2A3TA

Cu-containing nitrite reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the oxidized and reduced forms of nitrite reductase from Rhodobacter sphaeroides 2.4.3 at high pH: changes in the interactions of the type 2 copper.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA02
2IWFA 2VW6A 2I7SA 4DP6X 4E9RA 3FQ2A 1L9TA 2Q5BA 2PPAA 3ABMB 5I28A 5E9NA 1A4CA 2FWLB 3NSDA 3V9EA 5D4JA 4AKOA 3CVBA 3UAEA 2JKWA 1M56B 3FU7A 1ILSA 1E67A 2FJSA 3ABKB 3IN2A 3U25A 1PF3A 2DY2A 1NICA 4F2EA 4GP4B 2PPFA 2Y69B 5I6PA 4BWUA 1ADWA 1NIFA 3OMNB 1ET8A 1J9SA 1ZDQA 4KO7A 5ANHA 3OMAB 3WNIA 1GY1A 2EIJB 2J56A 1JZJA 4P5SA 4MFHA 2HX9A 3NJKA 2N0MA 2B3IA 2BP0A 2OV0A 2HXAA 4NB7A 4DP4X 5B1AB 1M57B 3WI9A 3D12B 3PAUA 1KBWA 2R7EA 1KDIA 1AAJA 3QJVB 4DPBX 4L0PB 3X1NA 1AG0A 2IH8A 3MX0B 2QPDB 4UANA 2Y1AA 3TA4D 3AW5A 3AY2A 1KBVA 4YSPA 1QHQA 3BQVA 2IDUA 1AS7A 2UXFA 3FU9A 3UADA 2X87A 1KCWA 5I6MA 3AG3B 1AS8A 2CJ3A 4QKTA 3T6XA 1IBYA 3TU6A 4E9TA 1A3ZA 2WO3B 2VSMB 2UXTA 2XXFA 3WKPA 1W8EA 3DKHA 1TEGA 3QQXA 2W8CA 6PCYA 4G72B 4JHVA 1PNCA 4A2EA 2YAMA 2BHFA 1WA2X 1BQRA 2BWIA 2VW7A 3X1EA 2FNWA 2HX7A 5B1JC 8PAZA 2YAOA 3AZUA 1NPJA 1IC0A 1JVLA 2TSAA 1PNDA 1AZBA 3QJTB 2XLLA 4YSUA 4A2FA 1AZUA 1ASOA 1CURA 3QJUB 1URIA 3FS9A 1NPNA 1JZFA 2VMJA 2PCYA 2YQBA 4F7KA 4A68A 1SHWA 4P5RA 3UABA 1FA4A 3S3CB 2HX8A 2JFCA 2IDQA 7PCYA 1DYZA 2CCWA 4YVNA 3FSZA 4FAAB 1MDAA 2UX6A 2ZONA 1X9UA 1SFHA 3EH5B 2XUWA 2IAAC 2IWKA 9PCYA 3EH3B 4BDVB 1L9QA 4F2FA 4Q8BA 3S8FB 3WG7B 4NAJA 1UATA 1YLBB 3UAAA 2VW4A 5TK2A 1GSKA 1BYPA 1OOWA 2BP0B 2HRGA 3OD3A 3T6WA 3NJIA 1BXAA 3X1BA 1JXDA 3FU8A 2UXGA 4E9YA 1J5DA 2GC4C 1NIAA 3T9WA 1OE1A 1WS7A 2CBPA 2DWSA 4Q89A 2PPDA 2VM3A 3BVDB 3X2QB 1L9RA 2GB2A 1NWPA 1A4BA 2RACA 2XYBA 3S3BB 2DYRB 1NTDA 2YXVA 4YVUA 3UGEA 5I6OA 1NIEA 5I5MA 5I26A 1AS6A 3FPYA 2ZWNA 1E65A 4DP5X 1GS8A 2WSDA 3SBPA 4W9ZA 1WS8A 1L9OA 2IDSA 1JZHA 1GYCA 4GY4A 3WKQA 1NINA 1SJMA 3DTUB 1CYWA 2VM4A 4G7RB 4DP2X 2I7OA 2GBAA 4DP7X 1AACA 3NP4A 1JXFA 3ZX1A 5IY5B 3NSFA 3NJHA 2BO0A 3EHBB 1OE2A 2B08A 3SBQA 1PZBA 2DWTA 1N70A 2UXVA 4DPAX 3NSYA 1V54B 3NJFA 3UACA 3T6VA 3PCYA 1IBZA 1CC3A 1TEFA 2AFNA 4YSOA 1L9PA 4JKNA 4YSDA 1KYAA 2DYSB 1JVOA 4TXVB 1RZQA 4E9QA 2BP8B 4A67A 5LDUA 1FWXA 3CDZB 2P80A 2QPEB 3ERXA 5I5JA 4N8UA 3QPKA 4HCIA 1SDDA 1J9QA 1PAZA 2QDWA 4DP0X 4YSTA 1XB3A 3OM3B 2BP8A 1AZRA 1WA0X 2H47C 3ASNB 1ZPUA 2HLEB 4JHUA 1OCZB 1W6WA 2MTAA 5B7EA 4KO6A 3V9CA 1SFDA 1ET7A 2FT7A 4QLWA 3FYEB 3TBCA 1PZCA 4GYBA 1JXGA 5AZUA 6PAZA 5PCYA 3ASOB 1PCSA 3ZDWA 1SF5A 3OMIB 2QT6A 4KNTA 2PP8A 1J5CA 1N68A 3WNJA 4M3HA 4YL4A 1SNRA 1JZGA 1IKOP 3PAVA 4HHGA 3FYIB 2AZUA 1AZNA 4N4YB 3FQYA 4DP9X 1OE3A 1GS6X 1PZAA 1WA1X 2FQFA 2XV3A 3NYKA 1JZEA 1NZRA 4HHWA 5D4IA 1HAWA 3T71A 4HAKA 4KO5A 4AKPA 3CZUB 1MG2C 3NJJA 1OV8A 2XX1A 1FFTB 4UAHA 3C75A 1EZLA 1OCCB 1R1CA 5A7EA 1NIBA 3ABGA 1L9SA 5B7FA 1BXUA 2XV2A 4HCFA 3WIAA 1XMEB 3IE9A 4ENZA 1ZDSA 2CALA 5B7MA 1E5YA 1J9TA 3OQRA 1TKWA 4HZ1A 5F7AA 4GXFA 3S3DB 3IBOA 4KO9A 3CVDA 3NJLA 1MZYA 1V10A 4HIPA 3TASA 7PAZA 3TBBA 4EF3A 3NJNA 5I6KA 3AG2B 5B1JA 1GY2A 3FSVA 2XVBA 1ZV2A 1X9RA 1NWOA 2EIMB 1KV7A 4AX3A 1RZPA 4FA7B 3MBWB 3PXLA 4PCYA 2QDVA 2PP7A 2W88A 4DPCX 4RH4A 3SBRA 1OCRB 4W1TA 2R7EB 2BZCA 4BXSV 1KDJA 1PLCA 3QJQB 2IDFA 3G5WA 3ABLB 4NERA 4YSRA 2J55A 3NJMA 1OCOB 3QJSB 1BXVA 1E30A 3NSCA 4CSZA 1J9RA 2YAPA 2FT6A 1A4AA 3X1GA 4A2HA 2NRDA 2JXMA 1AR1B 4YSCA 1A65A 3PLYA 4A2GA 1AANA 2EILB 5EHFA 3RYMA 1HAUA 4YSQA 1SHXA 2J5WA 1ASPA 5F7BA 1ETJA 2P80D 5D4HA 3SQRA 2FQGA 1M9WA 2YAEA 3FU7B 4AI7A 2BW4A 1ZIBA 3ZIYA 1PY0A 5I6NA 2ZXWB 2H3XC 3H56A 3KW7A 4YSAA 2FQDA 4KNUA 3GDCA 1PLBA 1ASQA 1BQKA 1V55B 1MZZA 1IUZA 4AKQA 2CAKA 2HRHA 2AZAA 3KW8A 4KNSA 3CG8A 4M4RB 1AQ8A 3NP3A 4X4KA 1AIZA 3FPXA 1MG3C 4GP8B 4PAZA 5I6LA 1ID2A 4G7SB 4K9JA 5FC9A 4E9WA 2BW5A 2XWZA 5B3SB 2GSMB 1GS7A 2BZ7A 2YAFA 4YSSA 1QLEB 3FT0A 2FT8A 1F56A 3PAZA 3AG4B 2Q9OA 2UX7A 3EH4B 1EHKB 2YAQA 3GXUB 3NT0A 1WAEA 4A66A 2CUAA 2FQEA 2DV6A 2ZOOA 2WO2B 1CYXA 4E9SA 2E86A 1JERA 1GR7A 2GHZA 3H4HA 2H5UA 4E9XA 1JOIA 4G70B 4UF7C 2MRYA 1TU2A 1ET5A 2GIMA 1GW0A 1PMYA 1BYOA 2J57A 2VSKB 4A2DA 1A8ZA 3CDZA 4ZK8A 1DZ0A 4BWWA 3ZBMA 5B1KA 1CUOA 2IH9A 1VLXA 1I53A 3HEIB 2PP9A 2EINB 3EF4A 4AZUA 1BEXA 4HCGA 2VN3A 4GP5B 3IEAA 2YAHA 3AG1B 4G7QB 1BQ5A 2I85A 1RKRA 2PLTA 3FQ1A 5I5IA 2YARA 2FTAA 3DIVA 2OCCB 4G71B 4BDVA 1ILUA 1B3IA 3NJGA 4BK5C 5AKRA 1ZIAA 3X1FA 1KCBA 2IDTA 2BWDA 3S8GB 3H4FA 3L45A 3FSAA 4WTQA 1JZIA 3T6ZA 2GI0A 4HALA 1NDTA 2GC7C 2LLNA 4CSPA 3N55A 5AFAA 5PAZA 1HFUA 1KGYE 1AOZA 2OJ1A 1RCYA 2IWEA 2HZHA 4WKXA 1AG6A 2A3TA 1T5KA 4KOBA 2EIKB 2XV0A 3PPSA 5B1BB 3CVCA 2YXWA 2X88A 3N2JA 3QJRB 4BWTA 3GYRA 4BXVA 2AANA 4DP1X 3IN0A 5TK4A 1XB6A 1QNIA 3FSWA 3JT2A 1AZCA 2AVFA 3JTBA 1XB8A 1NIDA 1E5ZA 1SDDB 4E9VA 1SF3A 1BAWA 4DP8X 2PPCA 1OF0A 2TSBA 2PCFA 2XU9A 4YSEA 2XXGA 2XX0A 1PLAA 1W6LA 4KOCA 2PPEA 3HB3B
chains in the Genus database with same CATH superfamily
1U3HA 2DWXA 3PFUA 4GRMB 4J3TA 2ITFA 5DRWB 2Q5BA 5EMYA 1UZ6E 4ZAKC 4AC2A 1REIA 4K5NA 1NMCC 3P3YA 4G6FB 4LNRA 4P5TA 5HGDA 5IB2B 1D6EB 3CVIL 2X2UA 1JHLL 2FEDC 3NACL 1YPZA 2GJ6B 3JV6A 4TUJB 4ETQA 2WLMA 5CLZA 1M56B 3ALPA 5FW8A 2DYPB 3O8XC 5KG9A 5MENA 3VWJD 1G6RL 1KJ3H 3E6HB 5DDHB 4F2EA 1S78D 2HKAA 2X4RB 2PPFA 5IBUB 2F8XC 4BWUA 5CD5C 4RMWA 2ERJC 3OMNB 4Z3GA 4MBRA 4XOAA 2YPLA 3Q0HA 3BVTA 4PVBA 2YOAA 4TNEA 1NAKL 4M7KH 3QQDA 2BMKB 1IMHC 3QO1A 4IJTA 5F6HI 1H0DA 2R1YB 5EU6E 5E24E 3CGTA 4WGVB 3RJQB 2NTFB 1FIEA 4CSSA 1RZGA 3NCYP 5TE6H 3GLAA 4IKIA 4Z7NE 2JTDA 3BPLC 4N86A 5B38A 4OZGA 3TBSB 3AT8A 3JV5A 5FYJH 5DVLA 3ULVD 2EUWA 2MNJB 5DYFA 1G6VK 2BRQA 1KACB 4ELMA 4KKRA 4WI6A 3B9KB 2IH8A 3B83A 1IQDA 1A7NH 2QPDB 1J0IA 4WUUB 3STLB 4BH7B 4KHTH 4OZFB 4HS3B 5A2FA 1HX0A 1OQOA 2A6JA 3BQVA 4LIQL 5LHDA 3HJ0A 5DVOA 1KCWA 3L4WA 2EIDA 1T2QH 3L9RB 4P49A 5EFIB 4P3DB 4H1LG 3B1UA 3QUXA 1I7UB 3AREB 4Z7WE 3VE0B 1BIIB 4YDKH 2YZ1A 4YR6A 2FBJL 2QTEA 3N04A 2Y6TE 1R75A 1MOEA 3X13A 4H88L 1MI5A 1GJUA 4YHLH 1TEGA 3KPOB 4IDLA 3LZFH 3OZKA 2F8IA 4WI8A 1ZLUK 3VD7A 5E03A 4B0MB 2V7NA 4X6EB 4NZ8A 1MHPL 2L04A 5F9JA 1UWEL 2J6EL 1A5FH 2YAMA 4PGZA 3TH3T 2XWTB 3L3KB 4Q6IC 5HHVH 1GC1H 2R4SH 1QASA 1U33A 2PYEA 3FT2A 3IXAA 3WN5C 5CZVH 1XR9A 1SEQL 1QP1A 1BLNA 5IB1B 3P30L 3P4NB 1PZ5B 1MCFA 2DI8A 2VIRA 4TOYL 3E2HB 3FN3A 3QDMD 2Q2LA 4X5XA 1KB9K 3TVMC 4WJ5A 3VDCA 2FSEB 5H37G 3U30B 2XVKA 3WLBA 1VCAA 4FNUA 4IRSA 4F8LA 7TAAA 3TESA 4Z7OB 2X4TA 1KXQE 1ECZA 3L9RA 1BM7A 3IU3B 3QUKB 4GO8A 4E41E 4X9HA 1VPOH 2DQUL 3EBIA 1I7UA 2ALAA 2C9UA 3AREA 4ZFOL 4Z7OF 2C3XA 3G5XA 1WD9A 3OLGA 4HIIA 5CCHE 3D2UD 1PY9A 2Z91A 1AP2B 4NKMB 4XC1H 1Z3GL 1X9UA 1SFHA 3MRIA 1ZGLA 4M6NH 1FV1B 1PCXA 1ESOA 3L54A 5FWQA 3S5ZA 4LGRB 4XO4A 4YC2C 4LCUB 4MJIA 5BUPA 2AXFA 1TXKA 3KGSA 5GS0D 4P2RD 4W70A 5K1NA 4HU8A 1YN7B 1MPAH 2ICEA 4HUXB 3P9MB 4Q0XL 1A6AA 4Y1SA 3SDAA 3VYNA 3KYKL 1OP9A 1ONQB 4PJ9A 2G9KA 3INOA 4X7SH 3RB7A 4NS0A 2EE3A 4HK0A 3PJSB 4HWNA 2GSIB 4PSRA 4OLWH 3WO4C 4AEFA 1FORL 3SY0B 5DHVA 1D6VH 1OE1A 3CVHA 4OQTA 5HGAB 1FO0L 3H55A 1HC1A 3H9HB 3OBAA 4KRNA 3RTQB 5IJKA 4AEIH 4EUPH 3VH8G 5SV4A 4JN2B 4J6RH 5GGTH 3V4LA 2BC4B 4X80L 5JW4R 4L48A 4C58B 1IGMH 2QKIA 1SXBA 2X7LA 2X9XA 5KVGE 5BZXA 1V5JA 4RIRB 1BAGA 5MEPB 2JQZA 4OD3L 2BX5A 2J88L 3MRIB 4MQXC 3QUYB 1ZGLB 5SX5H 4V1DB 2H2SD 4O4YL 3IKCA 3NVQA 3MQIA 3VWJC 2DIJA 4D7BA 1B0WA 2ZT9C 4GY4A 5BZDA 4PVMA 4CU7A 1OAYL 2ZP9A 2F8VA 2NY0C 5I1GH 2NXYD 3FHEA 1JNHA 5TJWK 5D1QD 4M8RA 3U0PB 3BPCB 1QKZL 5FIEA 4MYWB 4PJBF 1T89C 1I3RA 2RFXA 1SJEA 4XGZB 4PJAA 2IC2A 2GUOB 2QHRL 3EDJA 3DX2A 5CZRA 2W0FB 1MCOL 2HWZL 1T4KA 2X09A 4JO5A 4MMZB 5IUSA 3KPSB 2ZWLT 3NSYA 3CU1A 4ODTH 4XODA 5EBLB 4HMEA 5ADOL 5J4MA 1VFOA 4L4VD 3VFNB 1BECA 43CAB 1CC3A 2NX5A 5C09B 4BGDA 5J89A 2AEQL 4YSOA 3JWOH 1HOEA 1YO4A 1L9PA 5AVXB 4NLAA 5DS8B 1KYAA 3B2XA 2N56A 2XZQL 3GI8L 2V2XB 1M2OA 3LPWA 1E4HA 5IQ9A 1F4YL 5LDUA 1P4IH 4NBZB 3MRCB 2UY6B 5I5JA 5IZ7A 3MV7B 3JZ7A 2Y72A 1U6AL 5FHAL 4FQIL 5ICYA 1X4YA 3PE9A 1Q8MA 4QMEA 4PRHB 3SSGA 4DESA 3CFEA 4LSDA 2IVFC 1MH5B 4Y9GA 4DP0X 4KJWC 1AZRA 3ASNB 1MUJB 3EYFA 2CUHA 3WMPA 1W15A 4L29A 1O7VA 4PJFB 2XG4A 4QHMB 3V0WL 1E8XA 2E74C 1W6WA 5D1XE 4DGWC 4KO6A 2W0FA 4HIQA 4C57C 3CSGA 2WGXA 4MB1A 4UOZA 1F90L 3HKZA 2X40A 2YUVA 1AXSA 1PTZA 3WFHB 1NEZB 1FLRH 4UM8B 4Y1TA 3K6SA 3T6QC 2VRQA 4D0DB 3CX5K 2AMUA 2BNRB 4NQVB 1BZ9A 4IRZH 5A7BA 1HWHB 4YL4A 3WU1A 1FNLA 4AVIA 2OJZL 3VXNA 4Q7DA 2CXKA 5JMOC 2R2EB 3DX9A 1I8UA 2K9UA 3NTCL 4HCRA 1T3FA 3ARDA 1UM6H 2AJUL 4AGNA 3MJ7A 3FTVA 2PCXA 3KS0J 1DDHA 4YN3A 4Q4EA 3VGHA 3RNQA 2MPVA 4KO5A 5DVMA 4LESA 4GRLD 4NRXA 3UJTH 4UAHA 1TOXA 1D6EA 3ZVVA 2FWSA 1UD6A 3KJ4B 5IGXL 1YPZB 1UQSB 3JV6B 1E6OH 4TUJA 4JGUA 4YE0A 5AW0B 3K2UH 5T3XE 1D2OA 1INQB 4PRIA 4Z3IA 3WFHA 4YBLC 3NOIA 3PL6A 5F7AA 4RNRB 3MXVH 4X0KB 2BS8A 5D7JA 3O11B 3E3QC 3FK3A 3ZZ1A 5D5MF 4W9CC 3TASA 4EDXB 5ANME 1E4XH 1WBZB 2FBRA 2CDFB 3HLAA 3QARA 1B0IA 5I6KA 4I0PC 1IBFA 2X3AA 4EI5B 4E42B 2QEJA 1GY2A 3FCTB 1ZV2A 3OF6A 4B9IA 3WFBL 4LEBA 1IB5A 4FMKA 1U21A 2PP7A 2J88H 2OW6A 4R8WL 4Z7UF 3WIIH 5A1AA 1YNTF 2MQ3A 2ZSVA 1DQML 4JN1H 3TWCH 5HHQA 1QSEB 4Z0XA 3Q44A 3VRIA 1EA9C 1UJ3A 2HKFH 3PWPB 3AY4C 4AQAA 3NJMA 1BGXL 4J6RL 4CBZA 4MLIA 1X4ZA 3H42H 1JZ4A 2Y7MA 1XH3B 4TLUA 1A6TA 1IT9L 2NW2B 5MP6H 1WGVA 1BZEA 1FL5B 1SN2A 4G1EA 3SGDH 4L0YA 4QTFA 1M9SA 1RK0A 2OZ4A 3DX1A 4X6DE 4BYHA 3QAZB 1D5XB 4RGND 1P5VA 4NKQB 1BIIA 3SY6A 4Q74A 1JYNA 2DQTL 4JFFE 1N0LB 2X10A 2WK2A 3U46A 3QCUL 4ELMF 1PD0A 2ZKXA 5EF3A 3IB4A 2JKIS 3SODB 5K39B 4UTAH 1KZQA 3V79C 3BVUA 4N0FB 1TPXC 4WV1B 2FQDA 4KNUA 3HG0A 3QUXB 4RRPG 4QPEA 4WW2F 5F96H 4JKPL 3ARGA 5F6IB 2E6PA 4YHOH 3HIZA 4XP4H 1CFQB 4WUUE 2BIHA 3LXBA 1OSEA 4GP8B 5AYUL 4N90E 5AVSB 3VCLB 1ID2A 4EQ2A 3KM1A 4OZFA 1DBJH 5FC9A 3PIQB 3QUZB 4ZFOA 1I8MB 2GSMB 3MN8A 4AVKA 3I9IA 4GUPA 3FQNA 4PRIE 5IFHH 3BJ91 5F7YC 5HHXL 4WFHD 3Q3GB 1NCGA 1CPUA 4YDIL 1ACCA 3QI9C 1JI1A 3EH4B 1AC0A 3HKFA 2NX5E 1S78C 3SKNA 2IGTA 2ZOOA 4HF5H 4MD0B 3RTQD 3S48A 4FQ1L 1EEUA 5EU6B 2FEEL 2EE0A 5GRXG 4W9IC 3UTTA 4B5EA 3UEZA 4PBWD 1Q9KA 3LQZB 2V7HB 5D7LE 4EN3B 3KNBB 5ICZB 4XVSL 1GW0A 3L5HA 4ES9A 2UV3A 4QGTA 5I2IB 3GSNH 2FJGA 2G5RA 2Q76B 1ADQH 2DTML 2JKTM 3T1FB 5L4FA 1E27A 4FKHA 4WFFE 4KRPB 1AKJB 5ESQA 1I53A 3MBEA 5E94A 4HCGA 2VN3A 4UT7L 1URZA 4KKBC 4FCAA 4PRPE 3ZUCA 5IVNA 1YMMD 4APQB 4AK1A 1KTRL 1NCAL 1NGZA 3HZMA 1OAJA 4KX8A 3UAJA 3V4VH 4LCUA 4NZTL 2KZKA 2WCGA 5E1QA 1CIUA 2DLTA 3QNYA 4HH9B 5FDWB 4AIOA 3VQ1C 4M1GL 5C6PB 2N7SA 2WQ8A 2M2DA 4WTQA 3ATAA 4F2MB 3N1FC 1NDTA 5C6TH 5EOQH 5PAZA 1QR1A 4YAQA 5JORB 3RNKA 1AOZA 3ZRSA 2B59B 4LLWB 3ZQWA 3MOQA 1CK0L 3K0YA 1YECH 3W9EA 4BZ1H 4ODSL 1HVXA 4ZSOA 3TV3L 2WSPA 3E0GA 4DP1X 3HE7A 1MHHB 4Q6IB 4TVSa 1QI4A 1JFQH 2AS5M 3TA3B 2V2TA 3M17A 2VLKD 1W72L 1H3XA 1PD6A 2ZD0A 2H6PA 4XN5A 4P2QA 2WUBH 3H7LA 4K23L 4PJXA 2MKLC 3Q8FA 2JKLA 1FZOB 1PZUB 2NY3D 4YUEH 3KR3L 4ADJA 3A67H 1IGCH 2VDNL 1UB6B 3NFPA 3G04B 3SDDD 1T4KB 4MMZA 1DFBL 1EHNA 4ZTEA 4P23D 2YC1A 1P4BL 2EYSA 4LRNL 5E5UB 2CM6A 1E2ZA 2SODB 1QWUA 4RMBA 2BK8A 3T0EB 3QXVA 4XPBL 5LQBL 1H3VA 5E8EA 1K4DA 2XQYG 1NICA 4BBWA 4N1CA 2AJZA 4GP4B 2QZQA 3DGDA 1P7BA 2ORBH 2PNDA 3FRPB 1NIFA 4PIRF 2VC2L 4PVLA 3RGHA 3ZDXB 2Y5TA 2DLFH 4V1DE 2XN0A 3VXOB 2UYLA 1J9SA 3LY6A 1OPGL 4BE6A 1JZ7A 2Y36L 3DSFL 4U6XA 5SX5K 1ZSHA 4U1JB 1G1CA 1OZUA 2ZPKL 3QIWA 2J56A 3N0PB 1JZJA 5IUCA 1NGPH 4AJYV 5JW5B 1KXHA 3LZRA 2BP0A 2HXAA 3CC1A 2DQGH 5DZAA 1JZ5A 2WYZA 1IFRA 3HI1B 4L4TE 3D12B 3MCKB 4PQXA 1EBAA 4QRPB 3ECBB 1BD2B 3P4MA 3FCBA 2FNBA 3GKWH 2ARJB 3JWOC 3QNFA 5JYLA 1AH1A 3MX0B 5KJRL 3F65A 2BIMA 3P4OA 3NCFB 1CU4H 3U9PH 1KBVA 3GSQB 5E1AA 4M61A 2BSTB 5E2UH 4D9RE 2V5TA 1IFHH 4MA8L 1T0MA 4OZIF 4JFOA 1UXWB 2ZOUA 4F3FA 2YD3A 4DEWA 5G4NA 5HDQH 3MRDB 4DVRL 4NC2B 1AS8A 4HS6A 4XCYA 4DVRH 2FIKA 2ZCHL 1WBXA 2ZCKL 5E0FA 3F7VA 2ZCKH 2ZOKB 1A3ZA 2WO3B 2GJPA 1AXIB 3L81A 5FKAA 1I9JL 4QLRA 4GKNB 5F1IB 2QMKA 3UX9B 4XHJD 3SDAC 4ZUUA 1T21A 3S4SB 4G7YL 3QIWB 1DEEA 2A9CA 2CHWA 1PNCA 2B16A 2IADB 4G72B 4JHVA 5DCCA 2JV6A 4A2EA 1NFDB 2BHFA 5INCB 4YMPA 1THCA 1DDHB 4AMKL 4ICWA 1DR9A 1FYHB 1P4UA 4GSDH 2FD6L 4PRNB 2EUXA 1FIGL 4MXQC 4M6MH 2APXA 3UEQA 5IB4B 3A24A 1LM8V 5H37A 5IG7B 2YQGA 2JJVA 3CUPB 5IJBC 3L95A 3HG3A 3OG6B 5C0NC 3HNSL 1V3JA 5KVFH 5MEOB 2DOCA 1CFTB 3UTSB 2WQUA 1MF2H 3UABA 1XF2B 3T77B 3F7VB 1N5AB 3IDYB 2APWA 4IGBB 5DWPA 4AT6B 3U48A 3WKYA 5FUCE 4F33A 1F86A 4EZKA 1TFHA 1JWSA 2E56A 1EFXA 2PR4H 1SVBA 3QZMA 1IGCL 1HSBB 3F6LA 2UY7A 3HC0A 4Q8BA 5L0QB 3VFGL 2HT4D 2E3VA 4KQ4H 5GGUA 1LJMA 4ZDHA 2XFXB 3BKJL 3APFA 4NRXB 5TK2A 1YEKL 1ANUA 3ARTA 2XQBH 1C9SA 3GIVA 5E0QA 4D0BA 5F7DB 3LS4H 4HKJA 4CJ1A 1E0OB 1F8TL 1KEGH 1PAMA 3BVNB 3PY9A 1S8DB 3DX6B 4Y1AB 4QDGA 1KY6A 1UOKA 4NN7C 5TE4H 2LR4A 3Q8AA 1H3UA 2O72A 1WAAA 5GS3A 2V5SA 2NUPB 2NZIA 3KVDD 4WAFA 1OP3H 1DVZA 3SN6N 4HD9A 2W95A 1VKXB 4FERA 2RACA 3DJRA 4U4IA 5I19L 1CFSA 5E9AA 3KJ6H 4FG6D 3WLWD 3W2DL 3T3ME 3OX8A 1O9ZA 2Z8RA 2R1XA 1AS6A 4DP5X 2ZWNA 5DFAA 1J8HD 3NA9H 3GMRB 1YEEL 4W9ZA 3TN0C 2SEBA 2P8MB 5DRZA 3Q1SL 4QOKE 3S37X 1E4KC 4G9FE 4MA7H 4ES8A 1HK6A 4PJIE 2VDMH 4FI8A 1J8SA 2WIIB 3F58H 2CGZA 5EIQA 4H25B 2NNFA 1DSFL 4XCFH 2QTVA 3I2CH 4P4RB 4C54A 1RUML 4HKBA 5AW2B 1A6TB 1W72A 3SKOA 4IRZL 1TJHH 4ZI8A 3EHBB 5DJ8B 5SWZA 1DVYA 2OM5A 1PZBA 2VDQB 1KGCD 3Q3GA 2BY3A 4PRHD 5B39G 5HGBB 5F7UA 5LWYL 2Y1VA 3T0VA 1WYJA 2F58L 2WXQA 3VXMD 4HOZA 5ACMA 4TVPE 1I8LA 1CS6A 2MCAA 4XP5H 4ZODA 4HUWA 1R3JB 3BZFB 5EN2A 1DBJL 1PIGA 4AXWB 3CHXA 1XSJA 4JX0A 1B6UA 3TEUA 2FJGB 2P80A 2XETA 3NZHH 3QDJE 3LIUA 4GAGL 4Y89A 4I0PB 4EI5C 1RUAL 2V33A 4U1IB 3OJ2C 4MLSA 3KVPA 5EG6C 3EGDB 2X2YA 2NQ3A 2WWKT 2VWEE 1JDDA 4YNYA 4BCYA 4PJDE 1XB3A 1CG9A 4LXFA 4PWFA 2VXTL 3B7YA 4PGBB 2P24B 3WAKA 2QVTA 5E23A 5AYUH 1EO5A 1F45A 2Z4TA 4F9PC 5IB3A 4KZDL 3BW9A 4JHUA 3T1FA 1XGQB 4LOUC 5DEGB 2NXYB 4XXWC 4UNTA 4KV5E 1AKJA 4JLRB 5EU4A 3ZYIA 4ZMXA 3ZL4H 3D39E 1SOXA 5B3JE 5AW6B 4APQA 1WJ3A 3VRJB 4F20A 2KDYA 4JDVA 1Z5LA 2IGFL 3I6SA 1C5BH 2V7HA 1SF5A 3ECQA 4DPRA 1J1OH 4FHJA 5IJCC 2QFPA 2VERA 2Q76A 5C09A 3BGMA 2XA3A 3OWEA 4QUOA 5ICXA 1TTUA 4I0PA 4W68A 4K07A 1A1OA 4QTHB 3KL5A 1L7TL 2HCZX 2P26A 1F18A 1ZXQA 5JR1H 1JDCA 4AVHA 1HXKA 2QV4A 3RIAK 2VABA 5L6YH 2CHNA 4RMQA 5D4IA 4ZMPA 1HAWA 4HK3N 2ZYRA 1EZVY 3IGFA 1UEYA 1JPEA 4B96A 1XWVA 4XNMA 2YWYA 1KPUB 1ZEAH 2NTSP 3QEQD 3D0VB 5ESAB 5BS0A 5HVFB 1QR1B 1SZNA 1JPST 3KH3A 4YDLB 1AGCA 2WWNA 5F2FA 1BVOA 1WIOA 1CTNA 1IAMA 4WHYH 1FNAA 5BRZD 4IK7A 3HC4H 4HFWB 2AK1H 3VMNA 3QWOA 4FQXC 4WQOA 3U30C 4LP4A 4P3WA 3P54A 3ZHNA 4CRPA 1USQA 4UV7L 4X5PA 5I24A 5LG1A 2W07A 3QZPA 2X12A 2LABA 3FTYA 5JZ7D 1BQHG 3TTSA 2FBOJ 2I24N 4N2EA 1KT2B 3DUUA 3LMJL 1AHWB 4EOWH 3SKJL 4AX3A 4NYLB 1KV7A 1QFWM 2BSED 4CDHA 1S7UB 2PMZA 6CGTA 5IBTH 3JBG7 4QHMA 4KI5F 4QOKB 4F27A 3VO0A 3S37L 1U30A 2J55A 2P5WE 5I8OH 1OO2A 3AGWA 1MFAL 4FGMA 5EORL 4LSVL 2L8AA 5H8DA 2XDHA 2YLHA 1HSAB 4HC1H 2X4UB 4O9HH 4URKA 2WXFA 2ITDA 1FPTH 2J4WL 4ZW6A 2VM9A 1TZOA 2F5AH 3EGXB 4YH6A 4N1HB 5GGVH 1HJCA 2A9MH 4N0CC 5ID0B 3E7JA 3A4EA 4TL4A 4A38A 2VLJD 1HAUA 1JXJA 4DERA 1QRNA 4PWKA 3SQRA 4FYQA 2VZUA 3ROOA 5E00A 2PXYA 1YEFL 2Y24A 3EHBC 3ARWA 2X3CA 1R0AL 5F3FA 3TFKD 4H26A 4E41B 2GJZB 1EVUA 3K6NA 4ZFQA 2D31B 4R96A 3V4UH 1Z0NA 2J1YA 3DA0A 4ODUA 3RY6C 1OAUH 5AB1A 1TYRA 1I7TA 3CWGA 3RX7A 3S35H 3FFOA 3VI3E 5KYNA 4L9LA 4U1HA 2H7WA 1O7SA 1JIBA 1AIFA 1OGPA 2RB8A 4HW6A 3BQUC 4PJHE 3A5VA 5DJ0B 5FM5O 1BVZA 1S3RA 2B20A 1FZJB 4I4WA 4AJVA 4JHBA 3FQTB 3TYGL 2YZ8A 5B3SB 4GFTB 3P9LA 4PJAE 2IH1A 5FO7A 4EN3D 2NXZB 5D1XC 1RZJH 3BCDA 1KPVA 4EIGB 3O8XB 1MCPL 1AGEA 3BAJA 1NCTA 2EICA 3LIZH 2G0KA 2OMTA 3FN9A 1OTSD 2AQQA 1WBZA 3HLAB 2CRMA 4GXVH 4K9EC 2CKBA 4JVWA 1BZDA 4HUUB 4OFYD 4MNGA 3EJTA 1O75A 1NCAH 3V4VL 5CBAB 1DEDA 5HHMD 2ZXBA 3US0A 3BESR 1BYOA 3DECA 3EO0A 1DE4B 1A8ZA 1U8IB 2J8OA 2UY7B 2YXMA 3QW9A 2GJZA 2B9AA 2GHWB 1A6WH 1DZ0A 3MJ6A 3CFBA 4L8SB 4AEEA 4UM9D 3FO0L 3O41B 2WB1A 2ESVB 4FG0A 3HEIB 4AQ1A 1ZWIB 1NDGB 2GPZA 3RL2A 4AZUA 4N2CA 3FN0H 1EZSA 1XSKA 3KS0H 1QZNA 3Q2VA 4GAJH 2A77L 3RWJB 2H32B 1E6JL 3SJVB 2OCCB 3C5ZA 2BCMA 3WXVL 4AV0A 4MWFA 2J5LC 3PAYA 2WXRA 1ZIAA 1CF8H 4H1LA 4LPTA 1OPGH 5AKRA 3BEVB 3K0WA 3QZWG 1RIUL 4P9HL 2E6QA 1VEMA 3WV0A 5AFAA 2CA3A 2ZQKA 3CMOH 5DQ9B 2A3TA 2MQGA 4MXVF 4WEUD 3NACH 4PP1D 1J0YA 3UZVA 2XWJB 4ZTOH 3E6HA 5DDHA 3A67L 1RUPH 2D0GA 4NO2A 1UXLA 4Q9QH 3P3UA 3NSJA 4NO5B 4GG6F 5HDLA 3VI3A 1WZKA 4WWKD 1JWUA 4JRYB 1MJ8H 3RVVD 4F91B 1WZLA 1R46A 3AREC 4L3CA 1UYWH 5EIIG 5GJSH 3VCLA 4P5MA 4XNQA 1NANH 1R3LB 2BVOA 3GSWB 5LBSA 1A7OH 1W6LA 5T33L 2Z3FA 4HEME 4UTAL 4C83A 3C8HA 2QR0A 3KJ6L 1IIIA 2DYPA 4FQLL 1KJVA 2K3TA 5JXAH 5HHOB 3TWYA 2BPBA 1Z9SB 2D7MA 4XZUB 4K3GA 3RWHB 4BH8B 2Q8AH 3WCYA 2PWHA 2GY5A 1OP3K 3VXTB 3TN0A 2YHGA 1XIWC 1VF5C 3KPRA 4XI5C 5CJBA 1UURA 4KVCL 3X12B 4CC0A 2BZDA 1I1AB 1A47A 2XN1A 3I2CL 2B1AL 1QUNB 3N3EA 2WCPA 3NIDB 1IGFL 1WQVT 5DUBA 5EFIA 4OZGB 3QWQB 4MXWH 4XBPA 2Q0ZX 2ZSWA 3KCPA 5FO2A 3L6FA 5J6GA 4KK9C 2NMSA 2VXSH 4K3DH 1RZKC 4FNLH 3NJKA 5E9DE 3WDIA 3BZFA 4G7VL 2P5ED 3REWA 2ARJQ 5F3HA 4GW5A 3UGUA 3HNVH 3BEWA 1U0QA 3AXHA 3ULVL 3ZR6A 5KAQF 5AVYB 2VUOA 3QCTL 4DUXA 3U6RA 5HYJA 4UANA 3GI9H 5AAWC 4A7TA 5BUAA 3STZB 4IRJA 2WW8A 3D85A 3Q2LA 4N8VB 1K8DB 3H6JA 3GMMA 4AGPA 3UADA 4HUWB 4ZXBB 3ARQA 1B2YA 3DVFA 3AG3B 3T5WA 1LO2L 5DEGA 1NAKH 1E2VA 1TTGA 3T6XA 1WVZA 4OF8A 4U6VH 3FO1A 2QADC 1HT6A 1FDLL 5D1ZD 4QAMB 3K1DA 5AOJA 3KBFA 1WEJL 3MRQB 3QR2A 2OKMA 4MAYB 3WKPA 3F85A 1W8EA 4HEPG 3VM5A 4NKMA 5KSAD 1OB0A 5E1HB 1YECL 1GCYA 4BZ1L 1U8OB 1GZQA 3M8OH 2XYCA 1PZ5A 2P45B 5EU7C 3VXPB 3K6DA 1RIUH 4KZ0A 5B1JC 3BW9B 4YO0A 4P8QA 3T2PA 4Y5VC 4WSGA 1MH5A 3MNWA 5FGBA 3SPVB 1BZ8A 3CDYA 3LRSA 3S5LB 4JO8A 3WD5L 3NDZE 1VFMA 4HWZB 5I8CA 4GAJL 2F7IA 3QJUB 1XGPB 1U8PB 4WHTA 2R15A 1A64A 2OYPA 2MIZA 1KJ3L 2VMJA 1G7MA 2X4PA 3GMPA 2Q2EB 4ABVA 3PGDA 4Q9QL 1JZ8A 3APNA 2UVEA 1SXZA 1A8JH 2UUDK 4K9EL 3LMJH 2WNGA 1U42A 1NEZA 4KUZH 3QIBC 4X5RA 3D4GA 4OLXH 4O2FA 4KKLD 2P9RA 4YHZH 1ZLVK 1HNGA 3MRDA 2FB4H 2IOIA 4NUQA 3LHAA 3EH5B 4PJHB 4F7EB 4AG4H 5L2KD 1FZMA 1I1YA 4FQXB 3EH3B 3ZMEA 2FX9L 3HI5L 4YDVA 5HDBF 2VDKL 4F92B 1IAKB 5L6YL 2PCPB 3MRLA 3N9GH 5BOZG 3EKCA 5KSBA 3DSFH 3OAUH 2IMMA 5CEZD 4R4BB 1S9VA 2J1ZA 4POZD 3N50A 3O6FB 2OTWB 5T1MA 3X3FL 1GAFL 1S7UA 2R4RL 1NIAA 1AR1C 3FCGA 4WEBL 2E5EA 5BV7L 3VFWA 1JHTA 5MEPA 1XIWA 2MPAL 4G5ZL 2EDOA 2PPDA 4UB0L 4FXGC 1CXEA 1GGBL 1IKFH 3KYOA 1XAUA 3QPQD 5EULV 4ODTL 4Z8FL 4PUBL 3VJ6B 4M43H 3N1QC 4N2HA 1MNUL 5CN1A 3K71A 2AQ1A 1MQKL 5I18H 1JF1A 5SX4I 1PZ2A 4RX4D 1IC1A 3VGDA 4NJAL 3FO9B 4HX1A 5CD5D 5JUEH 2DBJA 1V7MH 2WSDA 3PJNA 2NY7L 3DX4A 3C08H 5LAPA 5ESVA 4DHLA 1RURL 3CFCL 4IGBA 3K72A 2QADD 4CMMB 1HXMA 4U1HB 3F5WB 3ZZQA 1SJMA 3FJTA 1UM6L 3BGAA 3GRWL 1CYWA 2DQEH 4QHPA 3W11C 1IM3D 4XHJC 1CI3M 1EMTH 3P2BA 3V5HA 2EC8A 4L3ED 3FTSA 2XFXA 1I7RA 4Y2DC 4M1DH 2EE2A 1LVEA 2EDTA 4NNXA 4Y4KD 1ORSA 3WEMA 2PETA 4HGWA 5K93A 5DHVH 1RJYA 3IDUA 4NWTH 3BZEA 1CZ8L 3S3SA 1VIWA 4RAUA 1JVOA 3HMWL 4UQ2B 2HRLA 4LKXB 3VFSB 4M9OA 2B39A 5BZWA 5IR1A 4JDTH 4OCYL 3LN4B 5GGUB 1E4XL 4Y2DD 4G3YL 3QVAA 1J1PH 4QXGH 3F83A 3VXNB 3QO1B 3LRKA 1S5IH 4TRPL 2FGWH 3OM3B 2RJMA 1ZLSH 4BRVA 4XMVA 5B3NA 5C0EA 3ARGB 3LXUX 4YBQC 3TCLB 1AXSB 3K46A 2EUZA 1K4CB 2ZXEB 1PVHA 4X5WA 2NUPA 35C8L 1MY7A 1VFAA 2VITB 3ZKND 4C55A 4KVNH 3HHSA 1ET7A 4MAYC 3UCRA 3V9FA 2AEQH 4TNWF 4QLWA 1X5GA 2ZE0A 4S10A 3GTNA 4KFZC 1Z9PA 5AZUA 4FYRA 3ZDXF 3KDMA 4B7LA 2BSSB 1KTBA 2E7LC 3S36X 3B2UC 1LDSA 1CT8B 5FXCH 1IRAY 2A99A 1SY6A 4N2DA 3UTQB 4POYA 1JTTA 3KDPB 2VXQH 3WIHL 3M86A 3FYIB 1WFOA 3FQYA 5DMKA 2OX5A 4LLYB 4MS6A 3RY6A 2CIIA 1PZAA 2C1OA 1DSYA 4P06A 3U9UA 4OZIA 3FOMA 3N42B 3CXFA 5IM7B 5IBLC 3TIDA 2PXYC 3HS0B 2N01B 3GC3A 4P9ML 43C9A 1AXTL 3N42F 2HMIC 1R3IL 3O6LH 3SKMA 3C75A 1X9LA 1J88A 2NCEA 3OKLA 3SGJC 2W0KA 4QYOA 5C3IA 1NIBA 3DC0A 4B53A 1MCBA 5IMLA 1MQKH 1X5XA 2FX8L 2CLVA 1R5VA 5B3JF 5ITFA 3GXIA 2E75C 1IAIM 1D9KD 1DJHA 5HHOA 4W81A 4UB0H 4N8CL 4Y5XC 4QI3A 1ZVHA 1DANT 3I50L 2A4ZA 4N5ED 3UMNA 4JDVB 3WELA 2C4FU 4G6AC 4NIYE 2YBGA 4PLKC 1T1WA 4R7DA 5I5RA 4PJDF 1MHHA 4Q6IA 1KGXA 3A6CL 4LO9A 4ZUTA 3MBWB 4L8SC 4LLDB 3PXLA 1G4MA 5KWYC 1ODAA 3F12A 5GS1B 4NBYB 1OCRB 1XGQA 2Y5QA 3VAEA 4L18A 2W59A 2NY7H 1XV8A 2R7EB 4K4KA 2IDFA 2AV1A 3IXTB 3FB5A 3EDKA 2XC8A 2OLDA 4BK5A 5L8KB 4ONHA 4LB8A 4B9KC 4XP9L 2TRHA 3JSSA 1N64H 1ZCRA 4KRPC 1MNUH 5EU5A 2GSIA 1I8MA 3U2IA 5DK0B 1IAIH 2UWEF 2CJSA 4X9BA 3BT2H 5DGRA 1QFUH 3V8OA 1DCEA 3X11A 2HJFA 1J8HA 1G43A 2EDFA 4JY4A 4YSQA 2HN7B 2WKLA 5CLWA 1SHXA 1UXSA 3MGOA 5GGVY 1VFBB 5F9WB 5J6HA 1J05A 1T1XB 2F2HA 4NT6A 4LKCA 4HWBA 4TKWA 1BQLL 1OY3B 3W1ZA 3LSOB 3GBNH 1NLDH 2VJ0A 5I76B 4PJ5E 4X7EC 5CCKL 1P5UA 1YPZF 4Z78A 1FV1A 1FGNL 1CGYA 2B9BA 5FYLE 3ZIYA 5I6XC 5ICZA 2HLFD 1MFCL 7FABH 4U1NB 3CU7A 4FFTA 4I0KA 3MRBA 1PLBA 1ASQA 2VDOL 3RUGB 4OZ4A 4N87A 4YS4A 5HYQA 2Q8BH 2P8PA 2OAAA 5EDXA 3U0WL 2EZ0D 5I1EL 3T3MF 3V0HA 2NY0D 4GSRA 5AW5B 4R90L 3LS4L 3POHA 3VWKB 4K71B 3K81A 4AENB 4LU5H 4RMVA 2A9NH 3TNNA 2IQ9L 3M46A 4N3UA 3N1PC 1S7QA 1FE8L 1ZGLP 5HGAA 3MBXL 2Z31C 5CHNB 3GIZH 3AG4B 5SWSB 2QQKL 3UJJH 4AYSA 5DJZA 2GK2A 3S5LA 5JO5B 1ZRUA 2ZOTA 4GT7A 4A66A 2FQEA 2DB8A 4YEFA 4N68A 2Y07L 4A7GA 1E9PB 3WEXA 4D94A 4LFHD 2XKNA 2I9TB 5TDNA 3ZW3A 2PYFB 4G70B 2FIKB 2ICCA 2X0UA 4F5CA 2P4AB 1BIHA 2VC2H 1QPPA 1GMEA 4CKVX 2CLRA 3TV3H 2FX7H 1EQWA 4NI3A 3MLRL 3K7UA 4IBQA 4ZK8A 3MCG1 3PABB 5C0CB 4YHPB 1K8IB 2DH3A 3EJSA 3QJZA 4NGHL 1IC7H 4G59C 4KJWD 4W4OC 3CMGA 4WDIB 3CDFA 4JE0A 4N2AA 4XNZB 5M95B 3MNZB 1NSNL 4EI6B 3X14A 4X9GA 1A6ZA 3UBXA 1DZBA 5DHDA 2H3NB 3ULAB 3LV3A 4FXTA 3WTXA 1Y18A 3AU1A 1NEUA 3GS4A 4XN8A 2BH0A 1DBBL 2EXWD 4CC4A 4B6ZA 3ESMA 4W6XB 4JPIA 1UB6A 3NFPB 2X3BA 2D3VA 3CDGA 4Y2OB 4U7KA 5KS9F 1NQBA 4P46B 1VADA 4KXDA 1H8OA 1R17A 4DFIA 1TYEB 5DS8A 4WF7A 4XCCH 1CFTA 1AZZC 4KHXL 2V2XA 3LXAA 2NT0A 1EFQA 3EJCA 3U79A 3HG4A 2X1WL 1XTMA 1F4YH 4J4PA 2PWGA 2BS9A 3D4ZA 1P7HL 2WBJD 2HFGH 4Z77A 4K3JH 3KPNB 5HHOD 4L8DB 2FIRT 1IAOA 2XWCA 1SF3A 5E2TH 1RFDL 4XOEA 2IQAB 3N9GL 1RFDH 3I6KA 3DUSB 2EACA 3DK2A 3LAFA 4LQFH 3OAUL 2HT3D 4HCRH 2HFFA 1FL3B 5D7KD 2XXGA 1OEZW 2PPEA 4JM2C 3HB3B 5I66A 1EXUB 1IFHL 2CG9X 4NQCD 2QLYA 4YQXL 5J7CC 2R2CA 1J0ZA 3FQ2A 3UDWC 2PWEA 2FD6H 1JHTB 3MLYL 5D72L 3H7BB 3R1GH 3V0VB 1AKPA 4UT7H 2ZCZA 4YGVB 1GGBH 4R7LA 4OZIE 4PB9H 4UQ3A 2DIEA 3NRFA 3RZWA 3WE1A 2EYRB 2FJSA 5E6SB 1CE6A 5FYKD 3VG0L 4UQ2A 4C8XA 3RY5A 2FZ3A 3U82B 1YYLH 5LAXB 1NOLA 3A0OA 3E8UL 1RD6A 1UC6A 5T1LD 3QEGL 1ZDQA 4ZX4A 1FCGA 5D9SA 3HPLA 3DX9B 1FNHA 3FONB 1TVBA 5GISL 3K4DA 3KPNA 5IROA 2EIJB 3V5DA 4E42A 2QGCA 1USZA 2HX9A 2EXYC 3H2PA 4F58L 1FRGH 2OMNA 4PJEE 3FUMA 3MJ7B 1A7QL 1NMAH 2VZSA 5A6MA 1DFBH 2PXYD 3FUJA 4M3JA 4PGDA 3IDNA 1UA6H 3O6FC 4L37A 1M3IA 1CWVA 4MTMA 3TFKC 1UM5H 1A3RH 5D2NB 5C09E 3LKPA 4MJ6B 3RIKA 5DC4B 4YGVA 3VSVA 5CEZH 1MLCA 1ZS2A 5DJ8A 5E2VH 2X87A 3ARGC 1WITA 3HC3H 3ALWA 1EZUA 2F54B 4YL9A 3SEPA 2VISA 2OI9B 3FF7A 1XAKA 2X9YA 5I19H 2FEDD 1CGVA 4LEOB 5BCAA 3KEDA 4ORGA 3G6JB 3DXAA 4EKXA 1MI5D 1MAKA 1NFIB 1BMGA 5TDOB 1S7SA 3S4SG 5C0EB 1XF4A 1BQRA 1FN4A 1XO8A 1XSOA 4MSWA 3X1EA 2P48B 3FT2B 3NFSH 2R9HC 4EZMA 5HHQB 1K4CA 4X5WB 5AW3B 3WOVA 2QHLA 3G6AB 1KFAL 1DSFH 2HKFL 2XNAA 4U3XA 1KFAH 3C6SB 2FHBA 4EBQH 4AW4A 2AXFB 3WS3A 3PV7A 4M4PA 1F6FB 1UJ3C 3SJVE 5EF0A 4ZFGL 1JGEA 3N85L 3N41F 1KNOB 3LN5A 2X4RA 1DQLH 5KBLA 2Z4QB 4YZFE 2JFCA 4YVNA 5ANMA 5LGHL 1HZHH 3CVHH 3ECWA 5HYJD 1DQDH 4YLBA 4DK3A 1YEFH 1TQSA 3H3PL 1EDYA 1SHMA 1EHLH 1OAKH 3L4UA 1G9NL 4NFBA 1L9QA 1GJWA 4FABH 4GT0A 4X6CB 1ZAGA 4FTVA 1OAUL 4JO3H 3S35L 4OV5A 2XPYA 2L7QA 2QKIB 4JFYA 4MA1B 5KEZA 2DIBA 4WWID 5IROD 4RISH 1O6SB 2I60L 5JPNA 5CGYD 1GSKA 3AWEA 3FAXA 2EDNA 3VGBA 1MHCA 1FBIL 5IBUG 4L4VB 4DGIH 3FT1A 4ZW7A 3SY0A 2PTTB 1R9FA 3J27A 5EU5B 2N4IA 1A4JA 4AMKH 3JVFC 3BRFA 1OOAA 2HVKB 4OGAD 2YPVA 1NCBH 1UB5B 1NC4B 2DQDL 3MV11 4HU2A 1U92B 2FECI 5F7MC 4XBEL 3MODL 4NBXB 1EAPB 4WLCA 5JDSB 2HT2C 4YFLI 3QS3A 5I1CL 5JHDA 4JM4L 1UKSA 3QPQC 4DW2L 1WCQA 1QO3A 3IFNL 3CX2A 1GZQB 2WYIA 4DQOH 2JKNA 3CHSA 3GHPA 1MEXL 4UTCA 3MV01 4CA4A 4L23A 2IDCA 2DYPD 4U1NA 5EC1A 3KYNB 2LT9A 1JBJA 1WS8A 4L4JA 5CAYB 5HJ3A 5L7XL 1SQ2N 3EYVB 1P4LA 5FO8A 3IMUA 5F7FA 3FN0L 2OSYA 2PYEB 3VFPA 3LSOA 2F53D 3IFPB 1L7TH 5IMKA 3D06A 2KBGA 3TBYB 3D3VD 1MW2A 1THAA 2AABH 5C0AA 1IBDA 4HA1A 1FYTD 4HKXA 3VD4A 2WWKO 1N64L 4GW1B 1WWAX 1CXFA 2BO0A 3NJHA 4RMUA 1EVTC 4J2QA 3V0FA 1CVSC 5DMJB 4NQDE 5GS2D 4R7XA 1DQJA 3L3DB 4RRPA 2RALA 5DHEA 2JF1A 1DUZB 2HT4C 3CPLA 2IAMC 2L0DA 3IU3A 3QUKA 2ICWJ 2OMZA 3EAKA 1CIDA 1FFOB 1G6RB 4XVJL 1EV2E 3ZHDA 4UNVA 3OWRA 1K3ZA 4B9JA 1ECYA 5CHNA 1MCOH 3UAJC 2R0WH 3II3A 5E95B 2OQJB 4TPRL 1XH0A 3N6YA 1J9QA 3BGMB 3SD5A 3VRLF 4X9IA 2QDWA 3RVXC 1EDQA 3EYUH 3LKOB 2VMEA 5DSCA 2LAGB 2OTWA 4PTUB 3X17A 5JQIB 2J12B 4NQVA 4NQED 2XPGA 2AQPA 3D9AH 5C0BE 1F4XH 1I8IB 1I1RA 4XCEA 1P1VA 4F9LC 4R3SA 2PO6C 4OM1L 1DQTA 2W9EL 5JXEA 2ADYA 3JWNE 3VXRD 1K8IA 2ZX8A 2M26A 4MXQD 2YC1B 4N22A 3IDMA 5A2LH 3ZGIA 4PJGA 4M02A 4OFYA 4C56E 3T0XA 1PZCA 3MVSA 3RQ3A 2GJRA 3MV8D 5BNXD 2XKNB 1KIPB 4PJBB 4PJ5B 2BC4A 2Q6WB 4LP8A 1RLWA 4NZDA 2IV9A 4XNDA 1QLFA 1A9EA 4IHOB 4F2ME 4D0CA 2OMZB 4FE9A 4JHWH 3Q43A 3RWEB 1KYUA 2DIAA 4NDMA 4JRXB 4W93A 2O5ZL 4IYKA 4HKZA 5IW1A 4TMPA 4U0QB 4Z0BH 2AJVL 5CFAA 5T3ZE 3B37A 1MWAL 4FXLA 1P9MC 3VSTA 3S37H 3T8XA 1CGSH 4XMUA 3TH4T 1JPGB 5BS0B 2C3HA 3V4UL 2C5DC 5GRZA 4Z7QE 2XTJD 4P46D 1G1OA 3ZTCC 2CRIA 3U0PA 2NY4C 3MROB 1OB1A 5CUSH 5FHBL 1OCCB 1TZGL 4XC1L 4KKCD 2NSMA 1RZIA 2WQVA 3B9KD 2BP3A 2ZP0T 1XF3B 3BEVA 3C8KA 4H8PA 5CIPH 1UENA 2VXVH 4M5ZL 2ODHA 5DZVA 1C1EL 5HI5D 1P7QA 4LSPL 5IVXA 4GI8A 5AWNL 3AMKA 4UYPA 3P73B 1F11B 4XMZA 3CVDA 5AVQB 1IAOB 2F54D 1G9ML 2JNZA 3RP1A 4P07A 1NCCL 2VERN 4LL1A 3G5YB 5I1DA 3W37A 4RFOL 5B1JA 5F7HA 3U7AA 3WJJC 3B9EA 4K8RC 2NDGA 4L2YA 1CB4A 1IEAA 1P1ZB 5LKNA 4M6AA 3DPBB 1ZEAL 3ETSA 4XX5A 4J8RB 3SQOL 4P2YA 3NIGB 2ZUSA 3L3OA 3NSCA 3FUEA 3E80A 1FNSL 1XF5B 3A6BL 3ZO9A 1RP8A 3NIFF 1QRNE 5C0BB 1ZK9A 2IGFH 4L8CA 2D0HA 4GAYB 4H8UA 1MNNA 3GB7A 3O9WC 1R3HB 3KPLA 1YEJH 1AR1B 3S9DB 4POZC 4PM1A 1A66A 2EILB 1M1SA 3RDTC 4GAFB 4X6CE 4IBUA 1R5VB 1HQ4A 3ZQ9A 3GMNB 3QXWA 4LEOA 4QHUB 4MA3B 4KRPD 2FO8A 4AEHL 3E6FA 4ODXA 5DQJA 3LH8A 1DVSA 3TM6A 3C6LD 1HXYA 4F8QA 1NMAL 1IX2A 1FGVL 1T5WA 3HG1B 4O5LH 3VFGH 1MZZA 1N8OE 4AKQA 5F7LB 3RTLA 4OLVL 1Q9KB 3CSPA 3LQZA 4NQDB 4EN3A 3O41A 1XGUA 4FQHA 1AI1H 1NEZG 3SDCA 3O6ML 4DGYH 1AI1L 1MAMH 4LAQL 4BHUI 4BFFA 4I0CC 5K5YA 2WGNB 4AYBA 4Z7UB 5C07B 4EE2A 3QRFM 4MCNA 1DO6A 3AVEA 1HESA 1SYVB 2G9HA 4FFVC 5FW6A 2GQHA 1T7XA 3T0AA 3WIIL 4K3HA 1UZ8A 4DKDC 1P2CA 2FWOA 4FADA 4UQBA 1DN0A 1EHKB 2RGSA 4H20H 4ZOCA 4AMXA 2G4EA 5C6WH 3UZEC 2DQ6A 4DGVL 1COBA 4HV8A 4AC4A 1YPZE 4DZ8B 1BZ7A 2JKRM 3C5JB 2KQMA 3EG9A 3NCMA 3G6JE 4XCFL 2H6UA 4JFDB 3V52L 1ITCA 4ZMTA 3FCTA 3MLYH 3VXQA 4A37A 3GMRA 3SDDC 3CLFH 2YUWA 1FVCA 4N2MA 3DV6A 4PB9L 1T7YA 3INUL 4ELMB 3BH8B 3IEAA 3AG1B 2ADIB 1XQ4A 3P30H 2PYED 3LHPL 3UYPA 2JKJA 1UT1A 1LEGA 4LCWA 1FVEB 2A1WH 2YARA 2ZTBA 2CKBH 4WCYH 3U7YL 2RMNA 1NBVL 3ARBC 2VJ8A 4OTXL 4OZ4B 1EXGA 3QP3A 5SV3A 5HYQB 5T1DL 1PEWA 3BO8B 3LQAL 4X99B 2B4CH 4TV3A 1CE1L 1F2QA 3MCLH 4JO3L 3UO8B 1J05B 1T1XA 1N3NA 4ELKA 4Y16B 1EEZB 1BEYL 4LHJB 1WWWX 1Z3GH 2BVPA 4BXVA 1IGIL 3H9SD 4O2EA 1R0AH 4ODVH 5K9JL 4QRFA 3IN0A 1XB6A 1QNIA 3BKCH 3JTBA 2VKWA 5CEYA 3SDYH 3K4AA 2H2SC 4P23C 1XL4A 4X2UA 3JTSA 1E4WH 3EO9H 5I0ZA 4RGNC 3KCPB 2DEWX 4DP8X 2NY5L 1RIHH 5K69A 1BAFL 1KB5L 3BN9C 3KXFB 1UD5A 5CZKA 5FCSH 3WGVB 4NQEA 1V3LA 1OXYA 4ZFZA 5AB2A 5SWZE 4GUPB 2VAAA 1B4JL 3U4EA 3SDXA 1FFPB 3WHXA 1JD9A 1R19A 4X8JA 3VXMB 4ZW3A 5DK2B 3POCA 4TLKA 3VB8A 1X5AA 2E4FA 2WJ5A 4HJEA 1ILSA 4QRPA 4TSAH 1MCWM 5F0LB 3IN2A 3VXUA 3C60C 4JGNA 3NFNA 1WHPA 4KTDL 4XHQA 5EO9B 1OHQA 2FE0A 1WLHA 1AFVH 4M1GH 5F9DC 2H26B 4GW5B 2CRYA 3J8F7 3BPOB 3P4OB 4D7PA 3BPLB 3BQUA 5HDRA 5B22A 1KGIA 1NAMA 3T0WA 1T0MB 1HCFX 3K74B 4U6VL 4IHBA 1OTTC 4JO1L 5KUMA 4Z7NF 4ZTPH 5ITBH 2D7OA 3IDXH 5CFHA 4H8HA 2ZYHA 3GHEH 3B9VA 3F62A 1A3LH 1G7QB 1A1MB 3O4LA 3S34L 2AK1L 4DP4X 5GS2H 4B3EA 1BD2A 1KCRH 4JFPA 3VXPA 3D3VA 5JA9A 1T1YB 4WW1B 5BJTB 2VQTA 1UGKA 1AG0A 1DQDL 4N24A 2HJKB 4WFEE 3KD4A 4M29A 3RGVA 3SE3A 1NLBH 4W9JC 4AV5A 3BGFC 1OT1A 2F15A 1N4XH 2HRPH 4GW4A 4U1MA 1ZT4A 1IEBB 2ENJA 1PZSA 1N4XL 3SHSA 2RFXB 1YY9C 1PW3A 4G8IA 5K9KB 3VXUB 4IKLA 2CJ3A 4ZUSA 1INEL 1HEZA 1HIML 5HVHC 5CJ8A 2DLHA 3RWIB 2DQIH 2VLLB 1KYOK 5I0DA 1HCZA 4QRQB 3J2PA 2XXFA 1ZLUH 3LHPH 3APDA 3HCVA 4WHYG 2H6PB 4JG9A 2JK5B 3JT0A 2BM3A 2X4NA 3RWFB 4LGPB 4XAKD 1DBMH 4OLUH 1W2KT 4KMTL 3DMMC 5T3XL 3SYOA 4WEBH 4JPWH 4PREB 1S46A 2YAOA 5GGSB 3ZTEA 4NFCA 1C5CH 3AMLA 3PL6D 4GB9A 1ERNA 2YMXL 4JZJA 4LHUA 2IAMB 3PRZA 3MLZL 4N2KA 4Y5VA 2YQ2A 4QRPD 2NX5B 5F8QC 4BA8A 1URIA 4FTVD 5LBVA 1S7RB 3P9LB 1T66C 8FABB 1JRHI 3ESPA 2V0AA 4I77H 4IU2A 2KKQA 3DURB 2VH5L 5EZLA 4PJ8B 4YIQA 4U1LA 1OAQH 3WY3A 2Y0SA 1KENH 3IFLH 3DOSB 2I26N 3TIEA 2EVIA 3QCVH 3KYOB 3WJMA 3IGAB 3ZZLA 1DYZA 1PY4A 5I73C 1RJLB 1MDAA 3BUTA 1IC5H 1QBAA 3VSUA 5CJ5A 4JG5A 4IOFD 3UIZA 1GH7A 4H26B 4IJ3B 4E41A 3FO9A 4JAMB 5IVXE 5T5FL 1U8IA 3B2VH 4S11A 1KWGA 3ARDD 5DD3L 2R0ZL 5CJQH 3PHQA 2GUYA 5BUGA 3GSVA 2X5PA 4NN5B 4QRTA 3CN3A 5JOPE 3IJ9A 3QRBA 1W0WA 2YD2A 3GI9L 3QCTH 2O30A 3NUKA 3S97C 1L0XA 3GZOA 3P0VL 4M5YH 5C0IA 3BYYA 5C0JB 1YEJL 5DRZB 1J5DA 5D1XD 1S7RA 1WS7A 1G87A 2YPKB 3O8XA 3ARDC 2R29H 5DJAB 1X5KA 5HDBE 4IKKA 3RU8L 2YGNA 3JUZA 3QDGD 4FDWA 2O5XL 2IEPA 3UZQB 3KBHE 3E38A 4C56A 3L9YA 2VLRA 1J1PL 2LAAA 4QXGL 2P49B 5ERWA 3B6SA 2I07B 2A6KA 2YXVA 1CLOH 2V9RA 4HJJL 1WDAA 4NENB 4LDCA 3KM2A 4OGZA 5HGBA 1WICA 4NO2B 2A73B 4JUSA 5C0AE 4AIEA 3QS2A 3SCMA 3QWNA 1IGTB 3VVVA 1KYOJ 4JPQA 1CLYH 2NQDA 2NR6D 4UAOB 5KS9A 5G5DB 4Y4KB 3MUJA 3ZE1B 3NPSB 1MCNA 3BZDA 1S5IL 3QBTB 1AACA 2ERJB 4C83B 4F9LA 5D96C 5AVWB 2J8UF 1EPFA 3HAEG 4P4KC 4JO4H 5C0CE 2J1KA 3GFUA 4JM2B 5ACZB 1E5BA 1U8QB 2ESVE 4NRZA 3QQ3B 4PW4A 1R3HA 3KPLB 3NFSL 4F8NA 4FFWD 2VL5A 1I9EA 2J8UB 1WFIA 1LILA 3BKML 4GI9A 1NBQA 4PJXE 4PWGA 4JM2F 3UACA 5IQOA 5IWLC 3EADA 2HSIA 5T3XD 5MENE 1HQ4B 4HLZG 2VLRB 1BZ7B 4HPYL 1KZYA 4FKEA 3B5TA 1A4KB 1YEGH 1Z32X 4GPVA 3TZVD 4JFQB 2YOCA 5J06A 4UIMA 4JY4B 4DO5A 5I0YA 1Y6MR 5E4OA 2WXLA 4MX7B 2WPGA 1HWWA 2G2PA 5FHBH 5GXBB 3L3KA 4JFVA 3H2WA 4QO1B 1LNUB 3TF7C 3THMH 3U0TA 2PN5A 3DX7B 1WTGT 4RZCB 2K8QA 4NM8L 4O5LL 3OHMB 3EG9B 1BYNA 3MBED 3GINA 3B7RL 5DMIH 2NY2C 1WA0X 1VSCA 3O6MH 4DGYL 3QJFB 2A7BA 3CFDA 1IE5A 1M1XB 3C5ZC 3IRCA 3W9DB 3KDMB 2E9BA 3L4TA 1MCDA 1H15B 4ZMYA 1QYGH 5EU4B 5DEFB 1BX2A 4X83A 1TG8A 5CINL 4G6AD 5LLIC 3V6FA 3V4PB 3OXRA 3G5XB 4R4ND 3U83A 2B0SL 2IPUK 4ZNCD 3VUAA 3DXAD 4XVUD 3V6OA 3OMIB 1ULVA 4NSKA 5J11B 3TO4A 3D30A 2VDMB 4FI6A 4I9WE 4EJ1C 5CMAA 3VFUA 1U8NB 3O3BA 2DLEA 5AAMC 4G6KL 5L8LB 1N3NB 4I3GA 2AJXH 4J6IA 4KROB 3DLQR 3FUHA 4O58H 1INDH 2VN7A 3HFML 4XCNB 1MIEH 1OE3A 3LKSA 1TQCB 5DMGC 4BELD 2H1PL 4FULA 4HK0B 4XC3L 3NQIA 3O3AB 3NYKA 5FCUL 4GKSB 1SOQA 2OJEB 5C0DB 1JPTL 1UKTA 4I77L 3FQUA 1AGBB 2R2HA 3BEWB 4R5VA 5ID1A 1MWOA 2CMRH 1MG2C 2C9AA 4OD1H 2OMXB 4M7JL 4R26L 2H0EA 1BD2D 5ESQB 4R26H 4NYLA 1U8LB 1MHEB 1ACYH 4J3OH 5C0GA 1IJNA 1BXUA 2R83A 4L4TB 4N8VA 1T83C 4GUOA 3SE6A 1T20A 3F6JA 1I3RB 3BFOA 1FSKC 5C3TA 1C8PA 5ISZB 1ZANH 5FM8A 3NFNB 3IGUA 3KNBA 4NM4L 1TKWA 4DWHA 3F04A 1FG9C 1FO0H 1FFRA 3GEWB 4UV4H 4GXFA 3S3DB 1UVQA 1H3GA 1RU9L 2XQBL 1I9IL 2BRRL 1FDLH 3KZ8A 1KIPA 3MA7A 2J44A 3S34H 4JPKL 1TNNA 5F9WC 5F3BA 4IBYA 3R8BB 4XCEB 3KXFA 5E70A 2UY6A 1SMOA 3WTSA 4JFPB 1TLMA 1UWGH 5G55A 5D2LF 1PG7W 5GS0C 4BXSV 4HZLB 2IFFH 3G5WA 1P4BH 4J2XA 3QJSB 2BINA 3FTWA 1WC7B 1XGPA 3U4BH 4UYQA 1RUMH 3VNZA 1RZKL 3CFUA 5I1JL 4ZOBA 4WTWA 4B7IA 4N8CH 4N2LA 3V6OE 4LMQE 4RGMB 5DC9B 2XT1B 5DUPL 1KCUH 2FX7L 4KK8C 2NY0B 2YGQA 3MBXH 4Z76A 1PFCA 1YRKA 5BW7C 2EO7A 3ULUH 4YHML 1ETJA 3BX7C 1CFNA 2OS7A 3OAYH 1RHHA 3ARYA 1IKNC 2BNRD 3LNDA 2GFBB 1VEOA 1JK8A 2DWYA 4LLQA 4WIQA 3QUYC 1NBZA 2WLLB 1YZZA 1I1YB 3HBQA 4FQXA 4A7GF 4K7PH 1OWRM 1P6FA 5FYKH 4YSAA 1BBJA 4MXVE 1OGAA 1P5UC 4HUUA 3EJZC 3PJLA 5FHAH 4ANWA 4GUCA 4LT7A 4M3KB 5EUOA 2AZAA 5FLVA 5LGHH 1V05A 4H2AA 2IBZY 25C8L 3VVWA 4WEMB 1ACZA 2QL1A 4A7VA 1AQDA 4FZ8L 1AGFA 2R29A 3OKMB 4KJYB 2NZ9C 4X98A 1J18A 3MV9E 1IJ9A 3GZQA 1IGFH 2YEQA 1GZPB 4DAGL 4LARL 2Z92A 1FFQA 4ZW8A 3LTVA 4PJEA 3GBLA 4UOW1 2D0FA 3MNDA 3O45B 4A7QA 5AAMA 1GR7A 3H4HA 1EXHA 4IKNA 1N8ZA 3UMTA 3K80A 4A6YL 2ID5A 3L4XA 4D8OA 1NDMA 1CD1A 1LEIB 4YHLL 3BPOC 4V1DD 1MRCL 2J57A 4IOSA 2WMPA 2G75A 1HEHC 2CO6A 3GMLB 4L8SA 2KPNA 2QGEA 3MHZA 3L9BA 4APQC 2EP6A 3LV3B 3NEXA 4QXTB 3V95A 4GO9A 5AOLA 3WJMB 1IM9D 3UZVB 3VFTA 4NQXB 1PEZA 3ATBA 4GP5B 3RBSA 1E9OA 1J0KA 1FI8C 4AL8L 3ZTJH 1GL4B 3HN5A 2YD5A 3IFNH 2LE9A 3SYAA 1MRDH 5IMOA 2DQFB 1HL5A 3JTTB 1HSAA 3ZYZA 2YS4A 5D1XA 4DN4H 1IQDB 4Q2ZA 3EGXA 5LCVA 1YN6B 3HB3C 4MNHA 1Y0LA 4NI6A 5ACLA 1NGXB 2ZNXA 3U6XS 1NC2D 5IFJB 3DUHA 2OJ1A 4Y8DC 4WKXA 4JRFA 3WL9A 5CEZL 3R7QA 5KW9H 3QORB 3HBPA 2YXWA 3ARBA 3GYRA 3LX9A 2EIZB 1WFMA 4X7SL 3B5GA 1UZ8B 4OZFH 5TK4A 1QZ1A 1KPRA 2O6EA 4GS7B 1SGKA 2AVFA 2XWEA 4QRUB 5HGHB 3VXTA 1U4FA 4W4NA 4PGEB 1SDDB 5J3HD 2WUBL 3FT3B 5TQ0L 4IQHA 5L4MA 5CWSA 4YDLC 3SDCB 5K9QI 1MPAL 4WNQB 5AZEL 3IAGC 3DTXB 5IHZB 1AQKL 3DMMB 5DUBB 4OY9A 4YBLB 3SZ6A 1Q9LB 4RGMC 4TN9A 3KYKH 4R2GC 3TO2A 2YKLL 1KCSL 4UTAA 3K6FA 3IXAB 5FS5A 4OD3H 1QTSA 4DP6X 4Z5RB 1R3KB 1LDPH 3N1MC 1MJ7L 2AKRB 2UZIH 1GGIL 1KUMA 3MLWL 5DEZA 3NK4A 3ZTNH 1BQHA 1HHGA 2R39A 1I8KA 3QDMB 5JDJA 4HISA 5J1SC 4A55A 5D4JA 3NPSC 4D0BB 1T1ZB 4LHUD 5SX4H 1CQKA 4FLOA 2ICWI 5AL8A 1PF3A 2DY2A 1JS4A 3LDBB 3LEVH 2J21A 4JFQA 4ENEC 3L5WB 1GGUA 4MKMA 2CRZA 4JCWA 4PHXA 1HSBA 3HC0B 1G7HA 5E2TL 1CI5A 1D7DA 3D85B 2XN9B 4Q6KA 3M88A 3WNLA 3QQDB 4L37B 3HPJA 2QKIC 4H0GA 4FLSA 4P5SA 2VQ1A 4UUJB 4MRBA 1CD9B 4ELDA 2EKSA 4H8VA 1GGCL 3NK3A 4UDUA 2X41A 3EYSH 3VI4B 4ENED 5AQ0A 4JG0H 1OANA 5KG9B 4U1KB 4Z9KB 3IFPA 3RAJH 5A2AA 4RZCA 1ZOXA 3VI4F 2WXKA 3X1NA 2BY2A 2BJMH 2VQ4A 3BSZA 3D2UA 5KSAB 2XN9D 3BWUC 4JRLA 3V4PA 4FZEH 3FU5A 5DHVB 2AQNA 5F89B 4BH7A 2O6DA 4WV1C 4ONOA 1NOAA 4XNAA 5I6MA 1I1FA 5KBKA 2Q3XA 4OM0L 4XWGL 4U7SA 3FFCA 4U1SA 1MIMH 5CU9A 3R7RA 4EAEA 1X6LA 4BSJA 5C0RL 5EUOF 1KIRA 2H8PA 1S7SB 1VZIA 4DIXA 1UXSB 5J6HB 1F3JA 3ECUA 3IDGB 1QLEL 2NY5C 2C9PA 1TCRB 2C7FA 4FFVD 4QRRD 2YJQA 3WKMH 1A7QH 4R7VA 4E5XA 2EC9U 4PY7A 1ETZA 3OKOB 2VZOA 2YGVA 2X9ZA 2R29L 4NO0D 1ZHNA 4OSUH 5CMAB 2P42B 1E40A 2GTQA 3W9DA 3FL7A 3CE1A 3KWXA 2WWMC 4CGUB 1JGEB 2ENYA 3IXTA 1JVLA 1PSKL 2VDPL 4JRYE 3EYQC 4YFLF 1L4IA 1R47A 2CR6A 5BS0E 5IEKB 3QJTB 4LLWA 4Z23A 1ASOA 3HA0A 3QIBA 3OXRB 3BXNB 1FVDB 2BCKB 1BLNB 3HMWH 4EVNB 1XCTB 3KPRE 4Z3FA 3TBWB 4XXWA 3RDTA 3FB6A 3HNSH 1JGVH 3UOAB 5A3IC 3W3BA 5I30L 5T5FH 2AI0L 4A68A 2YPVH 1I1AA 5KYUB 4OZHF 3W11D 3VXME 1A3RL 3SDCC 4NJ9H 4NQCA 2WQRA 5T5NG 4GIAA 3FSZA 1IGYB 4GQRA 1YDPB 4HD5A 2K4AA 2ATPA 3L7FB 5KW9L 5K9KA 3LKQA 1FZMB 4JCLA 3NGBB 2DPKA 2XHNA 5F3BB 1ZE3H 4IIQA 5D7IA 3QYMA 3QDJD 4IBTA 4O00A 3IGLA 4O02H 5IEHB 4N25A 1A7RH 3H85A 3D3VB 4OCXH 4EIBA 4QRQA 2AMGA 4MKTA 1OAXL 4IMLB 1P4LB 5H4YA 4PLNC 1MUJA 4XTRD 5C1MB 2BP0B 3FNKA 4XBGB 4LVNC 3B2MA 4M7LH 2FB4L 4L4TA 1OGTA 3ARZA 3KYMB 3G6JF 3T1WA 4KKPA 3WUWB 3T9WA 3DV4B 4OCNC 1BJ8A 4LOEA 4MQXD 4Q89A 3ZL1A 2IPTL 1LE5B 2BNUA 4X6DA 1A7BA 5JOFA 2GB2A 2EAEA 4X7TB 2AQ3A 3ARSA 5IF0B 2OR9H 2I9TA 3CPLB 4BQ9A 2J72A 2D7QA 3GXTA 3MRGA 5AG8A 1MFMA 2X6CA 4QTHA 2G5BB 4KROD 3IJHB 4ONGL 1FL6A 3QA3A 1ZHBA 2G30A 2XWBB 2VR9A 2ORBL 1HKFA 3EDEA 4WTXA 2X1PA 2ZF9A 4NHUB 4XMLH 2DM7A 2WBJC 3NCXA 4ALAC 5IB5B 1MJJB 1UACL 1NL0L 1N7ML 3F7KA 2X0WA 1X4XA 4N0UA 3MLSL 2Q10A 1CU4L 1PKQA 2FJHB 1UWYA 3BQUD 4DP2X 5DFTA 2IO5A 4YPGB 2W80C 4CU8A 2VLRD 1IAII 2X2HA 3CIQA 1BVNP 5LJYH 3NSFA 1PJ9A 4U1LB 3SBQA 2DWTA 3LKNA 5FUCC 3TPUB 2ZYSA 4X6CF 3TL5A 4PGJA 2DMCA 3T0EC 4XNUL 1EEYA 2V4LA 1J8KA 2H9GA 5ALBH 1KXTB 1FHNA 5BRZE 1CR9H 2ZPKH 4YSDA 4HG4J 4UTBH 3WAJA 3AROA 3S5YA 4IBLT 4JFHE 3HZVB 2OL3B 4BCZA 3DETC 3F7QA 1KCKA 1FWXA 3SO3C 3Q5TA 4ZPVB 4AOFA 1K85A 3CLWA 4PJGF 3TBVA 5KUKA 2VE6A 3BE1L 4ZD3H 5I1CH 5JHAA 1EJ8A 1A9BB 1TTCA 2A6KB 1I8LC 1JWSB 4ACTA 3Q6GL 4LNVA 2CDGB 2FJHA 3JZYA 5D7HA 3TCLA 1LO4H 5MERB 1EXUA 5EOCL 3CLEL 3SPIA 2NY1D 1CICB 2IXQA 4OCYH 2X0VA 3LRGA 1MRCH 3UTSA 5KVDL 5B7EA 4XMXA 3V9CA 3GSNB 1KFGA 2QSVA 3UTTD 5KYYB 1N2RB 1U2YA 2KERA 3VD2A 3ZKQD 1RIHL 1G1KA 1DJXA 2J2ZA 3OGCA 3L13A 4U1GB 15C8H 1OW0C 2AJUH 1UT2A 3HRZC 3VFRB 3VXSD 3EBAA 1PX3A 2DM4A 1A0QH 1JPGA 1TPXB 4G1MA 3TA3D 1LMKA 4C4KT 4KVNL 5L4JA 2GYSA 1GYVA 1JUFB 3PGCB 4LSPH 5D1ZA 3WJLC 4X6BB 4PI0A 3PS6A 2F18A 2HLFC 2C1OB 3FU3A 1UT9A 3ISYA 3G5ZA 2BOCA 4D3CL 1BM3H 1TZHA 3RPIB 3VXQB 5D55A 1BFOB 3OKEB 5DRNB 4MX7A 3OC8A 3IJEA 2CDGA 5I6XB 3V5HB 4HHWA 3RIFF 3VTTA 3PQYD 5E8PB 2DM3A 3NJJA 4XN1A 1L9NA 1SUHA 1MDTA 5ETUB 4BRJA 4JQXA 3E2HC 1XD0A 2F53A 4ZQTA 5J0BA 4LVEA 4L3EB 3CC5B 1XMEB 4ENZA 1ZDSA 2WLIA 3SJVA 1W72B 3SKOB 1YVLA 4K94C 4MJ4A 3JXAA 4G80B 1G9MC 2ZYIA 5HJBA 5JZ7C 5LGJB 4ONFL 2X6UA 2CPCA 3UTPD 1B6DA 4HJUA 2HPTA 2H2PC 1NL0H 3HUJF 3G6DL 3IBOA 4OKVA 4OQ1A 3V6FB 4H1LH 5EF2A 7PAZA 1L7IL 3CFBB 4S1QL 3K8KA 3WNMA 2X9WA 5LGYA 4WWKC 4HSQA 5FKPB 1BVKA 4BZ2H 5EDSA 2XVBA 1X9RA 1IBGL 1NWOA 3ZKMD 3F8UB 5GS1C 4NCC1 3E8VA 4L9LC 3UFIA 1DJZA 1V7ML 1KWKA 3CFDB 2IANA 3STBA 4U31A 4AEHH 1KJ2A 3S96B 5BOJA 4XMLL 4NT6B 4HJGB 3MBEB 2ZSVB 3NIDF 3QJOA 4OCSL 4LVOB 4XN2A 1G9EA 1RPUA 3VRIB 3CK0H 4QHKJ 1OT2A 1CDIA 2FHCA 3QZNA 4W6YB 1OCOB 2VQ1B 3VXUD 3VA2C 1BXVA 2VL4A 5F7WC 1T1ZA 5T5FA 5FX3A 3HG2A 4Y4HD 4X8XA 5DK0A 2B5IB 2PTTA 3LJ3A 4ZQKA 4OI8A 1JWMA 2XRAL 2EXTA 1J12A 4F2MA 1LL1A 1FFPA 1QATA 3GS7A 3NCJH 4MA3A 3TO4B 4CADA 2Y7OA 1T83A 3P1VA 4CSTA 3NN8A 4A2GA 2MPAH 4G5ZH 2FEEI 1U58B 4Q97A 3NABH 4QF1B 1SEQH 5DJXA 2LVEA 5D7JC 1F4WL 4HLZH 4I3SH 4XP5L 5E7BA 5D70L 1S9XB 2DQJH 4QRAA 3ZLQC 4Q14A 4E5XB 2H3XC 3MNVA 1HKLH 3WE6B 3H56A 4WO4D 3WN5A 2DKSA 3IPEA 3QG7H 5C07D 1MAJA 4HUKB 1KIRB 2H8PB 4JRXE 4GKLA 4AQ8C 2XOTA 1IUZA 1LO5B 2CAKA 4H0HB 2HRHA 3MLVL 3A6BH 4N6RB 3ZKXB 4PJDB 3I75A 1TZGH 1Y1DA 1YQ2A 4G7SB 3IK2A 1U95A 3QEUB 1WV7T 4L5FH 3V10A 4ETYA 2MEJB 1MJUH 2NSXA 4YSSA 1QLEB 4JG1L 5T3ZH 4BUQA 1EHAA 2HJKA 2PUQT 5LCVH 2G5UA 4MB4A 4ZNEA 2DAVA 5L7XH 3WEOA 2LLLA 1F3JB 3IDGA 1Y7VA 1AO7B 4I88A 5HHNB 1YAZA 4PIBA 1JERA 1CLOL 2X1OA 1G9MH 1EEZA 3QH3A 5I1IL 2YJLA 4K5OA 2CUMA 3SBWA 3CH1A 2UWEB 2FECL 3PYCA 4WKZB 1PMYA 4F9PA 5L9DH 2VSKB 4OGXH 1TDQA 4ZUTB 2P5EA 5ABDE 5JHDD 2JE8A 3V5KB 4ZO7A 3BUDA 3RU8H 2D3JA 2WLHA 2ZXAA 3KLLA 4BWWA 1KB3A 1CUOA 2IH9A 2ED9A 3H2QA 4G5AA 4PSPA 3VDAA 2MJWA 2GFBA 3EFDH 1MKFA 3GHEL 2R2BB 3MNZA 1JI2A 3IDXL 3ME0B 3L1OH 2EDEA 2XY2A 5C70A 4KH2A 4MD0A 2JCCA 2FLRT 3NJGA 1SLUA 1RVFL 1G9NC 5DJCB 4M7LT 4PCSA 4KDTA 4TSCH 1H8SA 4X4ME 2VN4A 4FXKB 4PV9A 3MRMA 3G08B 1CQYA 3FO1B 2ZWKA 4KXBA 1EFXD 4BQBA 5I8CB 1HINL 2DJ4A 5E6ZA 2ZXDA 1IGYA 1V7NL 1WO2A 5EO1B 4UQAA 3CVCA 3QJRB 4GMSH 4P2QE 5BZZA 1QLFB 3OLEA 4IHOA 4LU5L 4P23A 3EYOB 2IH3A 1ES0B 1LE5A 1CGWA 3UDWA 1HZLA 1E5ZA 3MLSH 3NCWA 5EIIB 3D18B 1UCBL 1NPUA 2YQ3A 1ZXKA 2VO8A 3MJWA 4OF6A 1BAWA 4MA8H 4X6DF 5IFAL 1NA8A 2QPUA 4PYHA 4BM7A 4XBGA 5DQDL 3DIFA 3TO4C 4U3CA 4LIQH 5T1DH 2C4XA 1WWCA 3TJEL 4ONGH 2Y2YA 2XTJB 4QXTA 3V0WH 2J73A 5I28A 4RQQA 1NUNB 1IAKA 2E9GA 2X4SA 4OB5L 5F9OH 4NP4L 2BVUA 3NABL 2ROYA 1ZT1A 3NSDA 4BSVB 3FTGB 2GK0A 4XH2B 1BA9A 3TA3A 4OJDH 2V2TB 1B0RB 2R69L 4JR9L 5DRWA 1CD1B 1G0DA 3IAPA 1XH1A 4GIPD 1LEIA 2R4RH 3GK8H 3L3JB 4UBDD 5BQ7B 3F00A 5DEJA 3MV7D 3V52H 4XN9A 4CC4C 4HT1H 5B8CB 5IVXB 4QTIL 4JJHA 1K6QH 2I5YL 1MCJA 4NHUA 5F1OB 2LTQB 2YD1A 1QSZA 4JJOA 3WSQH 1XZ0B 3TJHC 1TVBB 1MFBH 1DUYB 1O6TA 2BXYA 2APFA 4BE5A 1LWRA 3LCYA 4H4NA 1ORQB 1ZVSB 2APVA 4Y8AA 3FH7A 4HIHB 1JF1B 1FZJA 4A04A 3KPMB 4P2RB 5E2UL 1XZWA 5AOIA 3OKDB 4IU3B 3BLBA 3DBXA 1FUNA 3B2VL 4LCVA 1CLZL 1SBSH 3S88H 2X1QA 3DARA 2AK4D 4RAVB 1U3ZA 1EUTA 3PHOB 4LSSL 3FT3A 1JNNL 1KDIA 2K6YA 1IZKA 3SZKC 4YHYB 3DXAB 1EEYB 4JPIB 4R4FL 5FGSA 3O4LE 4GBXC 2BHYA 1MRFL 1C5BL 1UQSA 1AS7A 3EJZD 3Q05A 1M71A 1RK1A 3PGFL 1FORH 1DDTA 1B0GA 4JGJA 4L1BA 3ZHLA 1G1YA 1MCPH 4QKTA 4HS6B 2QQLH 3DO7A 5DUJA 3WO4B 4J7RA 5EC2A 2DN7A 5JIKA 1PSKH 1UH4A 4Z77B 2LFGA 2VNCA 4KI5D 3D4YA 3QQXA 3U36B 3F05A 3M8OL 4PMEA 3U1PA 2GITA 2VRAA 4EXPX 2HG5A 2AKRA 5H2BB 1D6VL 1AGDB 1KJMB 1LXMA 2J1XA 3DBXB 3FRUA 4UILL 3G6AA 4HSAC 1IC0A 2JELL 5I82A 5I8KL 5FV1L 5DA0B 3HNTH 3IPBA 2WB7A 3RVTD 3IM1A 4P5MB 1TZHB 4MZRA 1J7VR 5DQ9A 4Q0XH 3RB5A 3KPPA 5A6LA 1NPNA 2OMVB 4L8CB 2B7DT 2CBQA 1SJXA 5DEFA 4BINA 4Z7VA 2LU4A 4O02L 3BHBA 3RPBA 1A6PA 3MCYA 1W0VA 4YHKH 1TIUA 1T22A 2P7TB 1A6VL 3SGJA 1CO1A 1H6UA 4XPHH 4ZX6A 4KHXH 5KVEL 1XCXA 3FONA 3SO3B 2Z7WA 4M03A 5HPMA 4LCWE 3M45A 3GNMH 3U36A 3BKYL 1KCRL 4JFFB 5JA8B 2V3DA 1IM3B 4U2ZA 4UNUA 5I1AA 5JHDB 3GM8A 1QBBA 4PJ9C 5ALBL 4KTEL 1XR9B 3ARXA 1BV8A 2P24A 4XVOA 3IDNB 5CJXA 5JW4M 1KSRA 1BWWA