2A3TA

Cu-containing nitrite reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
b'LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Structures of the oxidized and reduced forms of nitrite reductase from Rhodobacter sphaeroides 2.4.3 at high pH: changes in the interactions of the type 2 copper.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA02
1GS6X 2P80A 3GYRA 2UXGA 4PAZA 5A7EA 1M57B 2BP8A 4GP4B 2IWEA 2XXFA 4HAKA 3ABLB 2J56A 1I53A 5B7FA 1L9RA 4YSDA 4P5SA 2IDTA 3ABGA 4G7RB 2HRGA 1NIDA 4RH4A 3SBQA 1PLAA 4NB7A 1JZHA 2B3IA 2YAPA 2OV0A 2PP7A 4Q8BA 3NJMA 2N0MA 1KCBA 1AS8A 4YSCA 1E30A 2BP8B 2J55A 3JT2A 5I5JA 2UXTA 3EF4A 1A3ZA 2DY2A 5B7MA 4JHUA 4YSTA 1FFTB 4AZUA 1N68A 3AG2B 1M9WA 2PPEA 2VN3A 1KDJA 3CG8A 5D4JA 1A65A 3T6WA 2XYBA 5D4HA 4A2EA 3AG1B 1QNIA 2VMJA 1AZUA 1PY0A 4DPBX 2CUAA 4CSZA 3PLYA 1KV7A 2BZCA 2QDVA 1JZIA 2IWFA 2BWIA 4A2HA 4DP4X 4KOCA 2JXMA 4F7KA 2YAEA 1JXFA 1J9SA 2BZ7A 3QJVB 4AKQA 2OCCB 3S3CB 1ETJA 1AANA 2HX8A 1SF3A 1MZYA 2BO0A 1ZPUA 2DWTA 3FSWA 3HB3B 5I5MA 1KDIA 3CVBA 2BP0B 1GY1A 3IN0A 2XV2A 1EZLA 4N4YB 2EIKB 1AZBA 3FPYA 3NSYA 2H5UA 5I28A 1NWOA 2MRYA 3UAEA 1ZV2A 3BVDB 3EH3B 1SJMA 4X4KA 4BDVA 6PAZA 2EINB 2CAKA 1N70A 4E9TA 1NIEA 1J5CA 3CVCA 2FQEA 1OCOB 1PMYA 3NSDA 1GS8A 3NJKA 1V10A 1GYCA 2RACA 4GY4A 2YAMA 2XUWA 1A8ZA 1ASOA 1NIFA 3D12B 1SFDA 1NWPA 2QDWA 4ENZA 7PAZA 3ZBMA 2YAHA 3S3DB 4BDVB 2IAAC 1ET7A 3PAVA 2PPDA 4Q89A 1RZPA 2QT6A 2CBPA 3TASA 4JKNA 4A2FA 4A2GA 3PCYA 1SDDA 2XV3A 1IBZA 1TU2A 1WS8A 3FU9A 3N2JA 4G7QB 2FNWA 3QQXA 5B1KA 3AG4B 2MTAA 1HAWA 3N55A 3V9CA 3SBRA 1JZEA 2AZUA 4P5RA 1J9RA 1NTDA 3EH4B 3NJGA 2GBAA 4KO9A 4E9YA 1AZRA 1OE3A 1L9TA 1HFUA 4KNUA 5TK2A 1MZZA 3NP4A 4YSQA 3PAZA 2BW4A 1ET8A 2CALA 4BWUA 3T71A 2J5WA 2YXWA 1KCWA 1R1CA 4KOBA 1BXAA 2E86A 1SDDB 4HCIA 3X1NA 4QLWA 1QHQA 4K9JA 3FQ1A 5B3SB 1AR1B 2YQBA 2X88A 4E9VA 7PCYA 1IUZA 1ILUA 1FA4A 1JERA 2YAFA 3FYIB 1FWXA 3WG7B 5I6KA 1A4AA 4DP0X 4KO7A 5E9NA 5AZUA 2J57A 4G7SB 3NP3A 2VW7A 1ASQA 3PAUA 3T9WA 4ZK8A 2UXFA 1KBVA 2A3TA 3DTUB 4UANA 1BXUA 4JHVA 4WTQA 2EIMB 2IDFA 2GSMB 4HHWA 1W6LA 2FQDA 3BQVA 1AS7A 3AW5A 1JXDA 2YAOA 2GHZA 2IH8A 4KO6A 5I6OA 1PNCA 3TBCA 4HZ1A 1J5DA 1URIA 2GI0A 3U25A 5I5IA 2HZHA 3IN2A 3WIAA 4FA7B 3GXUB 1GSKA 4AI7A 2DV6A 2EILB 4YSPA 1W8EA 3OM3B 4A66A 5IY5B 1XB3A 1NIAA 1E65A 1V54B 3C75A 2BW5A 2R7EA 1DZ0A 4PCYA 2XVBA 1XB8A 2UX7A 4BXVA 1MG2C 2W8CA 1AACA 1OCZB 1CUOA 3RYMA 3FSZA 3WKQA 3OMNB 1VLXA 2FQFA 8PAZA 2VW6A 4HALA 2Q9OA 1IKOP 2WO2B 4A67A 2I7SA 2HLEB 4HHGA 5I26A 4E9XA 2PPCA 3QPKA 3ZX1A 4G71B 1GY2A 1NDTA 2GC7C 4DP2X 4FAAB 1KYAA 3ZDWA 2DYSB 1KBWA 2FWLB 3PXLA 2LLNA 1AZCA 5AKRA 3UGEA 1ET5A 2EIJB 1WA2X 2VSMB 2R7EB 4CSPA 1OCRB 3SBPA 5I6PA 1RZQA 3PPSA 2DYRB 3OMAB 1NIBA 1BQRA 1AAJA 1PLCA 5D4IA 1PZBA 2TSBA 3ABKB 5F7BA 5B1BB 3MBWB 3NSFA 3NJLA 3WKPA 2JKWA 4A68A 1OCCB 1L9PA 3UABA 4UF7C 4QKTA 2DWSA 4DP6X 1W6WA 6PCYA 5B1JA 1CYXA 2W88A 4MFHA 4DPCX 1BAWA 4KNTA 5AFAA 2XWZA 1WAEA 3ZIYA 3JTBA 2H3XC 1BQ5A 4E9SA 4AX3A 2GC4C 1AIZA 1YLBB 3QJUB 3NT0A 2IH9A 4TXVB 3L45A 9PCYA 3CVDA 2FT7A 1L9OA 2FQGA 3AG3B 1AOZA 3S3BB 1JVLA 2AFNA 1JOIA 5PCYA 5FC9A 1OE1A 2YXVA 5I6LA 2PCYA 3IBOA 3FPXA 2HX9A 1JXGA 2ZONA 2ZOOA 2P80D 1KGYE 1AG0A 2XU9A 1RCYA 1X9UA 4GP5B 1A4BA 3IEAA 3TU6A 1L9QA 3DIVA 1V55B 5B1AB 4DPAX 4L0PB 2AZAA 2YARA 5LDUA 3AY2A 1NPJA 2HRHA 2UXVA 5PAZA 1GS7A 2FT6A 1SHWA 1QLEB 4NERA 1AG6A 4KNSA 3CZUB 1E5YA 1CURA 2VSKB 1ID2A 3FYEB 1BYOA 1M56B 1PLBA 1PZAA 3G5WA 4W9ZA 1AQ8A 3H56A 5I6NA 1L9SA 1NINA 2PP9A 4E9RA 1PCSA 1WA1X 2BHFA 3NJFA 3H4FA 1GW0A 3WNJA 3QJTB 1ILSA 1RKRA 3CDZA 2GB2A 4YSOA 3FU7A 4UAHA 2IDQA 2ZWNA 1TEFA 2BWDA 4GXFA 3QJQB 3WNIA 1XMEB 3HEIB 1WA0X 3TA4D 4W1TA 1ADWA 2JFCA 3NJIA 2PCFA 1SHXA 5B7EA 2X87A 2B08A 3NJNA 1ZDSA 2XX1A 5F7AA 4E9WA 2Q5BA 1SFHA 3S8FB 4EF3A 1BYPA 1SNRA 2WO3B 1NICA 2I85A 1JVOA 1E5ZA 2UX6A 3FSVA 1OOWA 4AKOA 1J9TA 4DP7X 3ABMB 3CDZB 1B3IA 1CC3A 1T5KA 4YSRA 3FU7B 3FS9A 2NRDA 3ASNB 1ZIAA 5B1JC 4HIPA 1AS6A 4GYBA 4N8UA 2PLTA 3SQRA 2IWKA 3X1EA 1PZCA 1DYZA 4YSSA 1NPNA 3X1FA 2OJ1A 1XB6A 3UADA 2BP0A 1BQKA 3NJHA 3X1BA 4BWWA 4F2EA 4M4RB 3QJRB 3UACA 4YVUA 1J9QA 1WS7A 3IE9A 3EHBB 1BEXA 4GP8B 5I6MA 4DP8X 1TEGA 2Y1AA 4BWTA 2TSAA 2XX0A 1PF3A 3DKHA 2IDSA 1MG3C 2CCWA 1F56A 2QPEB 3QJSB 3UAAA 1HAUA 3FQYA 4YSAA 4G70B 4A2DA 1X9RA 1A4CA 1TKWA 4NAJA 2GIMA 2FT8A 4KO5A 4WKXA 4DP5X 1AZNA 3T6VA 1MDAA 3OD3A 4DP9X 1JZFA 4HCFA 1SF5A 2VM4A 4AKPA 2ZXWB 3TBBA 2HXAA 2XV0A 4HCGA 2PPFA 3KW8A 3FT0A 4YSUA 1JZGA 3NJJA 4E9QA 1OV8A 2XLLA 2HX7A 3ERXA 1UATA 3NSCA 2PPAA 4F2FA 1IBYA 3H4HA 3OMIB 1OE2A 2FJSA 3FQ2A 5TK4A 4G72B 4M3HA 2AVFA 1GR7A 4YVNA 1PNDA 2XXGA 2IDUA 4YL4A 2FTAA 3FU8A 2CJ3A 1BXVA 3MX0B 3NYKA 1IC0A 1E67A 3S8GB 2H47C 1OF0A 1ZIBA 1PAZA 5ANHA 4YSEA 3GDCA 3AZUA 4BK5C 2VW4A 3X1GA 2QPDB 1NZRA 2YAQA 1EHKB 3OQRA 4DP1X 2PP8A 3ASOB 1ZDQA 2VM3A 3T6XA 4BXSV 1ASPA 2I7OA 2WSDA 2Y69B 5EHFA 1CYWA 3KW7A 3X2QB 1JZJA 3FSAA 2AANA 3WI9A 3EH5B 3T6ZA 3V9EA
chains in the Genus database with same CATH superfamily
3DJZA 4QRQB 4ZW8A 2VLJA 4R3SB 1BFOB 2FJGB 1XIWD 3RGVA 4ZX3A 1T89C 2UXGA 3D1MC 1NGYB 1EAPA 2EKSB 1JP5A 1KCUH 1D6VL 3LKQB 3FFCD 3PUCA 4WJ5B 4N2LA 3LNEA 4L8BB 3C5ZB 1IGYB 3ABLB 5JDSB 1I53A 2NUTA 1CWVA 4K2UL 4W9EC 4L2YA 5A2IH 5FDWB 4HPOH 4ZS7L 5D1XD 4EEEA 1ACYH 5FK9A 2O5XH 2QZQA 1KJ2A 2B1HL 3TV3L 3MBEC 2OXGA 3TCLB 1V5JA 4JFFA 3A24A 2X4RB 2C9VA 4EVNA 3CSYB 3IDIA 5T5FA 3BPOC 5HVFB 4U05A 4PBWD 5J1TC 1RZKC 3H54A 5KVMC 1OGAE 4HJGA 4QOKA 1MUJB 3FHQA 3MLWH 1RUQH 2DI9A 5I19H 4N8VG 1GYAA 4PLNC 4Y5VA 3T6WA 3BVNA 4UAOC 3MMEA 5C0IA 3N0AA 1QNIA 1JV2B 2VC2B 1P6WA 1MVUA 4AQ8A 3FCTB 5IM7B 4F7MA 5HHXL 4S1RH 4NC1C 2R4SH 4PTTA 3TX4A 2YS4A 4LLYA 5CZVH 3OGCA 1E9PB 4EXPX 5EZIL 1TIUA 2BZ7A 2P5EB 1T5WA 2VQ4A 4LHUB 5I1LA 3D69A 3Q01A 1U3HB 1NKOA 1MFDL 4GSRA 2VZOA 3GSNA 3HB3B 2ITEA 3FN0L 1NDMA 3GSOA 1YPZA 1J8RA 3K91A 4I1NB 1PS3A 4L8DB 3KR3L 4P5TD 2F54D 2EC9U 2X4OA 3DARA 3UJTH 1QI4A 4EI5D 1AQHA 2I5YH 1NBYA 2VR7A 4LVOB 5GS1C 4DNLA 4IRZA 3DMMB 4OCYH 2FECL 3I50H 1D5RA 1YYLL 3QORD 5JHLL 5ABZA 3NA9H 3NFNA 2J4WL 3NCYP 2LVCA 5D71H 3MV9B 1U3JA 3TO2B 1CD1A 2FLBT 3B1UA 2DQJL 1NL0L 3CLFH 4D8PA 2W0FB 4W9LC 3WYRA 2WMPA 2UWEA 2X40A 3PABB 2JJSA 4N5ED 4KTYA 3SKMA 1Z9MA 4Q4IA 4ZMAT 1B4LA 1TENA 1J7VR 4V11A 3ZHFA 1YEDA 2RA1A 2DQFA 1Q9LA 1JUFA 4TRPL 3SKOA 2CDGB 3HE6C 4LF3B 3MJ7B 2WQUA 3E6HA 3TASA 1N9PA 4AQ1C 1CLVA 1MQKH 5IMOB 2C26A 1YVLA 1KGJA 3D0AA 3N2JA 3BZ4A 2L3BA 1S3RA 3H9ZA 3N44F 2EKJA 1Z5HA 4OQTA 1SJXA 4XMPL 2P47B 4EE2A 3BEVB 1KIQA 3W0WA 1TFHA 1FZKA 4OCWL 1KB9J 3WLBB 4I4WA 1J9RA 2K9FB 2GBAA 4N3TA 3CFBB 4PG2A 3SYPA 1RI8A 2CDEB 5C0EA 1BA9A 2VO8A 2COQA 3UTSB 5AW5B 3WEXA 5DHEA 2Z31A 3T5WA 1JN6A 1R1CA 5HD8D 5T1LB 2F7IA 3RZWA 3C5XA 1E8YA 5JR1L 4X6DA 3JWNG 4AGMA 2FECI 2HTKC 4E9VA 4S1SH 4XR8C 5IBUB 5CJOL 1OY3B 3DJSA 1XCXA 1IAMA 1OAXL 3BISA 3TT1H 4ZUUA 1RJYA 4P46C 1JHKH 2WSPA 4JPSA 4XMTA 3IPBA 4XN4A 2XVLA 3CFUA 3D18B 1CFSB 1SEBB 5IB4A 3T9WA 3NFSH 1QUNB 3JWDC 4JFEA 3Q2LA 3WXVL 4WTQA 2D7OA 3QDJD 2FGWH 4UYPA 2PW2A 1KGWA 5KBMA 1W6LA 3H3PL 4FQCH 3U2IA 1AS7A 2YD5A 3IXAB 4WENB 2DDQH 2X9WA 4RDQG 5T1MB 4PJHB 5GHWL 3Q9PA 3ZVVA 3SDYH 1QBAA 1Z7JA 4OM0L 3FQ4A 3QVAA 3H7LA 3SO3C 4X5XB 5DD5L 2VRKA 3QPQD 4X6CF 3WJLC 1N59B 2EE3A 5DZPA 3WN5A 1N7ML 1NIAA 4XNUL 2PUQT 1HEZB 3SQOH 4JDZB 1OGTB 1LEIB 1DHKA 2ZG3A 2FEDC 3FSZA 5MI0C 4RVBA 1UB5A 3ARBA 1DVFB 4FX5A 1JZ6A 5KBNC 2V3EA 1U6AL 3K6NA 3QNYB 4EQ3A 4HHGA 3RWJA 3N42F 2C3GA 4G8GD 2E7LC 1HCVA 3CX5K 2ZXCA 2C1OA 3FXIC 1ED3B 3BUQA 3ZDWA 4N6QA 3SE8H 3T1FA 1QLEH 3SQBB 1MWOA 4W9CC 3AMLA 3P9MA 1PZUB 3QB7C 1HU8A 1SY6L 2GTZB 1F45A 3SE3C 5MEOB 4N5UA 5JHMA 2XZCH 1N0XL 1DEDA 1A7RH 1UM6L 4L8CB 1UENA 3N1PC 3EOTL 3WKPA 1RIVH 1DN0B 3BYTA 4ALAH 3ML9A 1UA7A 1CS6A 3U82B 3IJEA 1IJ9A 4L4TD 1W6WA 4GI8A 2B5IB 4MFHA 1MWAB 1XL4A 1RJLB 3LKRA 2DQGL 4FERA 4BRVA 4PJ7A 1TZ8A 2CKBA 1KXQA 4NQUA 1OK0A 4ZFOA 1OAQH 4NNYB 3VGFA 1V7ML 2OM5A 1FE8H 5C0BA 1NGPL 2QQLH 1QPKA 7TAAA 1P69B 2OZNA 5EIIA 3MV7E 2GABA 1L3WA 3DX4A 3Q8BA 4D9RE 5FAAA 1CDUA 3EFFB 1VPOH 1A6PA 3QQ3A 4N1EA 2BC4A 5DQJA 1F41A 5CAYB 3H9HB 3FO1A 3MLZH 4IIQC 3HTLX 2O30A 4LCYB 4I18B 4IEFB 1QLFA 2XA3A 4WTZA 3AREA 4GFXA 1NUGA 1JXGA 5A2KH 5D55A 2ZOOA 2PYEE 4XCNB 1X5KA 4FA6A 1JGEA 2IGFL 1FRGH 4ISVA 5DT1H 2OJEB 4M1GL 1HNGA 4DK3A 1X6NA 1IGJB 2DQHH 2AZAA 2VC2H 4JRXB 4MYWB 2ZIDA 5F9OL 5J5EA 1E50A 1M7IB 4JO2H 3K2UL 4Y2OB 4DAGH 4PB0L 4FG6C 3V0HA 4RLDA 1AMYA 3EYUH 5KYYA 2DQTL 4KNSA 1DL7L 4YWGL 4JPIB 3QI9A 5CR1A 5GGUA 2VWEE 3NSJA 2UV3A 4FQXB 1A7QH 1PL3A 2WLJA 2L8AA 4BSVB 3NABH 3W81A 1QRKA 4MDRA 4LDCA 3PHQB 5GSRB 2WLNA 1WA1X 2WKOF 3ARRA 5D7JD 4Z9KB 1P4IL 5C08A 5IJCC 3VFNB 4BV1A 5IUCA 3BVUA 4RFOH 2NY1B 2VQTA 2WBJB 3I9IA 1A7PL 3NIGE 2IDQA 4R96A 4WHTA 3VDAA 4KXAA 4HOWA 5FECA 3W11C 1V05A 4HZLA 2OS7A 3B6SA 3AQXA 3K8MA 3L6FB 4U6YB 2FJFA 4W1TA 5KEZA 2JFCA 5I0XA 5D5ME 4MA8L 1PIGA 1NJ9A 1IM9D 3TWCL 1T2QL 2XX1A 5DYOB 3ARGD 3TCXA 4XVJL 2FO8A 5ERWB 3KLQA 4M4RA 5BZDB 3ARTA 5K9JL 1MJJA 1PVHA 2HVBA 2CIKA 3QIBC 3B7YA 3QNXB 2VLME 1I1AA 1RUML 2VXTH 2WGNB 1U93A 3S98A 2D7TL 2XY1A 4M29A 5GGTH 3PWPE 5EU5B 3FO9B 4MAYA 1T5KA 4WO4A 3ASNB 4H8UA 4JRYD 5AEAA 3QHZL 2IGTA 2D0GA 3BD3A 2ZXBA 2LU7A 4QXVA 3SDDA 1E4JA 4NRXB 1J1XL 4PJDA 3BRGC 1DYZA 5L4IA 2CO7B 1E8ZA 1MCPH 5DR5H 3K71A 1YDPB 4J2XA 1NLDH 4XI5C 5A6IA 1AXTL 4AVKA 1L5GA 2MPAL 3QZWA 5IJVB 2CSPA 5D8JH 1CLZL 3KPQA 1WT5C 1A7OH 2G2RA 2WLMA 2NDFA 4KHXH 2J6EL 2ESVD 5ESVB 4XPGH 3IE9A 1EO8H 1JRHL 2JIXD 1IL1B 2ALAA 4ZZKA 1UH2A 1FGNH 3BD5A 1UD8A 1HCYA 1S7UA 4M4PA 4HMEA 3ME0A 4A04A 1FNEA 3Q5OA 4IBZA 1MAJA 4PJEB 3DKHA 4R2GC 4RNRA 4JJOA 1S7WA 2X6MA 3GMOA 1C5DA 4O4YH 3VRIB 3VMPA 5B39G 3DLQR 5DDHB 5BUPA 3U0WL 3LNHA 2CU9A 1AI1L 4KQ4H 3FTVA 4YX2L 4A6YB 1RZKL 1O7DE 5CMAA 5DD1H 1ZWIA 3DROA 5TH2B 1N3NB 1P4BL 1FYTD 1GYVA 3CC1A 4IW4C 4WUKH 2ZXDA 2WQWA 3EGSA 3MREA 2FBRA 2FHCA 1KXHA 3VH8B 2E27H 3MOAL 3SN6N 1V3KA 4YEFA 5IFJA 4X8JB 5B4MC 4R26H 4FNSA 4G72B 3IB4A 3VFTB 2HT4C 3VFSA 5IGXL 4WW2B 3L7FA 4JGJA 1ZGLB 3BEWA 1ZHKB 5MEPB 2N0KA 4GRWE 3W37A 5K1NA 1ZJBA 2HRLA 3QCVL 4L3FA 2FTAA 3G6DH 3QARA 4RISL 4F7CA 5LXGL 3IGKA 3VSTA 3PV6B 2H47C 1OF0A 4C8XA 1JYVA 3VUAA 2HT2D 4IU3A 3T65B 5IQ7H 4PJ9D 4QXUH 2H9GB 2H32A 1LD9A 1VZIA 3CE1A 1NZRA 3KWWA 1G0XA 1T0MB 3OQRA 2PP8A 4AW4A 1VENA 1JRHI 5DS8B 3U9PL 4ZMLA 3FK3A 4X7DC 5EOTB 3RWDA 4HG4K 2W07B 1KIRB 2G5BB 1CYWA 4ZFZA 5FLVA 4NOBA 1LQSR 3EH5B 3PJNA 3NIGB 4H8PA 3FFDA 3CXFA 3GPSA 4NGHH 1EGJA 1CICC 4ONFL 1GJWA 3G5VB 2J6WA 2NY7L 4PRIE 1QI5A 5FO7A 4CVZB 1KPRB 3WBDA 2GTQA 2CKNA 2JCCF 3NCXA 4MA7L 5AOZA 4AJVA 3R06A 3VCLB 1UVQB 2K6WA 3BZ5A 4WRLA 4R90H 4WVRA 1I31A 4FFVC 5J57B 3EADA 5F7DB 4OF7A 1JZHA 1P84J 1FVEA 2HTKD 4UB0L 4NCDA 2X70A 1BX2A 3MNWB 1KXVA 5BS0D 4DHLA 2AEPH 4YHKH 3GSUB 2VLRB 2W59A 4J2QA 2HTLC 3CPLA 5KVGH 3QNFA 4OZFA 4TLUA 3R7QA 4P46D 5CD5D 2ZP8A 3FOMA 1NC4D 4PJCF 3TBWB 4N2BA 3BP4B 4Y4FA 3IS1X 4BQCA 3R4RA 3EYOB 4JEGB 5GZOD 1XO8A 1KNOA 2FH6A 1MOEA 3DHPA 2EIZA 3LN5B 3PHSA 4XPBL 1ZLSH 4OZHE 1SEQH 2UVEA 1EFQA 2BRRL 4LVNB 2Y1ZA 5EU6A 2M1KA 4HVBA 3ETBJ 1NLBL 1RQ5A 2BZCA 4HUWA 4W4NA 4X4ME 3U4EA 4N9GB 3RFZC 2QSVA 2G4GA 3IDYC 4Z3HA 3NRPA 3QZLA 2ZX9A 4KMTL 5AUMA 4JKWA 3AFLA 4B9KC 4JM2F 4JJ5B 5CP3H 5DWPA 3VVWA 2PW1B 3REVA 1VACA 3B56A 2EXWC 2DRUA 1KB5L 1GSMA 4U1KB 3W9DB 2FEDD 3EGXB 3EBHA 4OZIE 1DR9A 3J7HA 4P2OC 4FNPA 3JWDL 4NN6C 4WU7B 2G4EA 3U48A 3BZFB 5DEGB 5BRZE 1EZLA 2Q3ZA 2NX5E 1DE4B 4FQJH 5AL8A 3L3OB 1EX0A 2HLFC 3L8QA 1D5MA 4RMWA 5D7LA 3VW3H 2MRYA 1ZV2A 1SY6A 2PKDA 4U7SA 3AXHA 3V10A 2DM4A 4UILL 5IT2H 4N2IA 3RWFA 2XNAA 5I30L 1VEPA 2NZ9D 3QS3A 4EPSA 3B43A 4AIZB 1A1NB 4Z7VE 3MLRL 1ZTXL 4JREC 5F7UA 1A4JB 2A9DA 1LHZA 4GRWB 3SDAD 1S9VB 1PKQE 1GYCA 3I6SA 4LVHC 4IMKA 4CU6A 1GAFH 3VU2A 2O6DA 2H2PC 5FHAL 2YKLL 4HUNB 4LCWA 3GB7B 4JO1L 4OLWL 5CEZH 5IWLC 2YUVA 4JN1L 4O9HL 2RAMA 1U8HA 1PYWA 4JO5A 1ASOA 1F4AA 4PJAF 3QZBA 1TLKA 1DCLA 1FG9C 4ENZA 5IFAL 5ICXB 3S3JA 2BP5M 4KXZH 8FABA 3ROOA 4P4KB 3DX0A 3S3DB 3EOAA 3JV6A 4TL5A 4MMYB 3GBML 3TVMB 4DGIH 3TXAA 2C4FU 1RZPA 1U8IB 4GT0A 5ISZA 1L0QA 3OKKA 3BDYH 1GYUA 5A7BA 3VXPB 3DOIA 3BX7C 4HJIA 2WVVB 2NSQA 4NJ9H 4RMUA 3TV8A 3V0WL 4F3FB 3FF8A 4F1SA 1BD2D 4C56A 2YRLA 3WNKA 3ZIMA 3NIFE 3M7FB 5HJGA 3SBRA 4LDLB 5F9JB 2LHAA 3U79A 3MRKA 2QHLA 3D4CA 4PJGF 3SZKC 1MELA 1HSAA 5C6WH 2OTUB 2DM3A 1BECA 3HFML 1I7ZA 2G2PA 2NTFB 3FQXB 4KK6D 5IVXF 2J5WA 4HXBH 2LLGA 4U1MB 1M7DB 2G0KA 3GSXB 3MRRA 1B90A 3EJYD 5E6YA 1VZHA 4W9FC 2R8SH 2R0ZL 4YFEA 3MRNB 3RY4A 1DJSA 1JERA 1G6VK 2Y7MA 3L4CA 5TF0A 3LNFA 5HGAB 1G5GA 1H3PL 1BIIB 2HKAA 3DYPA 4APXA 4OGAD 1OARL 3ZDXF 3A6CH 4HGWA 3PFUA 1T6BX 2ICEB 1T7VA 3EDJA 1I9IH 3VFUB 4W9IC 1TQSA 3IMBA 2VMEA 3U1SH 2J8HA 4LLQA 2V7NA 3F7PC 4PSPA 1O9WA 4UT7H 5FR3A 1EVTC 5F0MB 3WLWC 3X14B 1YNKL 4JFYB 3L9BA 3RVUC 4NWUH 1VRSA 1A3LH 5I6OA 4BQ9A 1QR1A 5TPWL 1H15B 4YBLC 5LBSH 3HG1B 1GSKA 3V5HA 3BP7A 3D2UD 4YSPA 3UBXB 4XN5A 1AIFA 2VZTA 1IB5A 5EO0B 4Z7QE 3C08L 3RYMA 1OCZB 1TZIB 4ODTL 2B0SH 1A6ZA 1AP2B 1U8JA 4JX0A 1UA6H 4IGBD 1RZJC 3ZK0A 3VG9C 4J8RA 3AS3A 4A67A 1WISA 2E8ZA 1LO3L 1X4YA 2G60L 3KDPB 4G71B 4OF3A 5IBUG 2YPLE 4ODHL 3BUYB 1CXHA 3ZLQC 3ALPA 3EBGA 4YK4B 4ZX6A 1KB3A 3ETBF 2BNRB 5BVJB 1KYOJ 2H1XA 3GZOA 1MW2A 5E9DA 2H0FA 4YXKL 2B2XH 4Z7VB 4HKBB 2AW2A 4OJCA 2YXFA 3EYVA 1XGYL 5FYLD 3OMAB 4LEXL 2ZP0T 3ISYA 4XVTH 3STBA 5IEKB 2VITA 5B1BB 4OV5B 2BNQB 2DMCA 2XN0A 1J1PL 3VXRD 4JM2C 1X5FA 1FL5B 3T8XB 4PRPB 1XTLA 2A6KB 3LQAH 4LNRA 3ZU8A 3CSTA 3HG0A 4C55A 4N26A 3UTPE 1E27A 1ACXA 2NR6C 4HUXB 3IJHA 1VZGA 2C8NA 2Z35A 3CZFB 5C0JA 4F7TB 2BVTA 1J05A 4EIZC 4I3GA 2V37A 4EDXB 3I74A 2AXGA 1XZ0B 2CJSA 2ZJSH 1E2WA 4MD0A 5IB5B 3X3GH 4JHWL 1XH3B 2VDPL 3HHRB 5E8DH 1JYWA 4WUUB 5IHZA 5JHAA 1H8OA 1ZPLA 2HWZL 3RDTB 5I1HL 2NDGA 5DUBA 1SXCA 3VMNA 4NZUL 3O4LD 3VRJB 2C3VA 1DVZA 3CLEH 2OR7A 3APNA 4AJWA 4XVSH 1VHPA 4OLEA 3DRTA 3F85A 5SX5H 6TAAA 1ZSDA 1DBBH 3BAYA 2ZONA 3DO4A 3HUJB 4LLWB 1CU4H 3UC2A 5B4MD 2A1WL 3TJHD 3NA4A 1ZXQA 4FQIL 2X9YA 2ATKA 1IAOA 2RMNA 3IEAA 3MJ9L 3TZVB 6FABH 1WD9A 9CGTA 1IV8A 1TJMA 2B14A 3I9GL 3O45B 2VDNB 4G11A 5JZ7C 2YARA 3BVXA 3OLIA 2QSCH 1KLUB 5F88B 3VXMA 3QYNA 2QV2A 5J89A 5E08L 4NQTA 1SHWA 4O5LH 3DC0A 5MERB 12E8H 3CZUB 3LKOB 2ALWA 1Q9KB 2A73B 3N50A 1F5WA 1JPGB 1IKFL 1BVNT 1M56B 1TEYA 3P4OB 4KFMA 1O9ZA 1N5AB 4CMHC 1UB6B 3GQFA 1KYUA 1S9XB 4E9RA 1XMWA 5GRUL 1SQMA 2YD4A 3ML8A 3QQ9D 4KZ0A 4AL8L 1HWGB 1OAUH 3WY2A 1OXYA 2QVMA 2VDOL 5FX3A 5J56B 3C6LC 1ZK5A 4E41D 3MTRA 4B60A 1ZOXA 3WNIA 2E6JA 4WK0B 2G9HB 4KVNH 1HOEA 4NM8H 1HJCA 3GXMA 3GRWL 3UG3A 2PCFA 2OL3L 4P48A 3TIEA 5CCKL 2YK1H 4X6FA 5I1KH 5BO1H 4JE4B 3NJNA 1URLA 3S8FB 1CFTA 2OMVA 2AGJL 1FZJA 3QUZA 5SWZA 3WD5L 2Y5TA 3B5TA 1OSZB 4GRWH 2WO3B 4TNWK 1EUTA 1EBPA 3H85A 4XOCA 1A8JH 4FP8L 1AQDA 3STZB 2UX6A 2Y2YA 4QWWC 3SE6A 3V0FA 5I1JL 3G6JB 1G7MA 2VQ1A 2OK0L 1T4KA 3DRQA 1QZ1A 4JQVA 4HYTB 3V5DA 3ILDA 1TG8A 2TAAA 4ADJA 1CE1L 1I8AA 1ZV9A 5DD6A 3FS9A 4B5ZA 3SBWC 2ADFL 3LYRA 4Z7IA 5ESAB 3QRBA 1JPFB 3SQRA 3CH1B 5CJXA 3VWJB 2W38A 3X1FA 3IF1B 3E6FA 1KTDA 4BE6A 3NJHA 3QJZA 1E4KA 3HRZB 3MOBL 1FVDB 2DL9A 3ISWA 5E8OA 4GFTB 3TBTB 3BP5B 3FB5B 3QEQA 3V6BR 2XBTA 4XN2A 1OWRM 2PR4L 4QY8A 3DPBA 4JMNA 2R29L 5MP6L 4N2OA 4NQVB 5TE6H 1I8UA 1E0OB 3B9DA 2G5UA 3GO1L 5EUKA 4PS4L 1GGUA 3GMRA 4BSWB 1DVQA 3I02A 4UINL 4NT6B 4HIEA 1KB5A 4IS6B 4WEEA 3SGDI 3S5LB 2P1YA 4XCFL 5D6DC 4ZMZA 3CDFA 2IFFH 3FBQA 1QLRA 1ZLEA 1CBVL 3LMJH 4LKXB 3VE0B 1CR9H 4OF0A 1CB4A 3MRBA 5GSVB 1XGZA 4JFDA 1M9SA 1ZRUA 2Y36L 5BRQA 2YD7A 2FJHB 5DHXB 2VL5B 1MDAA 3ETTA 5JPNB 2ZOTA 2BMKB 2Q0ZX 3F7VA 4JZOB 1VFBB 2ITCB 2EXTA 3CSBA 3QEGL 5ALBL 1PPIA 1JZGA 2PMZA 2XJLA 3D0VA 1A3QA 4HHAA 1BG9A 2VB5A 3OAYH 1SPDA 3NSCA 2PPAA 3H9SB 4MX7A 3QIWD 1OO2A 5E03A 3S88H 4ZAKA 3ATFA 3VX0A 2V7HB 4GAYB 4UM8B 4ZMWA 4QRFA 4DO5A 1SJHB 1I7UA 3HMXL 1C5CL 4JUTA 1D5XA 4XCCH 2O72A 3FQNB 1D6EB 4FI8A 3FT2A 2XWBA 5C7XH 3FQWB 3QDGD 3QJFB 4B6ZA 1TMCB 1PSKH 3S6CA 4PBDA 3MRHA 5I73B 3RB7A 3RUGE 4ZZFA 2FIKB 1E67A 3X11A 3WE6A 5CILL 3N04A 3CBKB 5HY9B 4GBXA 1RULH 2VUKA 5K9QI 2OULB 3BH9B 3QUXB 3L54A 4X80H 1J12A 2VM3A 1H19A 3T6XA 2YSTA 5DRWB 1WGVA 2GBVA 3C60D 4MMZA 4RMBA 3T4AB 4PG9B 1FLTX 4NIKB 3FOLA 5HDBB 3KJ6H 3EO0B 1VGKA 3Q44A 1RZGB 3IWVA 4YO0B 5KVEL 2ZOLB 2OYKA 1Q9OB 3O2WL 4FFWC 3DI2B 4ZMOA 3D25B 1VGEH 2OBGA 5F0LB 1F6FB 1A1MB 2GT9A 5HHQA 1DLFH 2BP8A 3FH7A 2J7LA 3SJVB 3TH4T 3VH8G 2D3LA 1ITCA 1WWWX 5KSAB 2J56A 2Z91A 2NUPA 3DMMC 1S9YB 3PDOB 3AXLA 1LO2H 3BLPX 5C07D 2CBQA 3ULVL 2RCSH 1E43A 2EUXA 5C0ND 3POHA 4RH4A 2FDBP 3GXPA 5BXFA 3HZ3A 1OZUA 2V9RA 4IKLA 4DZ8B 5FO8A 1RMFH 3LV3A 5C0DB 1HHGA 4L4VA 3IGAB 4MNGB 1OAYL 1JIBA 1U91B 3GT6A 3E7JA 5FUCE 1FGVL 4OKVA 32C2A 2J55A 4LOFA 1NFDE 3MV8D 1Z5LB 1IGIL 5ICUA 3NZ8A 5B8CA 3TM6A 3X12B 4ZQTA 5KBLA 5JDJA 2IQAB 4GXUN 3QEHB 3AG2B 4R83A 3ZOAA 1KDJA 1LTXA 4HU8A 1JZ2A 2E6QA 1KCUL 3L5WA 4JFTA 3WLWD 1YC8A 5E6IB 1ZLUK 2UZXB 3RVUD 2EH7H 4H8WL 1OLZA 4KDTA 3TO4A 2O6PA 4DP4X 1K85A 1EMTH 4F7KA 3QCTH 3EUDA 1J9SA 3ZW3A 1WE5A 4B9FA 4NI6A 4ZQKA 1LE9A 2JJUA 1DLHB 3TEZA 3HLAB 1TETL 4TNVK 4XMUA 4JK0D 2VDNH 4JFZL 5I5MA 3MO1A 3A6BL 4N4YB 1A02N 3L2LA 1ZEAH 4K5OA 4DGWC 1NUDA 4N8CH 4WFFD 5KN5B 5ADPH 5EDSA 1J9CT 2O26U 1NWOA 5CFHA 1AY1H 4LKCA 2ZF8A 3O6ML 4N25A 3LZPA 1BOYA 3VXOB 2JXMB 2EP6A 1N70A 3BAXA 4R4ND 3MLWL 3FCUB 4CVWA 5I19L 2BXYA 5I8EB 3KXFA 5B1CA 2J20A 5I9QC 3SKNA 5I18H 3HLKA 1RPKA 4YFLF 1JJUA 1OTTC 5AOIA 4WO0A 3RUGB 2WZ6A 4HS6A 3VFRA 4L3EB 1AKJB 3OTTA 1RZJL 3EYSH 2XVGA 2PO6D 4X6BA 4JM2D 1V3JA 2HVJA 4Y2DC 4N86A 4ZUTA 5HYQA 4OD3L 3PL6A 3CFNA 3QNZA 2R51A 2H6PA 2PCPA 2QJDA 2NR6D 3WNMA 2DMHA 1E6JL 4N9OB 2NY2D 2EZ0D 3VAEA 2BDNH 1MHPH 3VJ6B 4UWQB 4K23L 3BN3B 3SPJA 5IF0B 2D7NA 4U4BA 4YZFE 4OTXL 4XPFL 3FB8B 4OCYL 4LIQE 2WLKA 4PJEF 1DVTA 3HR5A 3I50L 1BP3B 4HOXA 1DVFC 4QJ4B 2F58L 2YGPA 1JZEA 1LQBC 4ZS6C 2V2TB 5EN3A 5EU3B 2OMUB 1BFSA 1GIGH 2APXA 2X44D 4JGMA 1JI2A 4ODXB 5FA3A 1S9WA 3PAZA 2IMNA 2WP3O 4PD4J 2BX5A 3ZYIA 3G5XB 3HZYB 4WI6A 2ZUXA 3T71A 3OSKA 3T0ED 1E4WL 1FFNA 4MD4B 1UXSB 5F3BB 5IHWA 4KKCC 3U7YH 4KUZH 2PXYC 4HS3B 5JZ7D 1FA4A 4LCUB 4JGNA 2NNXA 5KG9B 3CK0H 4XMWA 2J8UE 2CLRB 2XPGA 2ICWB 4DK6A 1ECYA 4I0PB 2J57A 3NP3A 4MCYB 4WW2F 4Y5XC 5JUEL 1GOHA 3N0PB 5KS9A 3ZTNL 2F7RA 2HAZA 2XWTA 5KVDE 2G3NA 3SY0A 3OZ9H 2CR6A 4ZK8A 1KBVA 4FZEH 3VI3B 4HWZB 2B5IC 2VN7A 4IKJA 1UA3A 3UTTD 3IJSA 3BQVA 1TJHL 3AW5A 3D4GA 3QDHA 4TYUA 2ENSA 2ZUQB 1CFNA 1CIUA 2OL3A 4KO6A 4X4XA 4BSJA 4X5PA 3BRDA 3IS0X 1URIA 3VD4A 2EDBA 4PWGA 1PG7H 3VQLA 4RGNB 3GXUB 4R5VA 5F44A 3KM2A 1P7HL 1R5IA 3OM3B 4A66A 3V4PL 1V54B 3C75A 3DXAD 1WEJH 4UQDA 3NIGF 2Y1YA 1HI6A 4I18C 3ESMA 5I23A 3OVUB 3CN2A 5D72H 4ENED 2HG5A 3ZE1B 1R47A 3D39A 3RIFF 3BAEL 4OCXH 4QWWD 3VI4A 1R3KB 3BFOA 1TLMA 1EDYA 1GZPA 3BQUA 3IGLA 1BVKA 2BVPA 1TJGH 4G8AC 5FYJE 2HT3D 4PW3A 4BFRA 3CSGA 3NFSL 4UTBH 2Z4QA 4Y4HA 1KCVH 2ZPKL 3LVEA 3OAWA 3VACA 3TEUA 2FGWL 3CUPB 4YC2B 1DQLH 1RLWA 5KUKA 3HC0A 1C8PA 4XX1E 1UOLA 1SM3H 5C8JB 1OCRB 3UZVB 4HKZA 3WEBA 5ETUB 2QQNH 4ZUSA 2WLYA 3BFWA 3ISRA 5HYSA 3S36X 1ZCRA 1IIIA 2F5AH 2R0LH 4FQXC 5D4IA 4UU9A 3ZKXB 1MHHA 5DLMH 3MBWB 4JFUA 1INQA 3QUML 1N8ZB 3NJLA 4ZJ9A 5IW1A 1H0DB 3J27A 2HJLB 1G7QA 1FG2A 4CSTA 1WG3A 2NY1C 4MA3A 1TVHB 1V27A 2GJZA 4QKTA 2WBJC 2YJQA 4DP6X 1RJCA 4C54A 2IO5A 2J73A 4FLRA 2ICCA 4MXQD 1Q0XL 4HKXB 5IVZA 3UBXG 4MDJB 4MS6A 3S37H 4CDHA 3K8KA 1HX0A 3JTBA 5I8KH 3B9VA 4PY7A 4UQ3B 5L2KE 4I8DA 1HL4A 5EC2A 1AR1D 4U6XB 1CT8B 3C5ZD 5C2BH 1P5UC 2YQGA 4PTUB 3SE8L 3RP1A 4S2SA 1QLEL 3G5ZA 4LBEA 2AFNA 5TE4L 2NY6B 1MCOH 2AK1L 4GXUM 4IBVA 4G8FA 1BV8A 4HWEL 1U8KA 2DIEA 2EECA 5I0WA 5I6LA 2XZCL 2PCYA 3IBOA 5CSBA 3DGGA 4P2QE 5HVWA 4H1LB 1KTCA 2ARJA 1A7RL 2HX9A 2FX9L 3APMA 4YDLC 1HH9A 3E1F1 3RWEB 5AYQA 5ESQA 1RIVL 5CBEA 4XGZA 4G1MB 1X9UA 4I2XE 1KIUA 1A4BA 5FFGA 2ZOKA 5ITBH 3VXUA 3ARSA 3DETD 2R2BB 1NBZB 5CINL 1YEIH 3O3EA 2J8UB 3U46B 1J8HD 2ZOUA 4FEIA 1EFXB 1NPJA 2UXVA 3CZEA 4O2EB 3VRLE 4OSUH 2C1PA 1ZMYA 3G9AB 4IOSA 1ICTA 3BKMH 5F2FA 1KGCD 1AHMA 4P07A 3HN5A 1WO2A 3GSRA 2D3JA 4GRWF 2QQLL 4Y4KA 1T6VN 1N10A 1PLBA 4HZAA 5CLYA 4HIHA 3D7PA 5FO9A 4PWKA 3AQDA 2BHFA 4ONHA 4Q6IA 2K6YA 3B2PA 3IGFA 2JCWA 4ACPA 2OTWB 3U2SB 1PX8A 3VFPB 2D7MA 3E80A 4NQCB 5C09A 5T3XD 1NBVH 1U3HD 3EH1A 3K1DA 4BYHA 1CDYA 1QSFE 3HB3D 4ZPVB 5CZKA 5MENE 4CADB 2HMID 4FFWD 4R7NB 1JGVH 3BIAX 1U92A 1MPAH 2WLZA 3MPCA 1MAKA 3BHBB 4ILDA 5DVKA 4ZTPL 1YNTA 5ICYA 1G1OA 1HNFA 2O5NA 3ILPB 4XB3A 2OMZB 1NSNL 2VC2L 2DKMA 1QTSA 3DMMD 1NEZA 3Q48A 4BH7A 2I85A 1G9ML 3TYGL 3DYMA 4DGUA 5E2UH 3MV9D 5H35B 5D7KD 4WW2C 4HWBH 5GZNA 3E38A 5EB9A 1U4FA 4HQQL 1YQVH 5DFAA 4XO3A 1GZQA 3NABL 1DN2A 4JMXA 5FGCE 3AS2A 5E2VH 2VE6B 2NPLX 2NCEA 3F83A 5L2JA 1WCBA 1HDMB 1XB6A 2OMXB 3QFJE 5J7CC 1N8OE 3KPMB 4JS7A 2RALA 4M7ZB 2H26B 5J6SA 4YHLH 2F7OA 3OC8A 4UQCA 5EU7E 2QR0A 1DBJH 2GK2A 3SYOA 4WFED 4KZEH 1QG3A 4UDTA 1MKFA 1WV7T 5DK0A 2F53B 2Y1AA 2DAVA 2GFBB 2V2XA 5A2FA 2W92A 5B3JE 2DJSA 1F11B 2Y24A 5ACLA 4NHCH 2L04A 1BFTA 1T1YB 2OYPA 3ARDA 3P0GB 1WFTA 3ARXA 2EDJA 2XDHA 4NPJA 2QLYA 4YSAA 1LP9B 3LQAC 4Q0XH 2DN7A 1F4WH 1X9RA 4OZGA 5F1NA 2DLEA 4GRMB 1OP3H 1P9MA 1LMKA 2A6DA 2XXMB 1KTRL 3UTSD 4DP9X 4QD2E 4WI9A 1OSEA 1MCPL 4KJWC 4JHAL 4OJDH 3A3YB 4AKPA 1KY6A 5T1LD 3RI5F 1NLDL 1QKZL 4JHBA 2PPFA 3WJJC 2B59B 2WQ8A 4FKEA 3SE4A 3ERXA 5JO5B 3G6AA 4RIRA 1AO7D 3GPEA 1JCVA 1KT2A 4M43H 1XTMA 2ZUYA 1OE2A 2FJSA 3BMVA 4BINA 4Q9CA 2HFGH 4UV4H 1FGNL 3U83A 4OGXL 2Y23A 1DFBL 2BSBA 5E5MA 1G1CA 4PREA 2B4CL 3DV6B 1G7IA 1GHFH 4NQQA 3LY6A 4XVUC 5LXVA 4WHYH 3VWKC 1IEBA 2QPSA 4NUGH 4X7EC 4L3AA 3CHOA 1SJEB 5DZJA 3LTVA 4AITA 3MKKA 3BGFC 3P9WB 3UDWA 4Z7VF 3S8GB 4OI7A 8CGTA 3KH4A 2VH5H 3TPUB 4BK5C 1A4KA 2EQDA 2P8LA 4TQIA 3ZDZE 2ZCLH 1YN6A 3JWOC 2CIIB 1JNJA 3UPRA 5IHHA 3LVTA 4P5MB 1WVZA 3S5LG 1D9KC 1Y0LB 1DQQA 5D1QE 4HUVB 4YDVA 3VFOA 2XSKA 4AMKH 1T1XB 3EDFA 3FSAA 1DVUA 1FZMB 2WYIA 3GDBA 4ERSH 4NNPH 2C7UA 2WTRB 3T6ZA 4Y9FA 1A3RH 2HJFB 4D2NA 3NZUA 1ZSHA 2CGRH 1O7DC 1QSFB 5MENB 3LRSB 1DVFD 3RE0A 1XCTA 1RURH 4HD5A 1ZT7B 5INCA 5CIPA 3L3OC 2GITB 3DO7A 3ULUD 1T83C 2IWEA 4B7IA 1XBRA 3TNNB 2PYFA 4LRIA 3VU1A 4NNXA 3INUL 2IBZY 3GJEB 2H0PA 3TL5A 3UYPB 3EH2A 1A9EB 3DJTA 3WY3A 2BSDA 5IESH 5IQ7L 3SD2A 2EIEA 4QXUL 1AGCA 5CSGA 5EFIB 3BW9A 4BQBA 2OV0A 4G42A 4KKCD 3GBEA 3UIZA 1TCRA 2BFVH 1M6OA 2X0VA 4EOWL 1A22B 3HUJF 4LCCA 3WNOA 4MNQE 1QFWM 1WFMA 2NZIA 4MJ5B 2AEQL 4PI0A 4Z7AA 3V4VA 2VLKA 2BCKA 1AS8A 3BWSA 3QFJB 2R1WA 1P7QA 4HMDA 1WLHA 2JB5L 1FLRH 3V52L 1C5BH 4PGEA 2XXCB 4PMFA 1K3IA 3PWJB 1EA9C 1UWGL 4OF6A 4P4KC 2AQNA 5BUAA 4JHUA 4LIQH 5EG6C 3LS5L 5C0AA 3GHEL 2VXSH 3HC3L 4AT6B 1MCDA 4K94L 25C8H 3T3PE 2RTTA 4O02A 5FKAA 3MRCB 4FLHA 3K6IA 4P9MH 3V79C 3QWRA 3PLYA 1JGDA 4A2HA 5K9KB 3A21A 2CMRH 5JOPE 1VAHA 2E4FA 5JHDA 4JO8A 4JFQA 4R90L 1PD6A 1I3VA 1BQHB 1JGUH 2FEEL 5F71A 4J3UA 5LLIC 3INOA 1Y6NR 2ATPA 3QFGA 2IPTH 4UTAH 4WWKA 1MY5A 4JFFE 1SVCP 2BO0A 4D3CH 4KITB 5E5RB 4H13C 3NEOA 4BKSC 5KTEH 4S1QH 3LRLA 3V0VB 3WS6C 2VOTA 4Z7QF 1S78D 1FIEA 3WKYA 4TQPA 5KVDH 4QOKE 4JRXD 4X4KA 1WTGT 4PGBB 4G80B 5IB3B 2WLLA 2Y06L 3G6JF 3CVCA 4JZJB 5GGRA 3CN1A 2FD6L 4HUUB 3P3UA 4DN4H 4Z76B 3VD1A 3BT2H 4NENA 4ZUWA 3RWGA 4FQXD 1YO4A 1B0RA 1YUHB 3I2CH 2BPBA 1Z9SB 3OKNB 1T66C 5IQOA 4M6NL 3PQYB 1DQVA 1SXNA 3D12B 3O6LH 1YNLH 1M3JA 3KNBB 3ZDZB 2NY1D 1JV5B 2WBJD 3I75B 5SWSA 2P24A 1P5VB 1MJ8H 5CEZD 1Y6MR 4P05A 2COVD 4JW3A 5D1QB 4Q89A 5CEYA 3UTOA 2DMKA 4B50A 5I1GH 3E9UA 4U7KA 3CHPA 4A2FA 5T3ZD 1AD0B 3BKJL 1SVBA 3FRPA 5DJ8B 3EDKA 3ZGHA 4MQ7A 5EZOH 3VW3L 3FU9A 4FN0A 5E00A 3O41A 1IBHA 1OAKH 4G6MH 5AAMC 3GS0A 1Q94B 1MFUA 5IT2L 1SYSA 3GIVB 3QG7H 2LABA 5DHMC 3MFFA 1I3GH 4JLRB 4KQ3H 1OW0C 5BV7B 2HCZX 2CHNA 1UXWB 4NO2A 3TN0C 3M46A 2UWEE 4JG5A 3Q2CA 2OMBA 1WAAA 5T33H 5CZRA 3RTLA 2P45B 2R69H 3GTVA 1RJZA 3O4OB 4YK4C 4XAWL 1E3XA 3B7UX 3V0EA 1F97A 4GW1B 4M1CD 1TU2B 3QDMA 1DVXA 4LQ1A 5GIRA 3R8QA 3WO3B 4NYLB 1MCNA 2NZ1A 4Z7WA 1AVAA 5D1ZD 3L4UA 3WG7B 2WV3A 4DGIL 5I1DA 4YLCA 2Y07L 4PR5A 2UYLB 5HGHB 2BSSB 3FT4A 5LKNA 3T0VA 3BIBX 3QUKA 4JQXA 2QHRL 4KRLB 5HI4D 2EDFA 2YGQA 5CCHE 3PHAA 2AMUA 1F2XK 4LHJB 5GJTH 1KBPA 3LH8A 3NACH 5H37A 4GG8A 2VLJB 5A2AA 3GSQB 3MUY1 3LS4L 3W0WE 5AVXB 3IJYB 2W9EH 3K4AA 4UANA 4U2ZA 1BXUA 3RGVB 4JHVA 1EAPB 1XIWA 5DCCA 1A9BA 3GMQB 4UV7L 4UM9B 3FFCA 5SWQA 2CRZA 4IRSD 5EC1A 2FWSA 3B2UC 1TYJA 2QLVB 1J5DA 1KPUA 2HB0A 5I5IA 1RU9H 3CNKA 2HZHA 5BRPA 4UTCA 1O6SB 2C7FA 3B3IA 3ARUA 4XE0A 3RDTC 4FYSA 3PXJA 2EILB 4X6DE 4PJ5A 5HDBF 1XD0A 2QQKL 5HYEA 2OXGB 2VQUA 4JFFB 4EVNB 5CP7A 5IV2B 3I3BA 5L4MA 2YA2A 1YC7A 2ICWJ 1U3NA 3KE0A 3OMNB 1X7TA 5FCSH 1Q38A 4CVUA 3VXTA 1MCQA 2BNUA 4NC0B 1G1KA 2KLTA 1JZ4A 1XVSA 1C08B 3QEUA 3MRFA 2PPCA 4HJGB 2L7QA 1EPFA 1KPVA 5BMFH 1I9IL 4HH9A 1KBWA 2ZG1A 3BVNB 4M5ZL 3MMEB 3VFVA 3C09B 5AKRA 3ZDYB 4X4YB 5J1SC 3U1SL 2VSMB 3HI1A 1NCWH 2DH3A 3P77A 3U9UA 2HP4A 3NTCL 2NNFA 1A3LL 4DJMA 4PTTB 1Q90A 5EEUA 2K4AA 1S7RA 3OGCB 5C6PB 5HVHB 2IIJA 1F3JA 5I1LB 1T5WB 4XO5A 2J8OA 3D69B 3BUBA 4YPGB 4LARH 3GSNB 2EYTB 4LSSH 4UF7C 1GGTA 5L7XL 2P48B 5F9WB 3W39A 2JV6A 1HILA 1YPZB 4U6VH 3D2TA 1UA6L 4ZTOH 4DPCX 4X9BA 2X09A 3KWTA 1TOXA 4J3WA 5ELIA 1CGWA 1HZHH 1NBYB 4P5TA 4B9PA 2F54A 3OZLA 2UVFA 3EG9B 1VEMA 2X0WA 4PY8J 1AGEB 3L1EA 4XP4H 5IROD 4K15A 3ALWA 1B2YA 1UADC 4DERA 1F00I 3L13A 3R18A 3OKMB 1M05A 2B2XL 3EBAA 2XN2A 3S3BB 5T1DL 1J1OH 2IVFC 1BLIA 3UPAA 3W9EA 3ZO9A 3GWJA 2WMPB 4KKLC 2UWEB 4AQOA 1I9RH 3PG2A 3FQRA 5F72S 5JMRA 1DQDL 1MH5A 2JQZA 3SKMB 4XVTL 2W0PA 4DFIA 1YEDB 2VLRD 1VERA 4PP2A 4XPHL 4B53A 1BBJA 3T0BA 2YRBA 3VWJC 1EXUB 2WXOA 3GMMA 4PJ8C 4BE5A 3LXBA 4KKBD 2A6JB 5E99L 1EHLH 1YEEH 2J1WA 5MEQA 1XZWA 3FJTA 3O3AA 2HRHA 3L3HB 3MNVB 4PJ7E 1KXQE 4XP6L 3DIFA 2CUMA 5I1AB 3THML 4P57A 2ZJSL 2BOLA 3BZ4B 4JCMA 3UYRH 3X3GL 1BVOA 4HP5A 2AP2A 3T1WA 1KIQB 3LD8C 1T7ZA 5EPMA 4C4KO 5J9PA 4Y1TA 3RUGF 4I4WB 2E5EA 4HCRH 5IJDC 3EJZD 1OGAA 3NCJH 5C0EB 1QFWH 3CLEL 2WB7A 1JS4A 3WFEH 3FT3A 3FZUD 4R4FL 2L4OA 4MD5A 5SV3A 4MDIA 1UZ6E 4XVSL 1CGVA 2X2JA 2Z31B 3L16A 3O9WC 4FFYH 1V8HA 4D0DA 2YMXH 1DBBL 3QJQB 4A63A 4EKJA 3OZKA 3TA4D 4GQ9L 2CHWA 1XHHA 5JPNC 4LSRH 5B7EA 2DLHA 6FABL 1F0LA 4I0KA 4NWTL 1ZLWK 5FOBB 4H1LG 2YD1A 1H3TA 2WIIB 2QSCL 5BZWA 3JWOL 4ZUUB 1RJYB 1BYPA 2EIDA 1MNNA 2VDLL 1PDKA 4KRPD 1BZ7A 4YE4L 1A14L 1ZK9A 3GZKA 4HK0A 4I77H 12E8L 4I3RL 3V5KA 3ZKSD 4B0MM 5IB4B 4OJFL 2GK0A 4F7PB 2ORBH 4JFEB 2GW5A 1IC7H 2NRDA 5GRYA 1ND0B 3ZZQA 2PW2B 4FE9A 3DSNA 4Z3GA 2VDML 2NXZB 3OWRA 1BZ9A 1NAMA 2BK8A 2KQNA 3L9YA 5E95B 2Q7YB 4APQB 3QR0A 4BA0A 5I73C 4GG6A 1RPQA 3MACH 2OP4H 1OAUL 2DW5A 4LSVH 3HA0A 3RKDC 3CN4A 3T3ME 4BWWA 1UWEH 4TSBH 4P4KD 2XHNA 3WN5B 2AABH 4Z3IA 1J9QA 1WS7A 3TVMD 5JPMA 4KVNL 2NY0B 3BJ91 3T4AC 5CXPA 3HBPA 5I1KL 3CVHL 1XBDA 1YCSA 1UB5B 5BV7H 4RMRA 4DW2H 1SMDA 4C83A 1IO4C 2XX0A 5KSBB 4HBCH 4GO9A 2X53A 1EEUA 5BVPL 2GUOA 1MRCH 4LSUH 1U21A 3RWJB 1L7IH 4MMXA 4IU2A 3DWTA 1UKQA 3FQYA 3LDBC 2C1OB 4B0MB 4G70B 3GF8A 5KSAC 2CRYA 4PJDE 4ETYA 5DJAA 3T1FB 3TBVA 1KOAA 1IBFA 1I9JL 1JZFA 3TJPA 3P9MB 1UM5H 1JE6A 5AWNH 4W6XB 4LL4A 3NN8A 5F96H 1SOXA 4QHKJ 5HDQH 1I85C 2Q8BH 4AQEA 3OJVC 4X9IA 2X5PA 2TRHA 1B4RA 1UD2A 4XX1G 4PGZA 3JBG7 1ZS8B 3TOPA 4YGVB 5TE6L 2EABA 1OK8A 3P30L 5DI8A 1GCFA 3EOBA 3LKRB 4L4TA 5K1JA 5GS0H 5KYUA 4PJ7B 3N3EA 4MQTB 4LQFL 3MCYA 1H3VA 2RR3A 1CR9L 2XN9B 4W9GC 5C0BB 2XG5A 4A2MA 2XFXA 5A3IC 1KJ2H 2VW4A 4KX8A 5E6IC 2QPDB 2MCAA 2OTPA 3SGKA 5FB8A 1CLYL 4BD4A 3HMWL 2BC4B 5DQJB 5F7WC 1IGML 2R39A 4I3SH 4J6RH 1J8SA 3FO1B 4ODUA 4QTFA 4U1JA 4TMPA 2NLJA 3F7RA 3HG1D 4YBHA 4Q74A 2GPZA 3RVTC 2YD6A 5T5FH 4HJ0D 1QLFB 3FTGB 3AREB 4XNAA 2AJSL 2AI0H 1T7XA 4EUPA 1JGEB 4YGAB 4TSAL 2CWRA 2HFFA 4ISVB 4JO3H 3MA7A 3S88L 4G6JL 1MW1A 2EC8A 4AVIA 4ZMQA 3M17A 4JR9L 3JV4A 2DTML 1VFMA 4YZFF 1JNLH 2FJUB 4Y2LA 3KL5A 4KVCH 4LDOB 1PU0A 2XA8H 2YWZA 4YHOH 2EVFA 1PSKL 3TGXA 5B7FA 4XWGH 5KYYB 4AM0B 2BNRD 1BQUA 3MV01 2W95A 4OLVL 3FCSB 5EH1A 5DRZB 5GGUB 1UUSA 5EA0H 5EBGA 1TZOA 1UT9A 1RULL 4OQ1A 1OKEA 4Y16C 2PP7A 3NPSC 4XP5H 2C9XA 4X80L 3GSNH 2LU5A 5C08B 3B7TA 1KCBA 2Y7QB 5E23A 4TUOB 2H3NB 3QXVA 5D2NA 4F27A 2XTSA 5D7JA 3QRFM 1REIA 2BNQD 3KJ6L 2CCLA 4MCNA 4WHTB 1TQVA 4EXKA 2HRPL 4PRPD 1B2WL 2UUDK 4UQ2B 1KTBA 4ZXBB 3B6SB 3TBSB 3V4UL 3VNZA 2UZYA 2FJFB 2J8UF 1MW3A 4TVUA 2GJ6B 2Y3NA 4Z23A 1TMQA 3MAWA 1ZA6A 1NJ9B 2VN3A 3S4SA 2FB4H 4LO9A 2CLVB 2FIRT 3ZTJH 1G43A 1DLFL 2Q76B 3SPVB 3ARGA 4JAMA 1MJJB 2H4EA 2ZUSA 3B2UD 4WUUD 2GQHA 5EO9A 1DSYA 5ICZA 5IJKA 1CXIA 1U93B 2Y1VA 2RCSL 35C8L 4CNIA 4K7FB 3RDTD 1UJ3A 4MAYB 3ZL2A 4AQAB 2NY4C 4G6KH 5DS1A 4Z1PA 1RUPL 2DTSA 3SDDB 4JRYA 3ZPDA 1MZYA 4EI6A 1ES0A 4BFGA 1A64A 1DQJA 3EAKA 1N2RA 2A0LD 1L5GB 2WUBH 2GAZA 2E74C 2DI8A 3WAJA 3QZWB 2EUZA 3V0JA 3GSWB 2XZAH 3IU3A 4JDEB 5HJ3A 1FSKB 3MXWH 4X8GA 3TZVD 1UH3A 2F19L 3BVDB 3B5HA 4OQTH 5C0RH 4BDVA 4I9XA 1IU1A 3O0LA 2ESVA 3GHPA 3JSSA 4QTHA 5FUCC 1BGXL 2JIXA 3COOA 1IX2A 3WAKA 1OCOB 3PGCB 4MAZA 5EU6E 1FNEB 2WY3B 2WPGA 1MJ7H 3NJKA 4FLSA 4GLRH 5E1HB 2XQYG 1SMOA 1PJ9A 1S7WB 4GY4A 3GMOB 1C5DB 3OLGA 5JMOC 1SXAA 3P4LA 3H1ZA 4NCC1 5TQ2H 3DBXB 3QCTL 3P2DA 1RERA 3RNKA 4D7BA 4NQSA 2E9BA 3U0PA 2H1LM 2V3DA 1QR4A 1NCCL 5CMAB 4NRZA 1I4FA 1ZWIB 3DROB 3ZBMA 2IPUK 4J27A 1MLBA 2PR9A 1F3DH 1ET7A 1R17A 2VDNL 4AENA 1YEGL 4ECNA 1BQHG 2CBPA 3MROA 4FI7A 3WHE1 3L4ZA 2IC2A 1FYTA 3EGSB 2H2SC 3MREB 4Y5YB 2IOMA 1YJDH 4XC3H 5D7LE 2LVEA 1IBZA 2HFEA 5ADPL 1FYHB 1AY1L 3D48R 4ANXA 4TVPL 2NXYD 2B1AH 5EUOE 5IFJB 3CFTA 2AQ2A 4U0QB 2MTAA 5I16A 4QHMB 1ZT1B 4LZKA 3VFSB 1FFOA 1CGXA 2Z7YA 4H4NA 2H8PA 3BEWB 3CVIH 1TQBC 1LP9F 2WNXA 3ZQ9A 4AYFB 1BM3L 5AAPA 3OHXA 2DIJA 1HC1A 3FTYA 5D5MA 4LCWE 4ADGA 3BRFA 4UZGA 1UCTA 2V9UA 4XN8A 3T4YB 4KPHH 1MI5D 2VN4A 4BM7A 4WY7H 1IJNA 1BXAA 2H32B 4GS7B 4YC2C 3VWJD 2E86A 1LD9B 1SDDB 2RFXA 3ZYJA 3HG4A 4C4UA 4PJ9A 4X9FA 4HH8A 1NGXA 4PV8A 2CUIA 1XF2A 2DD8L 1MXDA 3W56A 4TF4A 4MQXD 3PWPA 4GKZA 2PTTA 1NMAH 5F89A 2LFEA 1E3ZA 4H25A 2X1XR 5BOPA 1B88A 3AWFA 3PAUA 4C56E 3B7RL 4OT1L 1IBGH 3ULSA 4I9WE 2VDRB 1QO3A 3M7OA 4KXCA 5FO7B 4L1BA 2ZX8A 5IBTL 4Y19D 3VRLF 4HAGA 4ANWA 1EJOL 1KBGH 5AW2B 3HPJA 4KY1L 1H3WM 3A4FA 3Q3GA 4ZTEA 3R06B 3IDUA 4AYDC 2CLZA 3PHOA 3KS0H 1M1XA 2JWYA 1QEXA 2DV6A 1UWXH 4GW4A 5EIQA 3IDJB 1FVEB 5IY5B 2Q86A 2X70B 1E65A 2VRQA 3ECVA 3U6XS 1L0PA 4JDTH 3U7YL 4KUZL 1AACA 2E3VA 1AJ7L 3CC5A 2X4UA 2ENYA 4OZFB 1F4XH 4U3CA 5BS0A 4PIBA 3CK0L 5EBWA 5ABDE 1J11A 1LDPL 3B2XA 3D07A 3H9SD 1ODAA 3M45A 4X83A 5EOQL 5K39A 3SE9H 4WSGA 1NC4A 3R1GL 3VYOA 3IVKB 1KFAH 4GINA 1KNOB 2RD0A 4L37B 3RNQA 1Z9NA 5LGJB 2EIZB 5GZOA 4FXGA 1R4XA 5DO2C 1JXKA 2FWLB 1D7BA 3OSVA 3OR7A 4X98A 5HPMA 4XZUA 3U4EB 2HUHA 5J12C 3VGHA 4Y0GA 3CVHA 1DEEA 1G7LB 2AJZA 2XTJE 5DFVC 2NNCA 4Z3TA 3QUXD 5I1IH 5C0CE 3GNMH 2QKIA 1BQRA 1PG7L 2ITDA 1RVFH 5EZLA 1VACB 1Q9WB 1UEMA 1VFUA 3OF6D 1FL6A 1KELL 3OQ3B 5F9AC 3TA3B 1DSFH 2BOCA 4NKDA 4B96A 3RG1C 3SCMD 2O5ZL 2P3YA 3GXFA 3QFDA 4GIPD 2YLHA 4MJ2A 1KZQA 2AQ1A 5FGSA 4QXGL 4G6AC 3DHMA 3PJLA 4OCXL 1BAFL 4V1DB 4X8CA 2WZPA 5D7LB 1D5MB 4AYSA 3EW3B 3HJEA 2WP3T 4Y2NA 1TJGL 5D7EA 3SJVD 1JL8A 3KZ8A 4LEBA 1T5XB 3MYJA 4WKZA 3ZHKA 3RWFB 2VR3A 2XNAB 4AC2A 4UTBL 5KSAD 3NT0A 1XGRA 4TXVB 5E9DE 1JPSL 4AOFA 5F1IA 2YUZA 2ILLA 4BZ2L 1KJVA 5PCYA 3I6LD 3ESOA 4IOFD 5F70A 5FGBA 2WJ5A 3KG5A 4LASH 3SDAA 5CN2A 3AXIA 2FYYA 1KF9B 4LCWB 4JANA 1U8HB 3FPXA 1NCAL 4DQOH 1GVIA 1IKNA 4ODWA 3KGRA 4GP5B 3VO0A 8FABB 3ROOB 5A2CA 3EOAB 2YD2A 2YSSA 3JV6B 4M7ZC 1XF3A 4W6WB 5ISZB 4WWPA 2B1HH 3C6SA 3OKKB 3TV3H 5FUZL 5DJDB 2GEQA 3TWYA 1IQDA 2IALA 2QGCA 2EDHA 5K33A 1ADQL 1BD2A 1JI1A 2C9PA 5E6ID 5JW4Q 3ILQC 1JK9A 3QSKB 1JZ5A 4K8RL 3BCFA 1P6FA 1YAZA 1YEKL 2ZKXA 1F3RB 3DTDA 3MRKB 3UCQA 5D4QA 3DO3A 1HSAB 1MCOL 5FYKL 1HL5A 2EE0A 3ZDZF 4AYID 1I7ZB 1P2CB 4PYHA 3CHQA 1TEFA 1WHPA 4KI1A 2EADA 1ETZA 1WA0X 2VAAB 1VSCA 3MRRB 2IQ9L 4XP9H 5HHXH 1VKXB 1FPTH 4X4MA 3VFMB 4XN7A 2AK4B 1RHHB 5I74B 4FNTA 4DCQA 5ITBL 3VXME 1YEJL 1SFHA 5HGGS 1K8DB 1YEIL 4F7EA 2W1NA 4M9PA 1NICA 1TTAA 2DMBA 3O11A 3MJGX 3FN0H 5IBLC 1Q8MA 5E51A 5AB1A 3BKML 3AS0A 2Q87A 5BRZA 3KR3H 4MCZA 1FH2A 2CG9X 5FO2A 1B0WA 4G5AA 1YMMD 4N8UA 1UQSA 4L18A 2FYVA 3QUGA 4YSSA 4RAVA 3FH5A 1YYLH 2P7TA 1E9QB 4L3ED 1AKJD 3BWUC 2J4WH 3V8CA 4Z7OB 4RGMB 5EEYA 5DQ9A 5EBLA 4NBZB 2XTJB 4NQDE 1AC0A 2DQJH 1NL0H 1OTSC 4R5XA 4XNQB 2NSMA 1T0PB 3BP7B 4HA1A 5C9KA 1AIFB 3PV7A 2IANB 4J4PD 5FW6A 3D2UA 4PJFB 4GP8B 3UBFA 1F3DJ 1TEGA 2XC8A 5SWZE 1CTNA 2MQ0A 4JY4A 5LN8A 1HHIA 5EEZA 5EORH 4IGBA 1NCIA 5DJXA 4F57L 2E8YA 3QJSB 3ARPA 5E2UL 4F37K 2A74C 4UOQA 3BPCA 4LLMA 2H32H 3VYNA 4A2DA 4QAMB 1A4CA 4HWBL 3HS9A 4UMSA 1MREL 3Q5TA 4TQ8A 5KUMA 4RESB 4DP5X 2BOBA 1YRKA 4Z7NE 4C59B 5E2VL 1QUPA 4OCWH 2HN7A 2WAHA 2FSEB 5CJ8A 5E7BA 3PWNA 3NJJA 3BSHA 3QEQE 2Q7AA 1BREA 1EGJH 3DECA 4YHLL 3MBEB 5C3TA 4XBPA 3S96A 1D5BA 2C4FT 2VDRH 2VN5A 4X7SL 5CU5A 3VXRA 4YHIA 1LO0L 4I0PD 1X5XA 4R84A 3FHEA 3BPOB 1B4JL 2DS4A 3GZQA 1NH6A 1J05B 1O6TA 2CO3A 2PWHA 3DUSB 3F5WB 3K8LA 3S7GA 3WO4B 2AXGB 1S7QA 5CGYC 5EU7C 3SYCA 5CJOH 4GO8A 3ZDYF 1R46A 4FULA 4RZCB 1FI8C 4JFDE 1PAZA 1DSWA 4PRHE 5ANHA 5B22A 2NY5C 3GTTA 1JWSB 1NMBH 4M5YH 4UAOB 2VXQL 5HHOE 1CPUA 5LGHL 2JH2A 4ONOA 5DUBB 5E8NB 3SDXB 3PNWA 5D7IE 4F5CA 1G5AA 1JYNA 2DF3A 4QHNB 4OZFH 4RGND 2WSDA 3O4LA 5DC2A 3GBNL 2AAAA 2H2SD 5IHUH 3V6FB 3DRTB 3KS0J 1WQVT 2VR4A 1E3FA 1ZSDB 5GHWH 1YPZF 1TF4A 5TJWK 1KBKA 5FLUA 3MRMA 3OKLA 4OM0H 2ATKB 1IAOB 1LK3H 5DD5H 4NIYE 4DESA 2HFGL 1EJ6A 4NKOB 4UV4L 4Y9GA 5KYWA 1BVLA 2V3FA 2X6AA 4IJ3B 1N7MH 4XNUH 3FTWA 5GS1B 1GHFL 1OP4A 4W4OC 3AM8A 3DTXA 2IH3A 1QPPA 2IXQB 2A99A 2QTEA 1CG9B 3EYFA 4K7PX 4P5SA 3OXRA 3CN3A 4MVBC 2KDGA 2FR4A 2HRGA 4TM9A 3CCHA 4JZJC 5IR1A 2KKQA 1EXHA 1NKGA 2UWEF 2ZCLL 1JWUB 4NP9A 4N28A 1MF2H 3KAAA 4TTDD 4CBPA 1R5VB 4FFZL 2AV7A 1HXMB 1JG9A 4YSCA 1FCCA 3C5JB 4J8QA 2K9UA 1K72A 4L5FL 5B7MA 1NA8A 4M3KB 1QEWA 1R34A 4E41A 1A3RL 1SY6H 2A38A 1FVCA 4GKLA 1XAUA 4WQOA 1N0XH 3TIEB 4AZUA 5D1QC 3UC0L 1M9WA 4PRBA 1RURL 4Y7MA 1UM6H 4AQ1B 4WTZG 5D4JA 2XYBA 1FZJB 2Y5TB 1C12A 3CFDA 1H9DA 2X89A 5HDWA 1PEZA 2BWIA 2Z7UA 2P46B 3ES6A 1LE5A 3WTSA 2VQ1B 4HSQA 4KOCA 4QJ3B 3DRQB 4Z6AT 4JZNA 4OCSH 1CXLA 1XSKA 3HZVB 4FF9A 2DQGH 5DD6B 4NAMA 5IESL 2NY6D 4L4VE 4RMVA 1A1OA 4AUYA 2XIBA 1V7MH 3R7RA 2DEWX 1R3LB 3WHXA 1NGPH 4Z7NB 1KDIA 3UO1L 3E6FB 2AF2A 1SDAB 2XV2A 1DO6A 2GSGA 2PABA 1WWCA 3BUDA 2GJPA 3QEQB 4I5BA 1JHTB 1JGIA 3L1FA 3EH3B 5F8RC 4QY8B 3DPBB 4A37A 3RZCA 5DJCA 1RUAL 1HH6B 2CAKA 2N1TE 4LPTA 4NN5B 1EFXD 1UD5A 2EJ1A 1MNUL 3DV4B 5EUKB 4AMXA 2IGFH 2ZUTA 1CI5A 3GJFK 4HIEB 1KB5B 3ETSA 5FOJA 4P9ML 4PGDA 2AQ3A 1TR7A 1TTBA 1XGQB 5DFVD 4B27A 3RGVC 1J0KA 5A16A 4RQQA 4PB0H 4WK4B 4JFDB 1JGUL 4QT5A 1IAKA 2DQMA 1JZ8A 1SXSA 5DJZB 1K8IB 2DQTH 1DL7H 1OM9A 2QPUA 3CAFA 3PIQB 4YWGH 2IPTL 1U30A 4WWOA 4UTAL 3TFKD 1OT4A 5GS0C 4PY8I 4NQCD 4MCMA 2R1YA 4ZG1A 1CQYA 2OSXA 4JRLA 2P5WE 5LG1A 5KTEL 3F7VB 5L0QC 5C3IA 4AEFA 2VKXA 5JHBA 3CIAA 4A2GA 1WSST 3DUHA 5GGQH 1P4IH 4HHAB 5DURB 1WS8A 3P73A 5E2WL 3D0LA 4MX7B 1WIOA 5TDPA 5DD3H 5KVDL 1A7PH 4PSRA 5FM8A 1X5AA 3QIWA 4E2OA 2V9TA 3LB6C 4I89A 5DMGC 1I7UB 5L88L 3KXFE 1XDTT 3QO1A 3VD7A 2F74B 1D5XB 1H8SA 1RZ8A 3QZWG 3L9RB 4BJLA 2XWBB 4Z7UB 4E9YA 3KL0A 3PS6A 4MA8H 5H8DA 4DN4L 4XRCA 3TWCH 3MRHB 3QDGA 5ECGA 4WI8A 4PBVC 4PWEA 3X11B 1OF2A 4XVJH 3WE6B 2PF6A 4HT1H 5BO0D 4Y5VC 5K9JH 3ECWA 5AL0A 3C09C 1AGFB 1PAMA 4G3YH 4DT2A 3BXNA 3O6LL 4ORGB 3MR9A 5B3SB 2F5BL 4AQ8C 2WANA 3O2DA 1OHZA 2P43B 2OMTA 1SDYA 5JIKA 1ADQA 1MJ8L 4MMZB 5J3HC 5I6KA 3FOLB 3QHZH 3NDYE 1FFPB 3C60A 2N7BA 4M6OL 1J1XH 5HVHC 2E7CA 2IBBA 2VW7A 4HIIB 3Q6FA 5HJDA 2F53D 2WK2A 5F1OB 1AXTH 3T0XA 5FYJL 1OAKL 4G6ML 2MPAH 2YPVA 3AROA 3BO8A 1Z6JT 4B9CA 4PJ7F 5E94B 2B3RA 1CLZH 2GT9B 2MNJB 3QG7L 5KZCB 3CQFA 3F6JA 2KI6A 4KAQH 3AABA 1AXIB 3MLSL 3HI6L 1JFQL 2DYPD 2Z91B 4BCZA 5LQBL 1W8OA 1NQBA 4A55A 3TBCA 4YIQA 4AYBA 1HZKA 1TZGL 5C07A 3S2CA 2RIKA 1EEQA 2ODIA 4NDMB 5CN1A 3ARWA 5BXFB 1GMIA 1QA9A 5FO8B 2X7LB 3ZE2B 3KPTA 3OGOE 4YOKA 2WQRA 1XB8A 4ELKA 1CUOA 3U0WH 1ZT4A 2JJSC 2W5PA 4U1HB 3MODH 1AI1H 4U1IB 4YHPB 1JNNL 5DC9B 5JIIA 4K07A 3W5NA 1TUPA 2AV1A 5KS9E 2Y0SA 1WYJA 3NZ8B 4RBPK 1P4BH 3G9VA 3NJXA 2GC7C 2AKRA 3NUKA 1N6UA 3VGBA 5T1KB 4WCYL 1AZCA 1ETB1 1WHOA 3IGUA 3L5WB 5DGRA 4YBQC 1G87A 1HJBC 3LXUX 2EAEA 2VNCA 4HK3J 4MSWA 3SBPA 5IGXH 2W65A 1FO0L 3PPSA 5C6TL 1OTSD 1XGPA 4ZO6A 4JFHE 4Y16A 5F7BA 1YYCA 5LXGH 1HN1A 4RSYA 1E8XA 4K9EL 4PG2C 4XNZB 4EN3A 3UAJD 3J2PA 1IGFL 1QAWA 2XPYA 3CWGA 4L29B 2B1OA 5I8OL 2Z31C 2JJVA 2J71A 3VI4E 1CLOL 1QSFD 4KNTA 1JF1A 3E8UL 2XG4A 4KKNA 4M02A 4RGOL 3P3SA 3T04D 4UYQA 4LKCB 1I8IA 3EOYG 3QS2A 5IMMB 2BVOA 3DX8A 3B2VL 2X4SA 4OZFG 1AIZA 3QAZB 5CWSA 3RBSA 1RXLA 4H0IA 3ZKMD 2IH9A 1TDQA 4KHTH 3U6RB 1ZLUH 3KXFB 1TO5A 3KLAA 1L9OA 3SKNB 4KJYA 1AOZA 1YJDC 3QIBB 1TVBA 1JOIA 2WVUA 3S34L 1QWUA 1XEDA 1XXDC 3U36A 4Z0XA 2IADB 4HS6B 3IU4L 3VFRB 2OSLA 1E4HA 4KI5E 4MA7H 2NXZC 3FTXA 3R4DA 5JOEA 3L2MA 4CAGA 3B9KD 1JZ3A 2PO6A 3DGDA 3MRQA 4H5SA 2EVIA 2WB1A 3QNZB 2PCPB 1T0NA 4LARL 2VDPB 2WXJA 1R24A 4QXTA 4Y8DC 4GQQA 2Y7LA 1VFAA 3NCEB 1EWHA 1K4CA 1CDHA 2ADIA 2O4EA 1WZLA 5CGYD 2Z1PA 3WN5C 3IDMA 4JPVH 1HZHL 1VB9A 3C5SA 3UJIL 3VB9A 2YD3A 3BZEA 2UY7A 3GLDA 3KYOB 4ZDHA 1VEOA 3Q1EA 3HR5B 3RLSA 3DX7B 4XP4L 3ARBC 2BM3A 4W9ZA 3M1BA 1T2JA 3G3LA 3FQTA 5L8LB 4P2RE 3K3QA 5H2BA 3KPSB 4XPBH 3L3GB 4IJTA 2BRRH 1RKRA 3CDZA 4HGKC 3QW9A 1R3HA 1NLBH 1FFNB 3QHFH 3TF7C 3T0EA 4FQQA 4XPTL 1FN4B 4QNPE 4KMTH 3VXUE 5I66A 3TJEL 5DMYA 4PJAA 3VFWA 2NY5L 4O2FB 2QELA 2XPGB 1KB5H 2ADGA 1VFOA 2FLRT 1KULA 1YEEL 3N9GL 4PRDB 1X6LA 2I69A 3HNVL 3S8WA 3ARFA 4LSPH 4MVBD 5KYXA 5IMKA 3CV5A 2HSIA 1BMWA 4OUUA 3BDXA 1WITA 3SY0B 4OFQA 4WK2B 2DQCL 3B2DC 2VDOB 1L0YA 1P6AB 4W93A 3MCKA 3PWLA 2WZAA 1D5IH 1RP8A 3KHOA 2WZ5A 5ENWA 3UTTA 4XNXL 2OL3B 5BVPH 5I30H 1QFWL 1KCLA 3PQYD 3WFEL 1E6OL 3FTSA 4WHCA 1BQKA 5C09E 5MHSE 3X1BA 3PGDB 4UNVA 4IBUA 4F2EA 3QJRB 4F33A 1BJ8A 4YVUA 2YMXL 5DRXA 3GD1C 4RA3A 3LPWA 1YZZA 1DBAH 4TNFA 3Q2WA 5FHAH 2YKLH 4XWOC 4OLWH 3GUTA 4JO1H 3F12A 4JN1H 4LSRL 4O9HH 3RL2A 1HI6B 3LH2L 3DXAA 3KYNA 3U6XA 1DQTA 2CA4A 3D39B 4JKLA 4U6TA 1NMCB 4WTXA 2PTUA 1FZOA 5IFAH 1XGUA 4E5XB 3VI4B 1F90H 3BQUB 1KUMA 3PWUA 1BVKB 2BVPB 1D3CA 3MKGA 4FMKA 1DUZA 4I77L 3PGFL 2QSQA 2OXHB 1CCZA 4I1RA 4U0RB 5K5YA 2ORBL 2Z4QB 5JIPA 4ZMYA 1FL3A 4HAFA 3VA6A 2KL6A 3BI9X 1E42A 1XR9A 2K4WA 2BVQA 4YH6A 2WVTA 3MX0A 4OD1H 4ZUSB 4HKZB 5AW4B 2E7MA 2OP4L 3LX9A 1L6ZA 3QI9C 4NSKA 1G7PB 2HPOA 1QSEB 3FT0A 4UU9B 4E9QA 2VYRE 4IRJA 1HXYA 4RFEA 1MHHB 2HX7A 1IE4A 3SB3A 4Y88A 4L9LA 4FC3E 1IBYA 1N5YH 1N19A 3DDFA 4G8EB 4CVXB 3HFMH 4XCEA 1X7QA 1J0ZA 1FG2B 5TK4A 5CN3A 1ONQA 1YAIA 1Y6KR 4C4KT 3BSZL 4N3UA 3OX8A 1KIPA 3T2NH 3UROR 3HE7A 2AS5M 2VLJD 5IVZB 1KMGA 3FU8A 4QRQA 1QFWI 1UCBH 3K5RA 3NIDB 4LSUL 4OGZA 1BFOA 1L7IL 2KT6A 4PY7B 2CZNA 3QWOB 4OZGE 4MXWL 3FO2A 4UM9D 3NSXA 1H3PH 3LKQA 3TEXA 1QFHA 5GS0D 3C5ZA 1OARH 1S7VB 4L23A 5E24E 2Y2WA 4S2SB 3UJJH 3G5ZB 1RFDH 1PEWA 4PLKC 1I1AC 1ASPA 5JYLA 4MAYC 1EZUA 5AWNL 4WO4C 5DHDA 3GK8L 1NCDH 5D2LE 4F8LA 3OMZA 1UOKA 2ID5A 1JGLL 2Q8BL 1YNKH 1HH9B 4TVSa 3SDDC 3GMPB 3UGXA 2EEDA 3MLUL 3PJSA 4P2OB 5CBEB 4XGZB 2X4RA 1GGCL 3CSYA 3WFDL 2ZOKB 1NUNB 1WPCA 5ECJE 1LDSA 3MGOA 5DSCA 1OWWA 3US0A 1AHWC 1J8HA 2C1PB 3H3BC 4QRPB 4KKZA 5HBBA 4ODTH 3S3PA 3D50A 4MWFA 1MUJA 3DPDA 4G7RB 3G5YA 1H6EA 3BVWA 3GSRB 4ZSOA 3VB8A 4FG0A 4N6RA 1LEGA 4JREB 1JV2A 1KJ2L 3FBKA 4HIHB 4HPYL 4PCTA 5AVQB 3H42L 2G60H 3GLAA 3O0RH 2ERJC 2D7PA 5FO9B 3FCTA 4ODHH 3LZQA 5J3HD 1X3DA 5IM7A 4I3SL 4J6RL 1S5IH 4LOUD 5J8OA 3BCDA 4NFBA 4ODSL 5DK2B 4H88H 1U42A 4F80A 1SYVA 4HEPG 1E9PA 1A3ZA 3Q6GH 1IC5H 4QYOA 1TTGA 1HHKA 1U3HA 3H6JA 3QGVA 1E5AA 3AUVA 5AB2A 1FFTB 2JB6A 2G0LA 3F8UB 1YNTB 4L8DA 3QUYD 4A2EA 4M7LH 1J1PH 3LRMA 3FUKA 1JNLL 1F4HA 1HNYA 5AOMA 1A21A 5GGSA 4DPBX 4KVCL 4BH7B 4RMTA 4GT7A 4XNBA 3CZGA 5JYMA 1OB0A 4YAQB 4ZYKA 4TNWF 3TURA 3GHBL 4PMEA 3TO2A 4CC4A 1I3RA 3CX2A 4PRAB 1T20A 4JHWH 2W0FA 3CD4A 2VDPH 3GSNL 5L2JB 4YXLH 3AT8A 2Q3AA 2VLKE 3PABA 5L2KA 1JPEA 5HYJA 3ATAA 3IRPX 4X99A 4JQIL 2V33A 5LHDA 4NZUH 1Q4NX 5AW1B 2XI9A 1TXKA 1MIML 5DZAA 4IRZL 3IFNH 2QR0B 5C0AE 1OSYA 3QZOA 3S35X 1H9VA 3BLBA 3BUIA 5DK0B 4DF9A 3MJ7A 2OLDA 2XJKA 2V2XB 5G4MA 2A1WH 1K5NB 5IMOA 3A4EA 3MRPA 1QZNA 2IOIA 2WINB 5DA0B 3ARDB 2GY5A 4MJIB 1EV2E 3I9GH 3IJ7A 3CSPA 2W0KA 1MRFL 1VF5C 3NPZB 1QQDA 4GIOA 3PRZA 2X6CA 4OZGB 5E08H 4Z7OF 1Z5YD 4AIEA 1CYGA 1YEWA 3H2QA 1Y1DA 1MCFA 3CFBA 2A6DB 1RY7B 2R2EB 3IXTA 4JN2B 3SPCA 3UP1A 4Q9QH 5K59F 2I26N 2VZVA 2Z31D 4G82A 1IM3D 1FC1A 1TFPA 2YOAA 3UTSA 2AJ3B 3BC9A 4PJFF 5T1LA 2WUBL 4OF8A 2X3CA 1OAJA 3ZQWA 4AL8H 3G6AB 1KXVC 1KT2B 2J88L 4KTEL 4OQTL 2I24N 2PWEA 2VDOH 1AO7A 1XEUA 5C71A 1GCYA 4OFPA 4HLEA 1EEYB 3GS7A 1NTDA 2VMDA 1G7IB 2ENJA 4Y4FC 1R5WA 2OL3H 5AW3B 2V5RA 1N6QL 1E40A 4JFED 1EANA 3K81A 1CFSA 1SEBA 1CTMA 2CALA 5F7EL 1IRAY 3WD5H 1ZAGA 1UURA 4UNUA 5TQ2L 3RX5A 4KOBA 2VXVH 3JTSA 4N2CA 4FP8H 1A4KB 3EGDA 4APQD 5IB1B 1OP5K 4Q56A 3ZN6A 3IXAA