CC 1MWAB 1CZ8L 4QRPE 4G8GB 5T33H 1LO4L 4U1LA 5T5NG 4EZLA 1RI8A 2AXGA 4XAWH 1BJ8A 1E4KA 1UH3A 2XN9E 2YARA 2COQA 4PJGB 1TCRA 2VSCA 1MELA 1OVZA 2R9HC 5KYYA 4J2QA 3CK0H 1BBJB 4PPTA 1CICA 3WFDL 2DQTL 3PQYD 4JDVB 3HAEB 3HVNA 4MQXC 2J2ZB 1NFDF 3EOAA 5CZXC 5C08B 3ZN6A 4YHML 4XXWC 1U58B 1PU0A 4H20H 3FO1A 2E3VA 2HPOA 4YHKH 2NY0B 1AD0A 4G8FA 1NCWL 4HS6A 3PGFH 5CN1A 4GRLD 4MNHB 3T6XA 1X5XA 4D0CB 1AJ7H 5MEND 4J2XA 1OTUD 3AB0C 4I48A 3T2LA 3AS2A 1RUQH 4O51B 4MB1A 2C9RA 4M7ZC 1DLHA 5LXGH 1UWEH 3D39D 4QLWA 3BQUC 4HKJB 4DN3L 1XGTA 2CNZA 4MMXB 4JFHE 2R0WH 1FNFA 2AGJL 3RVVD 1E9OA 1WZLA 3OLGA 3O0RL 2BDNH 5TF1H 4I5BA 1D5BA 2ORBH 1RZKC 5E8OA 5CD3B 1D3CA 4ZX3A 4DP9X 1A21A 1FYTB 4PGCA 4FA8A 3SGDI 4ISVA 3IDGA 2AV7A 1CE6A 4ZMTA 1NM9A 4PJEE 4Q0XL 1GZHA 2C9UA 1ZSHA 3KS0H 2Y1VA 1OL0A 3QXAA 5JPMC 4K3EL 1TZ8A 5KTEH 2EXSA 4GW1A 3OAZK 1Q90A 5I18L 4QXTB 1NGYB 2ZKXA 1K9TA 5BJTB 1CG9B 3FQ2A 2ZTBA 5IHWA 3LRMA 2B1AH 4DVRH 4PJGA 6FABH 1R75A 4CADB 1M7DA 2F7OA 1S7TA 4J3OH 1E8YA 4JKPL 5FM4A 1A6UH 1EGJH 4RA0C 3EBAA 1TJGL 3GWJA 4NZUL 4ZAKC 4FXTA 3FUEA 1IGJB 1VZIA 3CLFL 2C5DC 5IW3A 5LGHH 2JKJA 5I23A 1XD1A 5K39B 2JIXA 2PW1A 2SODB 1F2QA 2NY5L 3RUGA 1B0IA 3GXTA 3FF8A 2AJ3B 3LB6D 5I16B 1ZTXH 4KI5D 5I5RA 1MJUH 4BE5A 4F2MB 3K71A 3SY6A 4EQ3A 4IJ3C 4XCFL 3WO3B 1AS7A 1AZVA 4PLJD 4R90H 3RWGA 4NN7B 4AENA 4JRXE 5ISZE 4E9XA 2DM3A 3F5WB 4GQQA 2KHAA 3H9HB 4NKIL 5J3HD 3DURB 2YKKA 3MV8B 5HI3D 5EF1A 1OWRM 2UX6A 4NBYB 3UO1L 4K9JA 2NSQA 1P6WA 3IFPB 1X5IA 1ERNA 1ETZA 5EH1A 2O5XH 5HY9A 5FFOA 2BK8A 3B6SB 5DO2D 1ASOA 2E6JA 4GP5B 1RP9A 3RIKA 2X4UA 1MCOL 4LVNB 1B2WL 3WJMB 1JV5A 3MLXH 4AV5A 2EDMA 2BVYA 2HT4C 3ARYA 3PWNA 4HV8A 4IOFC 2CKBA 3FSOA 4M6AA 4UU9B 4E41D 1UWYA 2AEIT 4IKNA 3LZFL 5F7NC 1L9SA 1SGKA 2IBZX 4LIQE 1NTDA 1W72L 4HUWA 5DK2A 5CEXB 2UY7B 4YHOH 3KWWA 4IRSD 4BSWB 5ID1A 4HJEA 1DO5A 3EGDB 1VZGA 3FHEA 4TUUA 3U2SB 3N42B 1C5CH 1HXKA 4RMBA 4C4KO 5DHEA 1ITCA 3UAFA 2NLJA 3HIZA 3E0GA 4PUBL 3QULB 3ARGA 1OCZB 1KYUA 4LAJH 2RD0A 2NX5B 3LKPB 4JMNA 4F7EB 1NCAL 1TG8A 5L88H 4WUUD 1J9CT 1H3VA 3T0VA 4D0CA 1R3LB 1S5HA 1ZLVK 4MXVE 4WFED 1JXJA 2X70A 3EKCA 4G8EA 5GS1A 4WU7B 4Y2DC 2HVJB 2GCYB 1AGFA 4KKAC 3NFSL 1XCWA 2I60H 2XXCB 5MEOA 5DI8B 2X6BA 2UZIL 4BFEA 3DXAA 3QZNA 2WVSA 3DX8B 2BP0B 3ILEA 1G1KA 5HVHC 1CFTA 1IIIA 1S3RA 3EBGA 1AQMA 3OB8A 3P0YH 4LNVA 4GO6B 3G5ZB 2F9BT 1GC1L 3HKZA 3Q2WA 2F18A 2IVFC 3RPIA 2EQDA 1LO4H 3E3QE 3L7EA 3VI4F 3V6FA 1ROWA 4XTRD 3RWDA 3FO9A 2R15A 1S7RA 5DHDA 4PTUA 1RZKH 2K7PA 5EUKA 4U1GB 5D93B 2P48B 3O9WD 4F37K 2E74C 1R34A 2NY6D 1UQSB 3I75A 1EHKB 4LSVH 4U2ZA 2XWJB 3VXMB 4GQZA 3MJ9L 4GIOA 4TVSa 1LQBC 1OF0A 5DRZA 4H1LG 1MHEB 1XCQA 3EAKA 4UM9B 4NQED 2FE0A 3O2DL 4JY4A 1Z9LA 2OA9A 4BKTC 1E40A 2YK1L 5JW5A 4DKEL 2YXVA 4IRSC 5LBGA 4YDKH 5LGJA 4FXGB 3LZPA 2DPKA 1FSKC 2JKWA 2MPVA 3UERA 4YUEH 4NM4H 1QSEE 2DICA 3GJFH 5BVJB 5JW3H 5IVZA 1OM3L 4BINA 4KDTC 2XRAL 3E8UL 4WTXA 3MJ8B 4ZMWA 3B43A 3RWEB 2M2DA 4PTUB 4X7EC 2ODHA 5F8QC 2L0DA 3FU7B 5C7XL 4PS4L 4XN1A 4PJAF 4RBPK 2H3NA 2A6DA 1JNHB 5FA4B 1SJEB 4ZMQA 4IBTA 2QQNL 4XVTL 2Z35B 1YNTA 4NRYB 3DGGB 3WIHL 4OLWL 2DQGL 1U8QA 2GJ6E 4JR9L 2ZXAA 2F8IA 5DZJA 3GRWL 3L3JA 3QZOA 4EUPG 3KWVA 4AH2A 4HIHA 5F6IC 3UBGA 4YSAA 3WNMA 4DKFH 1JNNL 4HWZB 4LLMA 3VFUA 5F9JB 5JHBA 5DI8A 3CHOA 4XNMB 3WHE1 4NRZB 2VLKD 4X6CB 4G8IA 1LEKB 1UATA 1KGXA 4UOJA 3NABH 4M56A 3EZJB 4JAMA 4EKXA 1NSNH 3NIFE 1G7HB 3X1BA 2ARJB 5IM7B 2WINB 3RDTB 3AGWA 3CFKA 3FT4B 4ZK8A 4Z7WE 4PS7A 4HKXA 4HEPA 5GGVL 4PIRF 3ZTEA 4KROD 5D4IA 1BPVA 5C09A 3W5NA 4LHQB 4F7TB 1DBMH 4BZ1L 1L9NA 1WFUA 1CGSH 1N0XL 5EOTA 3VJ6B 3EXLA 2PPAA 2WBKA 4Y5VB 4TSBH 1NGYA 4G7QB 3ZL1A 5J6GB 4A6YA 5I8KH 4QLRA 5EA0L 3L6FB 3JVGC 3L4ZA 4M7LH 4XMZA 3QQNA 4N0YL 3GO1L 3O3UN 3O8XC 2KS0A 1RVFL 2BSED 3CK0L 3QG7L 5C0BD 4L8CA 4HUUA 3W0WB 3ZTJG 3O6LH 5FC9A 4FFZA 3T09A 2C4FT 4YZWA 2JLPA 1X5GA 4OI7A 4BZ2H 4XB3A 1ZIAA 1BREA 2Z6FA 1T7WA 4NOBA 3S36X 5KSAA 5EC1B 4AK1A 1XB8A 25C8H 4B0MM 1JTPA 2NXYD 2BSSA 4IRJC 3HJEA 4AC2A 3GGWB 1KGJA 3BP6B 1MUJA 1DQJB 1DVXA 4XVSH 2WMPA 5C0JB 5C2UB 3KZ8A 4I1RA 1KELL 3NCBB 2R27A 3G5XB 3PJSB 4IMLA 4U1MA 4ELMF 1R5WB 2QLYA 1CVSC 2IG2L 3FT0A 1P84J 3EO1A 2O26U 5JIQA 1PLCA 3SQBB 3A4EA 3FU0A 3MRBA 1IQWL 3N9GL 5KSAD 3LRSA 3F3HA 2QL1A 3K6DA 5IQ7L 2A6DB 4UMSA 3X3GH 2F53B 3VWKA 2N7AA 5IK3A 1P1ZA 2UV3A 2FB4H 4OJFL 3EJRA 2WTRA 2YD7A 2NYZA 2BSEA 1MXDA 4MJIA 1F1GA 1JERA 2HH0H 5HHPA 4Y2NA 5BVJA 1H5BB 5E00A 2ED8A 4KNSA 4UQ3A 3QO1A 1Z3RA 1LO0H 3ZTNL 1LWHA 4I3RL 1W0VA 2G2NA 3P0VH 5DK0A 3BHBA 2ZWSA 4MQTB 4L0ZA 1ACYH 3DXAD 4R4ND 1MLBB 1PCSA 2R1WB 2BJML 3KVDD 1J8HA 3DMMA 2HG5B 1YMME 4N2GA 3MRLB 4AIZB 5FDWA 4XAKD 1KFAH 1DCEA 4RZCB 1GKEA 2ALAA 4D9RD 1E5YA 1EAPA 3AWEA 1U6AH 4WY7H 3AXLB 3QQ4B 4KK6D 1E5AA 4WCYH 1G84A 1CFNA 1Q9WA 3B9AA 5DMIH 4CVXB 2D0GA 1WH0A 5GZOD 4ZPTA 3KE0A 5AUMA 2OSLA 3MRQB 3Q1SL 4ZTOH 3OF6A 4FG2A 4LCWA 4NQTA 4HKBB 5JZ7D 1UC6A 4QEGA 4CU6A 5FHBL 2BW4A 4WV1B 4PJ7A 1H5BA 5KJ7E 5E5UB 3MRCB 4B27A 4H88H 4XP9L 5C9KA 2DI9A 4KRMB 1WSST 4IOIA 5TFSH 3JYBA 2C3VA 3H0TB 3I2CH 4NQCD 4AUUA 4CMHC 2AW2A 3HI1A 3IKKA 4FQLH 4L4VE 1NL0L 4W9EC 1MW0A 4K3DL 3VI3B 4H8PA 3QPXH 4D0DB 1JGLL 3O4OB 1JWUA 4NQCA 4R5XA 4XNZB 1HH6A 1ZLUH 3UBXA 3L7EB 1RUAH 3DBXB 3VVVA 1OPOA 3RL2B 3GMMA 3GS7A 1GGCL 3TJPA 1VENA 3DDGA 2KC0A 4KHTL 1CS6A 5D7IE 4U1MB 1RZ8A 4JG0H 2YPKB 5EOQH 1HCZA 2VLJB 1G7QA 3SYOA 3EJPA 5HGAB 2VR8A 4KK9D 5JIDA 1RERA 3SKOB 1K85A 3G6JA 1H15B 2Y1YA 1BAGA 4X8CA 3SDCB 2VRQA 3ARDA 5D1XA 5E8DL 2GHWB 1E4WL 1FVCA 2RR3A 3ZQXA 5EC1A 1ODUA 5T1KD 3TIDA 4NERA 2HSIA 1TJIH 2HUHA 3UDWA 4APXA 1C16A 1VFOA 3BDYH 4NQXB 4QY8A 5DS1A 3VD0A 1FLRH 2NY2B 4RDQF 3OJDB 2JJWA 2JB6B 4ZXBD 3O4LB 5IEHA 2UWEA 2J71A 5AAWA 1AHKA 2BS9A 2VTFA 3NSJA 3PV6B 5DJYA 4L48A 3HS0A 3WNIA 4ZMNA 3EH3B 3ISYA 1BYOA 4IRJA 2X9XA 2VDRH 4HUMB 4I8DA 1NGXA 4LLVB 4PJBE 4R7NA 3S3CB 3ZE2F 4K5OA 5JA8B 3G6AB 1EHNA 4IS6A 4LVHC 3FMGL 3ET9F 1OAUL 4CVZA 2CLZA 2PWHA 2VITA 3P0GB 3LIZL 2YAHA 4Y19D 3WFCL 5KYNA 3Q1SH 1N68A 2PO6D 3C6LA 1NUFA 3STBA 3SDAD 3S88H 2FEDC 4XHJD 3SDXB 1P7QB 4WUKL 4MWFB 3BZDA 3DARA 3MLRL 2DMGA 1MCNA 1PX8A 2W9EL 3EJZD 4PG9A 4OD2A 1CFNB 3KGRA 5FGCE 2OW7A 4RX4D 2G0LA 4UUJA 3QDJB 1TKWB 1CDCA 1J5DA 3EZ8A 3QJTB 1TO5A 4X42A 3TFKC 3JTBA 3EYSL 5FK9A 1EO8H 1ANUA 2ZXDA 3DVNB 4JVWA 3RBGA 5HGDB 1MHHB 2Z93B 2YPVL 3QSKB 1FV1B 3L4UA 1U3HB 1E8ZA 3MGAA 4IHOA 3J2PA 4ES8A 1UXSB 2Q8BH 3NCMA 5DEFB 1XAUA 5E2VL 4HK3J 2XA8H 3F7RA 4NO3B 3VFRA 3M8OL 2FO4B 2W0PA 3EOTH 3UP6A 5GGQH 1YNKL 1Z9OA 4ZI8A 5HHQB 1D6VL 3O6FA 3GXNA 2F58L 4JO2H 2X4QA 1WBXB 3BAYA 3KBFA 3KPLA 4Y4HC 1ZSDA 3TV3H 1O9ZA 2BX5A 4JQXC 1DBJH 2ESVB 3QIWA 3MNZB 3BH8B 4ERSL 4BV1A 3T77A 3D85D 3ZO0A 2AJYL 2WTOA 4PJIF 4FGMA 4JO5A 1EVTC 2VZVA 3N44F 2D8KA 1GAFL 3T6VA 1W9XA 5KS9B 2F1BA 4GMTH 1WAAE 5JIIA 5F6IB 4X80L 1TZGL 5DWPA 3SCMB 4U7MA 3PS6A 5A3IC 3ZSSA 1CDYA 3IT8D 4E9TA 1RIHL 1JZIA 3Q6GH 3VNZA 2OYPA 3RX7A 2MSPA 3PHSA 5EZJB 3O0LA 3LXBA 4PV9A 2IV8A 4CU8A 3EH4B 3ZT7A 2E4TA 2XPYA 3CSGA 1QLEL 5IB5B 4F8TA 2GBTA 5K9QG 2AEPH 2BVPB 3CDCA 1A2YB 4Y16A 4MCYB 3TNMA 2OZNA 4N0YH 4OCSL 3A6OA 2XZAH 5L2JB 1WICA 4N5ED 2CK0L 3K4AA 4TRPL 1LO3H 1SF5A 3HCVB 1PFOA 1SN2A 3QARA 3PRZA 1CFTB 2QZQA 4HH9B 3UH8A 4K07A 2AQTA 3B8SA 5IB1B 4PJ5D 1UZ6E 1M9WA 2H9GA 3US1A 5TH2B 1ACYL 4H8UA 1AP2B 1EXUB 2YQBA 4WW1B 4Y19E 2HLFC 7PAZA 1LO0L 4KVCH 3TYFA 2NR6D 1BAFH 4FFVC 3TBVA 3LVEA 5CWSB 2J7LA 1KJ2B 3HG2A 2P5ED 3CXDH 5E08L 4N6RA 4IU2A 2KI6A 4LKXB 3VXUD 2XG4A 5EDSA 1CLOL 2YD2A 4AQEA 1MAKA 1IBHA 1TMQA 1JK8B 1OP9A 1QRNB 3HBQA 1FE8L 4O58H 3SE4C 5GIRA 3M46A 3QDMB 4B7LA 2PCFB 1O7DC 1KYOK 3ZX1A 2J1ZA 3SE4A 3MV01 1VAHA 3I9GH 1IBGL 2EIZA 5GGSA 3EH5B 3WIIL 4N6QA 4DKDC 5ADPH 1KJ3L 3IE9A 2FHBA 1EIBA 3CVIL 5IT2L 4QTIH 5E4AA 3OC5A 4OLZL 1HVXA 4XVSL 1XIWA 4DGVL 2MNUA 3P30H 4RRPA 4JQXA 3R18A 2GTWA 4KQ3H 4FTVE 3K4ZA 3JWDL 3MJ8A 3CVHL 5F0JB 4ZMVA 3US0A 3H0TA 3RQ3A 5AVWB 4HOXA 5T5FA 4AYSA 3NG5A 1VKXB 1A1MA 1NGPL 4PAZA 1FBIH 5I17B 2UZXB 4PJAB 4F57L 2Z35A 3OKNB 5D72L 3EDFA 1NEZG 5D5MA 5BO1H 3Q8FA 4ZAKB 2Y06L 3QCUL 2Z0UA 5E8EB 1KGIA 4MLSA 4S0HA 3C12A 3HMXH 5PAZA 3QHFH 1KCLA 3RWFB 4GLRH 3HNTH 4OIIH 2R69A 2CCWA 2QQKH 2AJSH 5E9AA 4YC2C 1IGFL 2RQEA 5DD3L 1BQHB 4ODTH 3FHAA 1NCTA 2CHNA 4FQXC 6TAAA 5LQBH 4Z3HA 3MRGB 3N40P 3CVCA 3DRTB 2JI1A 3MRJA 4N9GA 3U82B 4JREB 5F1IA 2GSIA 5JNYA 1JN6B 2WXJA 4YHNA 1U8IA 1XZ0A 2WJ7A 1DQLH 1DZBA 3P40A 4G5ZH 3GM0A 5D71L 3WYRA 4ENEC 2AQ3A 4KITB 8PAZA 5I28A 1PKQB 2HT3C 4FZ8L 3EH2A 3TN0D 2FGWL 5DZVA 2RJMA 2VLJA 3UZEA 3ZYIA 5K69A 4WW2C 2BP0A 4X5PA 2X0VA 3FRPA 3QRBA 4JDEA 3BC9A 5IG7B 3ZL2A 4P46D 4N8CL 3HPLB 4LKCA 3TM6A 2QSVA 3SPGA 3QH3B 3U36B 2CR6A 2OSYA 2AZUA 4PVMA 1F6AA 3P4OA 3ZT6A 1KG0A 3I02A 1O7VA 2I25N 4V1DA 4JO3H 2W88A 4XWOD 4UB0H 1X6LA 5I1CH 4OZFH 2ENJA 1JMXA 4TNEA 4HAGA 3ZE1B 4BH7B 3DGDA 4MB5A 3OHXB 2BVTA 3PHOB 2I9LB 4JDZA 2MFNA 3FSWA 4AGQA 3BZEB 1AXIB 3MBWB 1NCDH 4P4KA 5D5MF 3V0DA 1E50A 3VXRB 1F41A 3B9EA 4GG8A 5KW9H 4Y4FC 5AZUA 3WS3B 5T1LB 5L9DL 1QLRB 4QRRA 1GZQB 3IU4H 4UF7C 3TFBA 1HFUA 3FFCE 1WD8A 3FO2B 1A5FL 1TEFA 4DKTA 4L29B 2WANA 4H5SB 5C0CD 2ROYA 1EAPB 3OR6A 3EOBA 3QJHA 2H47C 1TLMA 1I3RB 5JQ6L 3QIWD 2EIMB 5TJWK 1A4KB 1B3IA 3HC4L 3ZZSA 3A6BH 5TE6H 3D34A 3V5KA 2BRRL 1FNSL 2DEXX 3LMJH 1SM3H 3EGDA 2FQDA 1W0VB 5CILL 3QUYC 4FQXD 1I8MA 5CEXA 1JVOA 4DOHB 4UQ3B 2WXHA 3KJ6L 3IFPA 4XC1L 3MNZA 1XT5A 5HHOE 4FE9A 1TTGA 2WUBL 1PY0A 1QSFE 2R7EA 3NJJA 5E1QA 1CFQA 1TQVA 4JFXB 1GC1H 5IB4B 3B7YA 5EF2A 1MXGA 4YLQT 5KVGL 2A6IA 4UQEA 2WTRB 2EDHA 4HT1H 1AO7B 1Q9LA 1TR7A 2UY6B 3QUZA 3FHQA 5IY5B 1O75A 1QPXA 2F53A 2OMXB 3VWKB 1FORH 2DIAA 5DEFA 5E6UB 1NFIA 2JLLA 4EN2A 4ZOAA 5ISZB 4HIJA 4GRMB 3ES6A 4BDVA 4JZJA 1B3JA 4PJAE 4UTCA 2A3TA 3L1FA 5CFAA 3BAKA 1KN2L 2L4OA 2OTWB 2DLTA 2NW2A 2V8LA 4FG4A 2VKXA 1L6ZA 3ES6B 3GHPA 3AMLA 4TUJA 5D6CA 3WJLC 2AEOA 4W9IC 5T1MB 3A6CH 4W9JC 4FXGC 5I1CL 1FSKB 4H8WH 4P5MB 2G5UA 3Q6FB 2YEZA 1ZJBA 3FS9A 3WUWG 2ZYHA 4XVUD 1QHQA 5JOFA 1JV2A 4OJDH 3QG6B 3ILQC 4BFKA 3DOIA 1S7SA 3K81A 4BK8A 3MGOB 2AI0L 5TQ0H 4HPYL 3V0EA 3VDAA 5ICXA 4F9LA 1KDJA 1FH5L 2LAAA 3CGTA 3IGAB 4X6EA 1UJ3C 3V0WL 3V0GA 2AC0A 1YQ2A 1E6OL 1NUGA 3A5VA 3FT9A 4G9DB 2P8PA 3FUDA 1WIPA 1KV3A 1BF2A 3SO3B 1J10A 4W1TA 5INCA 1QACA 4NC0B 5DC4B 4Z7VF 3AGVA 1QSED 5LDSA 2FR4B 2CK2A 2JKRM 4LBAA 2CUAA 4WFGE 3FO2A 2V2TA 4BM7A 2VLLB 1UWXK 2YWZA 1SHSA 4JKLA 1N6QH 4ISVB 4NQXA 4B9PA 4GIAA 2YPLE 4PJ9C 2E47A 2EE0A 2HWZL 1YA5A 1S7RB 1D7FA 1KN2H 2CU9A 4NP9A 4DP1X 1IEBA 1X5MA 1SXCA 1I7TB 4JM2F 5I0DA 3QIWC 1I1AD 1ZT1B 1DUZA 4G7RB 4ZNEA 4XODA 4HKJA 1V8HA 1A1OA 1KEMH 1L0XA 2OJZL 3WNOA 3WTXA 1AZZC 1X5LA 1T0MB 3SYQA 1CYXA 2DRUA 4FEMA 4MS8C 4A68A 1EXHA 1CXIA 1T5XB 3MACH 4Y5VC 1XR9A 4LSSH 1THCA 2LFGA 1XTMA 1W15A 1M3IA 3KCWA 4FMKA 1MG2C 1YNTB 4MNQE 4WHYG 5F44A 4R84A 3RWIB 4TQIA 3P11L 3CZJA 1GJUA 5J12B 3L81A 4GG6E 3S3JA 5DHXB 5I8CB 4CC1A 4QXGH 3QEQE 2LGNA 4G6KH 2KT6A 3QUZD 1EZVX 3JV4A 3A6BL 3D0AA 4MQ7B 2ERJC 3DO4A 5IT2H 3NFPA 1KJ3H 4LSPH 5C0CE 5KYWB 3CZNA 3G9VA 1CI3M 4H44C 3QJFA 4KTDL 3N41F 4F5CE 3CFBB 4OZIB 4Y2OB 3O8XA 4QHKI 3F05A 1H9VA 4ZODA 4JY5L 4LEOB 3K6SB 1A9EB 3V4PA 5BS0A 1MHHA 1V05A 1Q0XH 3SPVB 1IV8A 1FE8H 3MRGA 4BH8A 5E1AA 4NAQA 1ORQA 2X6AA 3V7AE 3MCLL 3PWPD 4OF7A 5IZ7A 2AGJH 2Y6SC 3OGOE 4QHKJ 1S7SB 4PJFF 7CGTA 2DQJL 1AR1D 2YEVB 4UUJB 1UHVA 1MNUL 2EH8L 1E4XH 4NHCH 5KYXA 4U4BA 1F11A 1LEGA 3I6KA 3PL6B 3ZMEA 4F2EA 1RH8A 4K5MA 3WLWC 5E6RB 3HFFA 1TYRA 4BCYA 2K4AA 2F6AA 2AQ1A 4WO4B 1SJHB 1FFNB 3Q05A 4R7DA 5IFHL 5JDJA 3KD4A 2LTQC 2A38A 3FU5A 3WIFB 4F80A 1FGVL 1A8ZA 4XXCA 2JJUA 4PJ8A 1PW3A 1YN6B 3H42H 2OXGB 4RQQB 5CCGE 1A7PH 2K9FB 4K0OA 4KJYA 3CVBA 5FM5M 4BIKA 1JFQH 3GSVB 3K6OA 2PO6C 3WTTA 5HHVL 4HQQL 3UG3A 1S7VA 4L4TD 4RRPG 4MAYD 3QNFA 2CIIA 1PD6A 2CDEA 1EAQA 3WBDA 1CD1B 3OZLA 5B38B 5CGTA 3H9SD 4IDJL 4NO0D 4NZTH 4QT5B 3BPCA 3K74B 4XO5A 5HJ3A 3H2WA 4U1JA 3ZKND 1RZIA 1P7KB 2CRIA 5IIEB 1UT9A 4NBZB 3PP4L 3G6JB 3O4OC 4KVNH 3HHSB 2GYSA 5DXWA 2W07B 4PMFA 2TRYA 1CC3A 1EHLL 4L3CB 1X4XA 1O6SA 2CCLA 4Y1AD 1T5KA 1V3JA 2IFGA 3ESNA 1OLLA 3LPOA 1W16A 1I3RA 3NFNA 3LOWA 3FQRB 4JFSA 5EFIB 4X4YB 5C0EB 1NCUA 3ZKSD 4ELKB 1AVAA 3DX9A 1YNKH 5FW6A 1EFXB 3W0WE 1DZ0A 3KPRD 3HE6C 1RIUL 1OP5H 1EEZB 2X1OA 3LKSB