2A3TA

Cu-containing nitrite reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Structures of the oxidized and reduced forms of nitrite reductase from Rhodobacter sphaeroides 2.4.3 at high pH: changes in the interactions of the type 2 copper.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA02
2DYSB 1E5YA 1OE2A 2PP9A 3ABMB 4PCYA 2HLEB 2QDWA 2BWIA 1A4BA 2OJ1A 2IH9A 1J9SA 1NIBA 2BHFA 3QJVB 1MG2C 2PP8A 4WKXA 2QPDB 5A7EA 4YSUA 1L9OA 2NRDA 3X1GA 3SBQA 3BQVA 1MDAA 1PZCA 3ASOB 4QKTA 3IN0A 1A4AA 2R7EB 1L9QA 5D4HA 3ABGA 1OE3A 1XB8A 4YSPA 2AVFA 1PLCA 1CUOA 1AAJA 2HX9A 4JHVA 1NICA 2XV3A 1BEXA 1RZQA 4YSAA 5I6MA 3FS9A 3NJMA 3UABA 4YVNA 4A2GA 1ASQA 1L9PA 2GBAA 5I6KA 4KO9A 2XXGA 1A8ZA 5B1JC 1GW0A 3EHBB 3QQXA 4AKOA 1AIZA 3ERXA 3NT0A 4DP2X 2YAHA 4E9RA 4ZK8A 2FQFA 1IBZA 2QDVA 1BXVA 2GC7C 4G7RB 1AR1B 2B3IA 3AG4B 1J5DA 1KGYE 1N68A 3CDZA 3RYMA 3UGEA 4AX3A 2XX0A 3FT0A 2CAKA 2LLNA 2IH8A 3FSZA 3FU8A 1ADWA 1GYCA 3V9EA 2DWTA 2UXFA 2Y1AA 3IN2A 3V9CA 3AG1B 4N4YB 1ILUA 3WKQA 4F2FA 3IEAA 5I5MA 1AG0A 1BYPA 1SJMA 3N55A 4DP6X 2PPDA 4FAAB 4P5SA 3PPSA 3EF4A 4UF7C 3T6ZA 3NSCA 3ZBMA 1V10A 1BXUA 3FU7A 4G7SB 3EH3B 1URIA 4DP9X 1E65A 3EH5B 3NJNA 2BP8B 4HHWA 4A2DA 1YLBB 1PLAA 1I53A 1MZZA 1T5KA 1RKRA 1AZCA 2AFNA 2PPFA 8PAZA 2JFCA 1SDDA 2YAEA 1V54B 3FPYA 2MRYA 2UX7A 1ET5A 2YAOA 2FNWA 4YL4A 3S8FB 3NSDA 3FYIB 3NSFA 4BDVA 2HRHA 1TU2A 1PNDA 4KOCA 3OMIB 2PPEA 1GY1A 1W6WA 1JVOA 4NAJA 3X2QB 1OF0A 4G72B 2FQDA 2VW6A 1ASOA 2QPEB 1X9UA 1BXAA 3PXLA 2J5WA 4K9JA 1BQ5A 2IWEA 1RZPA 2UXVA 4DP0X 1E67A 3EH4B 4DPAX 1NIFA 1IBYA 4RH4A 5B1AB 4AKQA 3HEIB 3MBWB 4E9TA 3JT2A 4A2FA 1GS8A 1WA2X 1XB6A 1J9RA 3NJKA 4UAHA 2BZ7A 2VW4A 2IWFA 4F2EA 2UXGA 4DPBX 1PZBA 3DIVA 1JOIA 2XXFA 2FT8A 2HRGA 3DKHA 3NJJA 1KBVA 4E9YA 2AANA 4KNSA 1RCYA 3FQ2A 2EIJB 2DWSA 1SFHA 2E86A 3KW7A 2Y69B 1QLEB 2IDTA 3T6WA 3ASNB 5TK2A 2VMJA 1NPNA 2VSMB 3H56A 1F56A 5IY5B 2MTAA 1WS7A 2EILB 1WA0X 2N0MA 4GXFA 3MX0B 1HFUA 1OE1A 1PNCA 1NWOA 1OOWA 3FSWA 5I6PA 3OD3A 1AG6A 1GR7A 3S3CB 2BZCA 4BXSV 3WNIA 3PCYA 1QNIA 2J56A 5I5IA 1JXGA 2GB2A 2I7OA 2PCYA 5B7FA 2WSDA 4AKPA 5I6NA 3ZX1A 1PMYA 3CVCA 5EHFA 1OV8A 3DTUB 2J55A 1KCBA 3WKPA 3T6VA 5I6LA 1A65A 1CURA 1JZHA 4YSCA 2PLTA 5PCYA 4G7QB 1SHWA 4HCIA 3IBOA 2H47C 1MZYA 5I5JA 4Q89A 2YXVA 3ZDWA 2BP0A 4NB7A 1NDTA 1NZRA 1FA4A 3AG3B 3TBBA 2PCFA 1BYOA 2TSBA 3NP3A 4GP5B 4WTQA 1BAWA 2CALA 2IDFA 3FQ1A 1KDJA 3NJGA 3CDZB 1PAZA 2AZUA 4G71B 4GY4A 3OQRA 1SHXA 3QJRB 2EIMB 1J9QA 2FJSA 1JXDA 3BVDB 1L9TA 2XWZA 5AKRA 4BWTA 3QJQB 3AW5A 4QLWA 2X87A 3T71A 1B3IA 3GYRA 1JZJA 1EHKB 2HX8A 1NIAA 3AY2A 4A66A 1IKOP 4DP8X 2HXAA 3CG8A 3GDCA 3NJHA 3UAAA 4A2EA 3FU7B 5B7EA 4E9WA 1SF5A 4E9SA 2AZAA 1SDDB 1OCCB 3AZUA 1IC0A 1ZDQA 1A4CA 3SBRA 1MG3C 3HB3B 4W9ZA 3WIAA 4A67A 1JZEA 2FWLB 6PAZA 3FU9A 1IUZA 4BDVB 4X4KA 1ZPUA 5I26A 3UADA 4KNUA 5E9NA 4YSTA 4YSRA 3FPXA 1AOZA 2CCWA 4KO7A 4YSOA 2JKWA 2Q5BA 5B3SB 3H4FA 1DZ0A 3U25A 2UX6A 4HAKA 1JZGA 1X9RA 1KV7A 4YSQA 4DP4X 5D4IA 2CJ3A 1SF3A 2VM3A 3FSAA 1NINA 4YSEA 1SNRA 3ABKB 3JTBA 3QPKA 2XUWA 1AZUA 2YQBA 2J57A 2WO2B 3PAVA 1ZIAA 1NTDA 4DP7X 1NWPA 1A3ZA 3PLYA 1GS7A 3OMNB 2BO0A 4NERA 1JERA 4AI7A 1M57B 2XV0A 3CVDA 2Q9OA 2ZONA 4AZUA 2DYRB 1HAWA 1BQKA 1AANA 1KBWA 1R1CA 2BW4A 2UXTA 3FSVA 1PF3A 1ID2A 4HHGA 1J5CA 1L9SA 2I85A 2OV0A 1PLBA 7PCYA 1CC3A 1XB3A 2YXWA 4HCFA 1EZLA 4BWWA 2XYBA 3NYKA 2A3TA 9PCYA 4GYBA 1OCOB 1VLXA 4BK5C 1FFTB 1ZIBA 3GXUB 4A68A 1JVLA 2BWDA 3PAUA 2DY2A 1AZRA 4PAZA 2B08A 3S3DB 1AACA 2P80A 1SFDA 2FQGA 2P80D 2RACA 1GS6X 4GP4B 3IE9A 4L0PB 1L9RA 2EINB 1ET7A 1GSKA 1ILSA 4DP1X 2GIMA 2GSMB 2R7EA 1ASPA 1ZDSA 4BXVA 1CYXA 5TK4A 1M9WA 3KW8A 2IDQA 5F7BA 1AQ8A 2JXMA 5B7MA 4W1TA 4G70B 2TSAA 2GC4C 3SQRA 2XX1A 2YAPA 3OMAB 1TKWA 4KOBA 5I6OA 4N8UA 4GP8B 2IDSA 2BP0B 2GI0A 7PAZA 2FQEA 3D12B 1KYAA 3UACA 4F7KA 3PAZA 5LDUA 1PZAA 3WI9A 4HALA 5F7AA 4M3HA 1QHQA 4A2HA 2VN3A 3ABLB 3OM3B 3TA4D 2CBPA 3FYEB 2H3XC 3NP4A 2BW5A 3SBPA 4EF3A 3QJSB 2DV6A 3X1EA 1AZNA 3TU6A 1NIEA 1OCRB 4E9VA 3X1NA 5FC9A 1TEFA 1WA1X 3QJTB 3X1FA 1NPJA 1FWXA 3NJLA 3T6XA 3S3BB 3TASA 1DYZA 1E30A 5B1JA 1WS8A 4KO5A 6PCYA 1JZFA 2XVBA 2IDUA 3NSYA 2CUAA 4JKNA 3X1BA 3NJFA 3S8GB 2FT7A 2EIKB 2HX7A 5I28A 2ZOOA 1WAEA 4DPCX 1HAUA 1GY2A 1KCWA 1AS6A 2YAFA 3ZIYA 4HIPA 1PCSA 5ANHA 2IWKA 1W6LA 1V55B 1W8EA 1ET8A 5B1KA 2XLLA 3AG2B 1N70A 4JHUA 1BQRA 2QT6A 4BWUA 1NIDA 4KNTA 4YSSA 2BP8A 2XU9A 4E9XA 2W88A 2PPCA 3FQYA 2H5UA 4HZ1A 4UANA 4M4RB 1XMEB 4HCGA 3TBCA 1AS8A 3WNJA 4ENZA 5B1BB 2ZXWB 2FTAA 2YAQA 4YSDA 3H4HA 4P5RA 2YARA 5AZUA 1E5ZA 2GHZA 1J9TA 2YAMA 1KDIA 1AZBA 5PAZA 4CSPA 1TEGA 4DP5X 4FA7B 1ETJA 3C75A 3T9WA 2VSKB 3L45A 5AFAA 2PPAA 1M56B 2FT6A 4CSZA 1UATA 4Q8BA 2IAAC 2PP7A 4E9QA 3CVBA 2VW7A 4MFHA 1ZV2A 1CYWA 3WG7B 4TXVB 1JZIA 2WO3B 2ZWNA 3G5WA 3QJUB 3NJIA 2VM4A 3CZUB 1OCZB 3N2JA 4KO6A 3UAEA 1JXFA 2I7SA 2X88A 5D4JA 2OCCB 1AS7A 1PY0A 2HZHA 4YVUA 2W8CA 2XV2A
chains in the Genus database with same CATH superfamily
4GFTB 2P28B 4TN9A 4RGNE 5HP5A 5L8KB 3QQ3B 1JPSL 4OAWB 4PCYA 3S3SA 1BJ1J 4IJ3B 3I02A 2PR9A 3MN8A 1L9NA 1G43A 1UHVA 2J3SA 2XFXB 4FQHB 4WWPA 3ES6B 3LVEA 2XPZA 4HBCL 1NC2B 2XWDA 4PJGE 4W9CC 3VXSE 3O3EB 3NDYE 3KLHD 2M83A 1NMBH 4MCMA 1JPFA 2PYEA 3VGFA 3GMLB 2G2RA 1CZ8H 3IN0A 3SBWA 1A4AA 4NO2A 4JZJA 3L4VA 3RIAK 2EJ1A 2VH5L 3K46A 2V8LA 3VYNA 4NX0A 1F5WA 2FEEL 4FQ2H 4HJ0D 4K7FA 3C2AL 5IQOA 1EO7A 2OXGA 3BPCA 2K45A 2X2IA 4Y2DA 1KB9J 3VWJA 1YECH 1EFXD 1MIEH 3HVNA 4ZPTA 4AH2B 2QADB 2XWJB 5D7IB 3V9FA 5HYQB 4ODXB 4A2GA 4AEIH 2OI9C 3TBTA 3P11H 4B0MM 2ICWA 2PYFB 3IDNB 4IU2B 1F2QA 3OKDB 1AC0A 4FEMA 1KBPA 3GHBL 1ZTMA 2UY6B 4WI0A 2XXGA 1RULL 1FIGH 1NBVH 4N8VG 5F88B 3WIIL 1NCBL 1XCTB 2NLJB 2HKFL 1AIZA 5AW2B 1LK3H 4P5TA 2NY5L 3ECVA 4TNVF 3SDDC 1MCWW 1HESA 3VFRB 3TNNA 2NR6C 2VSCA 1BDYA 5F96H 4NUGL 4WWOA 3W1ZA 4XP4L 4E41B 5E2VL 1O5PA 4E5XG 3D4CA 4LFHD 1N68A 4WNQB 1V7NL 2AJSH 1YNKL 2Z4QB 2JCCF 1YEGH 3VDAA 3BOVA 4IKIA 5L2KD 4IQHA 2I9LB 4U3CA 4XGZA 5KG9A 3CU7A 1BBJA 4FG6D 4FYTA 4A39A 1UVQA 2Q3AA 4G1MA 1PSKH 3S36X 1UXSA 5FGBA 3L1OL 1MNUH 1T6WA 3QA3B 4FQJH 4QEGA 4ZAKB 2VLRE 3Q13A 5DMIL 4J3UA 2PNDA 3PDDA 3KCWA 4I5BB 1HH6B 1OHQA 2PCPA 1QO3B 1VPOH 5DMJB 5DZPA 3MDJA 3TT3H 5C0IA 3RBGA 3FT3A 4ZPVB 2BP8B 1MRFH 2H6PA 5AKTA 2VZUA 2Y2YA 4M6NL 4NKIL 4AGLA 4K3DH 1YLBB 3KCPA 5JHLA 1SXNA 4UTAL 4HS6A 1UXMA 2XNAA 5T5NF 5IWLC 4MJ4A 4L9DA 4P2OC 1GRWA 2NY7L 4M61B 2WZ5A 1OPGL 3D3VB 3P3RA 1XF3A 1B9ZA 2H9GB 2WGXA 5IUCA 1AHWC 1QABA 2B15A 3OMIB 1YA5A 2V37A 2Y7QA 3FC8A 4DGIL 1WPCA 4DN4H 4L4VD 2WVSA 4GBXC 3AQZA 1FLRL 1OF2A 1WD9A 4K2UL 4X0KA 3QR0A 4GKNB 3O6FC 4G72B 5KBDA 4AT6A 1F11A 3V0HA 2FSEA 4HFWA 3WFHA 2CDFA 5AKSA 3ULVL 2YRZA 5KJRH 2GKIA 3JT0A 4RFEA 5L0QB 1BZQK 3GSXA 1A9EB 4MNQB 4TTGA 2BRRL 2BVUA 5K69A 1I8IA 5GGUB 2DLIA 3DV4B 4NKMB 2AEWA 3BEVA 3T2QA 1H5BC 5I0VA 3T1WA 1WA2X 3HNTH 5DRZB 2YK1L 2K6YA 1GCYA 4YEEA 3AREA 3MCKB 1TTUA 1HC1A 3K8LA 5JHDB 4MNHB 1QW8A 5I30L 1QFUH 1E9OA 2HKAA 2FT8A 2JB5H 3SQOL 4AGPA 5BVJA 1UCTA 5FECA 5AL8A 3C6EA 4LNRB 2VDNB 2YD6A 3DRTA 1WBZA 2NMSA 2ZNXA 5HI4C 3VI3B 4XMPH 4Y16B 1U6AL 2IDTA 4OGAC 1RPQA 2VIRA 2FEEI 3QDJD 5HHMB 2EDQA 1UT2A 1Z66A 1TJHL 5FYJU 1EGJL 5DD3L 4MVBC 3CFQA 3LIUA 3S5LG 3VD3A 1A7NH 4IOIB 1IIKA 4DEPC 1FZKB 4EKJA 1LHZA 3CCHB 3QWRA 4XN7A 5DD6A 5F9OL 3UG5A 4HQQL 4FQLH 5IHZB 3ZL4H 1G7IB 4BFJA 4OI7A 5IIEA 2Q86B 2AJXH 1BMGA 3CVCA 4FGMA 2F18A 5KAQG 1FL6B 1F42A 1NUNB 3HHSA 3IDXL 1KEGH 4ZUWB 1TJGL 2NYYC 4FNTA 2BY1A 4R96A 4XCNA 3DMMA 2WINB 4MNGB 4XAWH 2HTLC 4FP8L 3WDIA 4XHJD 2BP0A 4Z7OE 4H1LG 3DHJA 4HUCA 5ILTL 5A2JH 2HH0L 2R56L 3ARBC 1FA4A 1LWRA 3ASWA 4FL4C 4XT1C 1J8RA 4X7SL 4UDUB 3V7AG 5JOFA 2W07A 1UCBL 1KXHA 3FN0H 1KDJA 3OHMB 2BOBA 4PEEA 5TDOA 1R3JB 3GI8H 5CXPA 3IJSB 3U30B 2WCSA 4AQOA 2IBZY 4K3EL 1P5UC 2A7BA 5CBAA 3B2UD 3BPOB 2XWZA 4L8CA 1DLFL 3IB4A 3MOAL 1UTDA 2X3CA 4BWTA 1CFBA 5FUCE 1YNTB 4NNYA 3OKEA 2YEVB 3T71A 12E8H 2JJWA 1L7IH 5GGVH 4RWYL 4L8DA 1J10A 1JZJA 2UUDH 5LN8A 1BZEA 3NH7L 4U1JB 1EEZB 4R90L 1JZ2A 1IKNC 4UM9D 4TULL 1DUYB 5TF0A 2E8YA 4OI9A 5JMRA 3R8BB 4R97C 2IAMC 1EZUA 4NLHA 1JNHA 5F7EH 5DLLA 1FFNB 2VC2H 3RDTA 4HXBH 1CE6A 3L54A 3PIQA 4PRDA 3UO1L 2WLJA 5INDB 3GHEL 3IBEA 4GAYB 5D96C 3WNOA 5DZ9A 2C1PA 1UKSA 1CDIA 5B3JF 1IUZA 3BW9A 2X1QA 4LLMA 4AQ8C 4Z0BL 1WAPA 3VCLB 4PHXA 5D7EA 3MJ9L 1LWHA 5I1KL 1BA9A 2WJ5A 4M4RA 1LQSR 1F3JA 2CCWA 4APQC 5F1SA 2X9WA 2BMKA 3UEQA 4Y5YA 2LW3A 4IBSA 4PW9A 1JWSB 3L5WB 3SKMB 1EAOA 3KBEA 1IAMA 2DKUA 3DDGA 4APXB 2E7LC 4WI5A 3FSAA 5EU3B 2FCBA 2XPGB 1H8NA 4UT9A 4UMSA 1FBIH 3PAVA 3BKJL 1Z32X 4L3CB 4LL1A 4G8GA 1PZDA 3HZVA 5F1IB 5A3ID 4L29B 1HL8A 3GSNH 1GKOA 1NTDA 4YHOL 4DP7X 4AVIA 2TRYA 4DF9A 1HNGA 1FVCB 3FQNB 4XPBL 3K6SA 4GSXA 5DEFB 3X13A 3GZQA 1CLVA 1CXIA 5HVFB 4JG1L 3TN0D 2ZONA 1UWEH 2BJMH 3JVFC 2AKRA 2OZ4L 1HAWA 4P23D 1T03H 2VAAB 1O9VA 1W0WB 3DVGA 3EBGA 4I85A 5BW7C 3E1F1 3SEPA 5EEYA 4B9IA 2KMWA 5D7LA 5TPWL 3B2DC 5GGTH 1MHEB 4F2MA 3ESNA 3ZK0A 4JKKA 3MBEA 1GMEA 3LKQA 5EZOH 3NYKA 2D7PA 2EUZA 3QWNA 3VRIB 2OK0H 4JPSA 4AM0A 5LWYL 4KK8D 3QNYA 1MW2A 1JVLA 4PJ9D 3V4VH 3WIFA 2B08A 5JPNB 3NIDE 5HHOA 3LKRA 3QNXA 5CJXA 3VE0B 1M6UA 3GIZH 3L3DA 2Q2LA 5FA4A 2RACA 3L7FB 3T3PE 1LP9E 1HHKA 1NKRA 3F7QA 5CCKH 3CVHH 4PRID 4L0PB 1IBHA 4F7CA 5FGSA 4I0PC 3U0WL 5AB9A 3N1QC 1ZLWH 1BV8A 5TDNB 4C56D 3GBML 5F0PB 3WENA 4YDMA 1BPVA 4A38A 4NT6A 4P06A 1Z9SB 5TK4A 1NBYB 3EOAB 5DI8B 4LZKA 1WTGT 5ITBL 2UZYB 2IXQA 1DSWA 1WWWX 1WP6A 2XVLA 1EQWA 3RTQA 5BZDB 1A6TA 1AJ7L 4JHAL 4PB9L 5DS1A 2VXQH 2Y5TA 4OZFG 2OQJB 2X3BA 2ZJSL 1U8OB 3O8XC 5DTFB 4NKQB 1SOKA 4LSPL 4F7KA 1BLIA 2PW2B 4YR6A 1U8IA 3QXVA 3UGXA 5B8CA 2R1YA 4ZO7A 3G6JA 3NCEB 3TWCH 1T1XB 3EH1A 2HG5B 3ZTNH 2VZ1A 5FB8A 1X4XA 1YO4A 4Y5VC 5EZLB 5C2BH 1PFOA 1FYHB 3LOWA 1MY5A 2AK4A 3RL2A 3VB9A 1DFBL 4OI8A 1PG7H 1O7SA 4H0LC 2ZWLT 4I9WD 4K8RC 5EU6B 3MV01 3JSSA 2IMNA 3DTDA 1OAJA 2Y1YA 3BZFA 5KS9E 3ULVD 1AGEB 2NTFB 1ES0A 1EAQA 5BRZA 1BVNT 4ZNEA 5EEZA 3VACA 1Z5LA 2ZOUA 3MRNB 2NY6D 4F92B 3N9GL 3QIBA 4KTYA 5EO9B 4DZ8B 2KC0A 1MCRA 5B1KA 3V5DA 1SEBB 1I8UA 3OAWA 4ZRGA 4IRZL 2GK0A 4J3TA 5F7WC 4G1EA 2QT6A 4JFQB 4K07A 5IR1A 5K9QI 3ZZSA 2A9ML 1DUZA 1KTCA 4U1HA 1S9YA 2VERA 5ACZB 4ODSL 1TTFA 3K5RA 4MXVE 2E3VA 5CKAA 4EI5B 1IM3B 4HPYL 2OPCA 3LB6D 1FRGL 2AI0H 3LJ3A 3MJ7A 1O5DT 2BIOA 2E56A 4OF5A 1N67A 4PRNB 4YZFE 4DP5X 4EI6A 2EAEA 4KK9C 1IFRA 4APQB 5ALCL 2X4OB 1RZKC 1UATA 4TNWK 4GI8A 1JFQL 3HI5L 3OKNB 1QLRA 3VGHA 3JWNE 4X6EA 3QCTH 4GB9A 3KJ4B 5E8NA 3TO4A 2WLYA 5KSVA 1ZV2A 1XQ4A 2J8UB 3ULUE 2VLMD 4I1RA 2FJGA 4A2MA 2CLZA 5EOTB 3CUPB 5HHQB 1WIUA 4KAQL 4AQ1B 2BC4B 2NX5B 2HRPH 3Q2VA 5MI0B 1DANT 3MLUH 4WI3A 1MCLA 1NCHA 2Q8BH 4PG2A 3E6FB 1V7ML 2EDTA 3W56A 2JH2A 3UCRA 5EPMB 1AI1H 4YVUA 3CH1B 2ARJB 4J23A 3ZE1B 3ZZQA 1OE2A 2YRLA 1F02I 3N43B 1KT2A 1RVFH 2Z35B 4J3XA 3S36H 4DK5A 4G82A 1O7VA 3UTSE 2C9VA 1OM3H 2H3NA 4YLCA 4HIJA 4WK0B 3I85A 5F89B 4HK0A 1OP5K 5DMGD 2WLNA 4R5TA 4RISL 4PGDA 3GSNA 3UG4A 5E8OB 2K3HA 1TYEB 3ASOB 3SODB 2WMPB 3ZTJH 3KWTA 3FU0A 5BNXD 3B37A 1BVLB 3MACL 4MJIB 3GMMA 5KOVC 2BSTA 3V79C 2GJZA 3QO0A 3D30A 4BQBA 1UG9A 1EFXA 4G6JH 4Z3HA 2BS8A 1N6QL 4Q9QL 2I69A 3RP1A 4BEIA 4NM8H 1PCXA 1UOVA 1NGQH 3EIFA 1TKWB 4JO8A 4MQXC 4ZMTA 1E43A 3GXTA 4G8EA 3UERA 3TFKD 3GRWL 3CHOA 5LKNA 4L9LA 1L9PA 3RG1C 2CBMA 4M6OL 1BQSA 3OSVA 3QUXD 3V4VA 2ZOWA 4PJCF 4J3OC 4RESB 5EF3A 4QPEA 4HFUH 1QUNB 1D5BB 2W0FA 2P7TA 4MJHA 3Q5YA 4MS8D 3VSUA 4DK3A 4ODHL 4F7EB 2YAHA 5IB5A 5JPMC 1N59B 4IM8A 3C5SA 4OQTL 4ZK8A 3WLWC 1EIBA 1S2EA 5EIVA 1YY8A 2GJ6E 3DSNB 4L4JA 1XF5B 1BXVA 1JPSH 3DX1A 3FFCB 4X5XB 1CE1H 3VFTA 3BQUB 1JI1A 3E38A 5ACMA 4FLOA 3SPGA 5L2KA 3ZW3A 2P5ED 3FT0A 1VACB 2CR6A 2AQRA 3MCYA 3BPNC 2Y1AA 3V9CA 5IMLA 3HE6C 2CDGB 2J1XA 1T83C 3INUL 2VXQA 5F97E 32C2A 5HY9B 3GMNA 3CDCA 1IC4L 4IMLB 3IRPX 3O9WA 1I1FB 4UF7C 5I74C 5C0AD 5JUEL 3WU1A 4P3CH 5DJCB 3FU7A 3EH3B 1YQVH 2AJYL 3FB8A 1QQDB 1PLAA 3CFBA 5HDBE 1SDDA 2YAEA 3HW7A 3PQYD 4FZ8L 4HZLA 4LCCA 5FO9B 3CXDH 4GIPD 1ET5A 4MSWA 4KGJA 2F8VA 3NSDA 3HB3D 1OTTC 1F13A 2FH6A 1CCZA 1JNNL 1RJYA 1TU2A 4LSTH 3TVMB 3KEHA 2ZAHA 1OD9A 3LYRA 4L4VA 5E0QA 2WZ0A 1PIFA 5EUOE 1BAGA 2PPEA 2JCWA 2QGEA 1JGVL 3C09B 4X4MA 1JN6A 5C6TL 1BGXL 1QPPA 1XIWC 4W9GC 4XP4H 1JGLH 5E2VH 5IBLD 3LXCA 5AAPA 2ZCHL 5CD3A 2IWEA 1GGBL 4XC1L 4AEFA 3J27A 1DN0B 5EO1A 4PMFA 3EUUA 2FO4B 1SY6L 3OB0K 4FHJA 1YRKA 2VXVH 3S7GA 4G5AA 3ZO9A 1S7XA 2VW4A 2XZQH 1KTLA 4HUWB 2MCMA 1CFVL 4QY8B 1OY3B 1EAPB 1G6RA 5AZEL 3CBJB 1GOGA 2ZCLH 3BUTA 3IDIB 3MROA 3N04A 5C0GB 3STLA 4N6RA 1KLFB 1M7IA 2CJUL 4Y4FD 4NKIH 4JL2A 5F3HA 3MR9B 1D9KD 2J6EL 4TNGA 1GHFL 3S5YA 3MA7A 2F15A 4PV9B 1ERNA 1NPNA 3A67L 3H56A 3WN5B 4KJPD 2J71A 3FQXA 4IEFA 3QUYD 1OPGH 1J7VR 4ODBD 4NN5B 4IMKC 1OAQH 1HXKA 1OE1A 2V9UA 4NJ9L 4FLSA 1BZ9B 1JWUB 1QOKA 3L95A 4DGIH 4NZFA 2DM3A 3C12A 4K2UH 2E27L 3CLEL 1RAMA 1KBGL 1HXMB 4X8XA 2Z93B 5BO1L 1HI6A 3QEUA 2DWEA 3C5ZD 2X4TB 3WKPA 3U6RB 3N42B 5KAQF 4Z7UE 3BZEB 1FNGB 1JGUH 2BRRH 5DHVA 2IANE 1NMCC 3FJTA 1FVEB 2LABA 5HHXL 3GBEA 5IK3A 2YK1H 4Q6IA 2HP4A 3BUDA 3TBBA 4MDJB 1E50A 2DMKA 4WTQA 5D72L 3HUJA 4PYGA 4WUUD 2IALB 2WSPA 3MLVL 4TUKL 5I19H 1FYTB 3UXFA 5J6HB 1ICTA 3V2AR 4DKEH 3WDJA 4AJVA 1CFMA 1XH3B 1JAEA 1QKZL 4AXWB 1VCBC 1IC1A 3ARZA 1U8HA 3BWUC 4OF6A 5DUML 4BM7A 1TJHH 1HTYA 5I9QB 3KYOA 3ETSA 3IKCA 4UM9A 5DD3H 3NZ8A 1E4XL 3T0DA 1NMAL 1H3PL 4JKPH 1AKJD 1HL5A 5AAWA 1I1AC 1I8MA 1SVBA 2WWKO 4QXUH 4OZHA 5T3XE 3EJQA 2MPAH 3V8CA 1MHPH 5HHNB 1Q1JL 2IFFL 3ZDYF 4WCYL 3BUBA 1KZQA 1T5WB 5C2UB 1VCAA 1T6BX 5EN2A 2YMXH 3NEXA 4KK5C 2ADJB 2VZVA 1MG3C 4A67A 4RDQF 5FOBA 3G5ZB 1X5YA 4KUZL 2IVFC 1ETZA 3CBKB 3FZUC 4P0DA 1C8PA 1JPEA 3H3KA 3P4MB 3FDWA 2QSVA 4FP8H 1ZSDA 3KLSA 2JKWA 1KN4L 3PWJB 2R56H 1NFIA 1DLHB 2UX6A 2ZG3A 3NRQA 2NSXA 4NSKB 3BSZL 2Z1KA 3QBTB 2W60A 1NAKL 2F54B 4R8WH 2DWXA 3CHQA 4EN2A 1SNRA 4TF4A 3UX9B 3UC2A 3CZFB 4NGHL 1JWMB 2J57A 5CFHA 1MFDL 3EJSA 4X80L 1DLFH 5IJKA 5GIRB 1A3ZA 1IJ9A 5DRWB 4FNUA 2ZNWA 2QV2A 3TN0A 3ZHFA 1YNLL 3PGFL 3HKFA 3C8KA 4YX2H 3QI9B 2V4LA 5BQDA 2VL4A 4D9QD 4AGOA 3ZMRA 1K4CB 1K72A 3NH7H 2BW4A 4HEPA 3EFOB 3F58L 4GT0A 4LGRB 4XWGH 5D7SL 4UTBL 4YQXH 5EEUA 1FP5A 1GGUA 3FCUB 4HLEA 3D0VA 1L6PA 3QHZL 4JFZH 3QCVL 4KVPA 3QUZB 1EXHA 5FM5O 1D5ZB 1EEUA 2EDYA 3LSOA 4PJ9A 4YPGB 3QULB 1OCOB 1F6AA 5HYSA 2CSPA 2E8ZA 1QEWA 5ISZD 4R4BA 4XNMB 3LDBC 4XO5A 4H13C 3KPLB 4LOFA 1EK3A 1A6AB 4WV1B 4WJ5A 4XMUA 4Z0BH 5J1SC 3V6FA 1OGAE 2ITEA 3SYPA 3QDJE 3MJ9H 4I3GA 3RFRA 1I9IL 5CLWA 4DHLA 3J2PA 4XCYB 1GSKA 3VFMB 5GGRY 4C56A 4EZMA 5K9KA 2K8QA 1ZGLP 1A25A 1VFUA 4UV7L 5F1NB 5AEAA 2Q7AA 1YMMB 5BS0B 4IBTA 5E95B 2E4TA 1FH5H 3T77A 5HSFA 4AGQA 3OF6A 1U95B 1AQ8A 1C5DB 5B7MA 3T2LA 4KROB 1H3UA 1UOLA 4W6YB 1V5JA 4G70B 3R4RA 4JN1L 2OR7A 2XWBB 4UDTB 5DO8A 4PCSA 1ACYL 4YHOH 1NFDF 2ZKMX 4TLKA 1R5IA 4UTAA 4YIQA 1BZ7B 4XPBH 5ANME 1KACB 5D2LB 1Y6MR 3MFFA 4OTXH 1WUNT 3VI3F 2K9UA 2OZ4H 4Y5XC 3B9KA 5LDUA 4CNIA 4X0NA 1GZQA 3UC0L 2VZTA 3GMQA 3V5KA 3VD7A 3G5XA 5D7JB 5GS1B 4NS0A 3GHPA 5CINH 2A73A 2LT9A 4XBEL 1H8OA 3JQOB 3P9MA 4HWZA 3EFFB 1KYUA 4LCWD 4R0LA 4CVZB 1K85A 1E4XI 3CLFH 4P5KB 4FQQA 1X6NA 5ACLA 4E9VA 1QLFB 5LWYH 4KDTA 3TOPA 2DMHA 2BY2A 1IAII 3X1FA 5D1XE 4P2YA 2QKIB 2Z34A 5I1DB 1J8KA 5B1JA 4OUUB 3NRFA 3AUWB 2IPUG 4QTFA 5M95B 2NY0B 1OSZA 4KO5A 3WELA 1PLGH 4CILA 3BE1H 3S8GB 3UAFA 2ZPKL 2AEQH 4EUPH 2RAMA 1FL3A 4ZFOB 3FCBA 1N6VA 3U0WH 1ZJAA 3CLWA 4FXGB 4YBHA 3SDDD 4LF3B 1IILE 1MHHB 1V55B 1PL3A 4UQAA 1UD6A 1A7QL 1ET8A 4EDXA 2BXZA 2FYYA 4Z7VB 2IH3B 1QI5A 2VDOL 3U9UB 1AD0B 1QZNA 3FB5B 5IJCC 1WWBX 4E9XA 3NQKA 1AJ7H 1OAZL 2W88A 2Z31C 3HG1D 4YHYB 5FUZL 2WXIA 5B1BB 1YN6A 1MJ7H 4WIQA 1DSFL 3TBWA 3SDYH 3MC0A 5AW9B 2WB7A 1EGJA 1GAFL 1K6QL 4UQ3A 3ZU8A 1AZBA 3T0EC 3E80A 2IOMA 5TE6L 1PY4A 4FA7B 2OZNA 1YNTF 2PWEA 2OCJA 4XCEA 3EYVB 3T9WA 1PKQE 3BAJA 2X4PB 3LEXB 4FERA 4QRQB 3JTSA 2AQ3A 2NNAA 3D9AL 3QDGE 1ZEAL 1BLNB 1KG0A 4E9QA 1YYMH 2VT0A 2X4NA 3BI9X 3WS3A 4P2OD 2H1XA 1DFBH 3T8XA 4KMTL 1C8QA 4YBLB 4G42A 2XACC 1TQVA 3CFUA 2EDNA 3EW3B 3VFUB 4MWFA 1D7BA 5IQ9B 1FVDA 1RZ8B 4GBXD 4U4BA 3BVXA 2O6CA 4F9PA 5D6CA 5JMOC 1S8DB 3O6FD 4H20H 4XXCC 3K6DA 3MGOA 2FECL 1QR1B 4FQIL 5C3IA 5KSBE 4K8RL 2HFGH 5HXMA 2PP9A 2GJJA 3MRPB 4FFYL 4JPKL 1B2WH 1MEXH 1WC7B 4HGWA 1ZLSH 5CIPB 3MGTA 4QRPE 4OLEA 3GMPB 1X4YA 2ED7A 1T1ZB 2A9MH 3TCLA 1S5HB 2AGJH 4PRBB 3P73B 4IHOB 1SXZA 4G9DA 4I2XE 4KXZI 4GQPH 1T22B 1NSNH 3VMPA 1K5WA 1AKPA 3RWGA 2R7EB 1FRGH 4R26L 5EUKA 4AY0A 4XRCB 1FG9C 4D0BA 1OE3A 1LILA 3MV7E 2DQTL 4PRIE 4F7TB 3RUGE 1MCBA 5F0JB 4XNXL 1FJ1B 3NESA 3QSKB 5ALCH 1MKFA 5HI4D 1DVXA 1J11A 4OGAD 4U1NB 5LGHL 3HI5H 5T5FH 1JZ3A 3PGDA 2YPKB 5EG6C 4HJGA 4PTTB 1NC4D 3GKWL 2PMZA 2FB4H 4MCYA 3BIKA 4BSVB 3BFOA 3HHMA 5SWSB 4ZYKA 4MQSB 3UBFA 2EEXA 2HFTA 4GG6E 1CQYA 5E5MB 1MCCA 1GGCH 1RZKL 3MJ9A 1P1ZA 4OCMC 5DFWH 1S6NA 5TE4L 1YUKB 3RU8L 1S7TB 1V7MH 3RWJA 2Z92B 2OMYA 4LEXL 2NCMA 1N8ZA 4KRPB 2J73A 2AQTA 3DHMA 4YFEA 4ZUVB 2DQFA 2G5RA 1JJUA 1WYJA 4ECNA 2DQEL 1KGYE 1E0OB 2NYYD 3RURA 4A7TA 4OM1H 1Z9OA 5L2JA 3FSZA 3PJLA 4XMLH 3UZEA 1JHKL 3PWVA 4JE0A 4URTB 5DEGB 1HCYA 2LU4A 2VDPL 3ARBD 1LVEA 3RVVC 2PCXA 2VLJD 4HXAL 5C0AA 5I0ZA 3IF1B 3ULVE 3EF4A 2OZ4A 3E7JA 3TO2A 2CRZA 5D70L 3ML9A 1PZ5B 2EYSA 4MB4A 2YC1A 3OKKA 4G7SB 1CT8B 3WIHL 3BZ4B 3KS0H 3D50A 1ACCA 2NSMA 5E4IA 4OFPA 3NJNA 1F90L 2ZKXA 1IM9B 3PQYA 5D6DC 3QIWC 2WLZA 1HE7A 4RVBA 4Q14A 1WZAA 4B9CA 1YMHA 3IMUA 2R2EA 1DJXA 2ROXA 3PHSA 3QHTC 4NZTL 5LG6A 1G1YA 3KVQA 5IW1B 1SVZA 2JKIS 3QT2A 2EACA 3DLQR 5D55A 5IV2B 1TJXA 5GISH 1J1XL 2Q3XA 2CMRH 5I76A 5IJVA 1QD0A 2IAMD 1GY1A 4KBPA 1CG9B 5JOPD 5LVEA 4OQTH 1QSZA 4HWEH 5JLZA 2PUQT 5DJZA 3VXTB 3ZT7A 1A7PL 2P24A 3BESR 5CFAA 2J5WA 5SX4H 4O58H 5A16B 1XV8A 4P5MA 2FECI 2C7UA 4NO3B 2H1LM 3TIDB 5HDWA 5DXWA 2VDNH 4HWNA 1VA9A 2IDCA 4DKDC 2UYLB 1E67A 5T33L 1U3ZA 3PHOA 2R2BA 5IREA 4N2LA 5MEOB 2VLME 5D93B 1F3RB 4IGBB 5K59F 4PJ5D 1HKLL 3LXUX 1AMXA 1KIUA 2YLHA 3LKOB 4JJ5B 3PY9A 4YHPA 2J12B 2NY3C 5TQ2L 5IFJB 2YKKA 4P3DA 5C0JA 4N2OA 1AOHA 3L6FB 3GGWB 3MUHL 4FXKA 4Y4FA 3LN4B 2AANA 2AJYH 3P3UA 1D9KA 1TZOA 5EZPA 3PABA 1UM6H 4JFDE 5TK2A 4FNPA 4L3EB 2YPLD 3K2IA 1GA2A 2E47A 5ESVA 4FZ8H 4GS7C 4ZQKB 3QUYA 1BF2A 3K5SA 2N0MA 3AY4C 3IDYC 3RJQB 1OSYA 1FE8L 1NA8A 1JNNH 4ZSOB 5T3ZH 4N2NA 3O4OB 5D1QC 1ZGLM 2W94A 1NWOA 4EN3B 3DTXA 1XBRA 1BEYH 3FSWA 2IWGA 2XA8L 3V6ZB 4XZUB 4DO6A 2ADIB 1JGVH 2Q2EB 1IZJA 4M29A 3VWKB 2GEQA 5I5IA 4MD0B 2R0ZH 2A74A 3C5ZA 4YO0A 1EH9A 1QRNB 2V5MA 1WT5A 1SYSB 4IRZA 4XC1H 5DJXA 5LBSL 2ORBL 4DW2L 2IC2A 5CNHA 4XPHL 2PWGA 3PHAA 1OTSD 1SY6H 2H47C 3FTXA 4I0PD 4ELDA 3ZT6A 3GZKA 3PDOA 4S10A 1P2CA 1K4DA 1FFRA 1CFVH 1XO8A 3O4LB 1Z5HA 2PYFA 1WK0A 4WUUA 2IDFA 1NANI 1QBAA 5AZEH 2BSED 3HC3L 4FLQA 1KIPA 3BPLB 4DZBA 5G4MA 2F0CA 4DGYL 5GGSB 5DUBB 1OSPH 1NOAA 3QJRB 2C34A 2O5YL 2J6EH 4LQFL 2QPFA 1YEEL 3O8XD 1XAUA 2BNRE 2QQNL 4O2CB 2GW5A 4LLYB 4F3FB 3I6KA 2HLAB 2P5EE 3V52H 4J6RL 2HUEA 1AKJA 4FADA 5C09D 1QFHA 3I84A 3GBDA 4TQIA 2R4RL 3QIUC 4HWUA 4K5NA 2ITCB 2P42B 4BFBD 3MNVB 2NDGA 4J3BA 4YDIH 2D73A 4HG4J 3M88A 4RNRB 1FF5A 3CLEH 1G5AA 3FRPA 1KBGH 5DUPL 4YEFA 3VXUD 2DYPB 3BD3A 4FE9A 4HUVA 4I18B 4K8RD 1EJOL 1NEPA 3RZCB 3WHE1 3MRCA 1WIOA 4I5BA 1HH6A 2FUQA 3KPQA 4HOWA 2G75A 4JRXD 3OJDA 4HS8L 5G2NA 1X9QA 1SLWA 4NI6A 1TTGA 3WXWH 1AOZA 2E5EA 4ZFFB 4RBPH 1D5MA 5HHXH 1JV2A 3ETBJ 4MD5A 3FUNA 3S2AA 1CICC 5KVEE 4HAKA 3LMJL 2OL3B 4AQEA 1HL4A 3ARGC 5D72H 4UNUA 4M43L 1DCLA 8CGTA 3MLVH 5GPRA 1NINA 2A4CA 3ECUA 2PTUA 4X5RA 1G9EA 4P9MH 3KZ8A 1YUHA 4EOWH 3A6OA 1MI5D 1OGPA 5C07B 1BF5A 3M07A 4PJAB 3U36A 1PTZA 3GRWA 1B4JL 1R6VA 5DUMH 1GC1C 3OLGA 2DWDB 2X28A 3GMRB 5C0FB 1MREL 3KH3A 4CC4A 5E6IC 5JNYB 1A6WL 4A63A 4KK9D 3RNQB 2NXZC 5GZOC 4Z7QB 2EE6A 3WFZA 2CKNA 2L7UA 1Q1JH 1YEFH 4YWGH 3UJIL 4IJTA 1CXFA 3EJYC 4WCYH 4OQTA 3KPRB 5ISZA 5DRZA 9PCYA 4CJ1A 1ZIBA 3GXUB 3ZSSA 5EU5A 1G1OA 4Z0XA 5E08H 4KI5C 4KUCF 3KVDD 2UZIH 3JWNG 3BKCL 5D5MB 2VDMB 1UKQA 2XIBA 2WQVA 3E3QC 5C0BD 1A7OL 3AQXA 5GS0C 1N0XL 3Q2NA 1UFGA 4FTVB 2QEJA 4C83A 3DECA 1FSKC 5ABZA 4LCYB 1T3FB 2V7NB 1DBKH 2OM5A 4GKSB 2Y2WA 4ETYA 3VI4E 2WXFA 1AFVH 1T20B 1RSFA 3MRMA 5F7BA 3D39E 2RCSH 5TFSL 2WQRA 3SKJH 1P4LB 3KYKL 3Q5TA 4B3EA 1MFDH 3QXAA 3VU1A 2X41A 4NC0B 4X80H 3DHPA 1FAIH 1F2XK 3LH9A 4KOBA 4ETQB 2PN5A 3PGFH 1KJ2B 1RUQL 5CLYA 5DJ2B 5INCA 4ZOEA 3MAWA 1Y1DA 3U4EB 3PAZA 2R9HC 1FL6A 1N64H 3ROOB 5FF6A 1IFHL 4A2HA 4LCWA 3RGVC 4EO5A 5IQLA 2ZD0A 3RWHA 2Z3FA 2PF6A 3NZSA 2DL2A 1HINH 1P7KB 5EC1B 3WTSA 5DMYA 4OLYL 1TEFA 2OCFD 4XPGL 5E6YA 1HE8A 3EOYG 1NPJA 3T8MA 5E8PB 1UH4A 3LIZL 2X9ZA 4TRPL 1YPZA 3DO3A 5DK2B 4J3OD 4EAEA 3DO7B 5LAXB 3EGDB 2CUAA 2F7RA 3IETA 4JZNB 4UB0L 4BFIA 2ZOOA 4OZIB 4ZD3H 1SY6A 3MRBA 2HB0A 1U8QB 1I9IH 3H6AA 3SDDA 4JQIL 2NR6A 4WF7A 3WLWD 5HYFA 3N42F 4OM0H 4B9PA 3NIGE 4JG9A 3BGFB 3BWAB 3OAUH 1RSYA 3SDAB 3JV5A 3VXRB 5CEXA 1ZHKB 3EYQC 4PRPB 2OMNA 1HHJB 2C3WA 4XXDA 2C3VB 3ISRA 1P84J 4QOKE 3WBDA 2B20A 1Z3GL 1IC7H 2R29H 1K8IB 2D7TL 3HG1A 3KEDA 5FFGA 4B5ZA 1IAIM 3HE6D 1OQOA 4WK4B 4ESKA 1N2RB 3FQYA 4JRYE 1NAML 4Y4HC 2J6EA 2W81C 4U1IB 1CFSA 4DCQA 1AS8A 3CZEA 3AABA 1I3GL 2YN5A 3MRJB 3L5XH 3PHQA 1L6ZA 1TQCC 3D69B 1WHPA 3QDME 5BMFL 1SUJA 3BDXA 1DL7L 4Y4KC 4AZ8A 3BAXA 3WTVA 4LCUA 5F21B 1ZS2A 4Y19E 1RZJH 1SYVA 3ILEA 4D0DB 4DGVH 2VSKB 3GD1C 2PTVA 2FT6A 3MRLA 2YSTA 3FMGL 3RBSA 1ZRUA 3ZJAA 5D2NB 5IWLA 4X98B 4U2YA 4Q8BA 1SLUA 4P2OA 3ZTCC 3NUKA 2DD8H 5LAPA 1TJIL 2GABA 1MPAH 2DMBA 1AHWA 4TQEL 3I50L 1OTTD 5LHDA 4M7ZC 1TYRA 1UQSB 5CCJA 4KVCH 4GBXA 3EGXB 3UAEA 4RGOH 1FV1B 2H26A 2VDLB 5AOLA 3O6FA 1T7VA 2R0LL 5J1AA 2OCCB 3HOGA 4JY4A 3NEEA 5SWZD 1HDMA 2HFEA 5ENWB 3UJTL 1F3DH 5KUMA 1FVCA 3B9EA 5DEFA 2BNQB 3H2QA 1LWJA 1L9MA 4NJAL 2OTUB 3KHOA 3W0WE 1ODAA 2VDOH 4GKZA 3RB7A 5KBKA 2DQCL 3KMDA 1XR8A 1DEEA 1H5BA 2ZUXA 3K8KA 3CZJA 3DX8A 3SDCB 1F1GA 5FUZH 3U2SA 1ORSB 1YEHL 5IUSA 2PKDA 2X4RA 1SQ2N 2DTSA 4YXLH 5IFHL 1K6QH 1GAFH 1P7QD 5DQJA 5I16B 5CM1A 5D4HA 4D8PB 5KSUB 3AGVA 3VRJB 2JXMB 1YEJH 3BH8A 4ZS7H 4LSVL 2ZF8A 3L7FA 4PTUA 2PW1B 4UTCA 2DQMA 3SPJA 2OA9A 3D4YA 4PRHE 1NC4A 3S35L 5IVXA 3MLZL 4X6CB 4PRAB 5AG8A 1XZ0B 4PJHB 4ELMB 3K71A 4KMTH 4MBOA 1CLOL 5I17B 3EOAA 1TFHA 1EV2E 1FN4B 4H2AA 5E1AB 2YUZA 3F6JA 5J12B 1Z6JT 2XZZA 2WUBH 2APWA 1CN4A 2UZXB 4YHIB 4C58B 4PJBA 5CSGA 3GXNA 3OLIA 4DUWA 2XKNB 3FOLA 3IJ7A 3GO1H 4FQIH 4K8RH 3BUQA 4P2RD 5DT1L 3TBSA 1VIWA 3HZYB 4FFYH 5E1HB 3BSZA 4CVUA 1IE5A 5GGRB 1S9VB 4DH2A 5BRQA 4RWHA 5LDSA 4POZC 1T1XA 4TPRL 4F33B 4WKZB 4B41A 1G7HB 1KCVL 2XX0A 2CAKA 3FU8A 3HAEB 2N0KA 2YQGA 5DQDH 3ARFC 3V9EA 4JKLA 3SJVD 1RL1A 3ARBA 2VLJA 4J7RA 3WKQA 2KHAA 2B5IB 2ICEB 4PJ7A 3M1BB 3QQNA 4NZUL 2ITFA 3PWNB 5T1MA 3MXWL 5KANG 2A9CA 1KJVB 1BFSA 1XMWA 2FBJH 5DJDB 4XNYL 4JFPA 1P5UA 4UTBA 3SDXE 3BIAX 1E40A 3HNSL 1G7QB 3H54A 4XNXH 3TBVA 1E65A 3GDBA 4EZLA 1X5XA 1LL1A 1XGQB 3IGAA 4HIEB 2XN9B 5LGHH 3N40F 2PPFA 1I53A 4MA7L 3T1FB 4YHLL 1F0LA 1T2XA 3LXAA 5DJ6B 1UASA 4H40A 3VXPA 1SJHB 4OV5B 5C9JA 3QFJE 1IKNA 3PNWB 3WAJA 4W4OC 4YL4A 1SEBA 1I1AD 1KF9B 5B38A 2IPTH 1RZKH 2V33A 3KXFD 2IAMA 5J13B 1XDTT 2CHXA 2EC9T 3LNEA 3RU8H 2IGLA 4L5FE 4BA0A 1AO7D 2JK5A 4PBDA 4TOYH 5E7FA 4LEXH 2VL5B 2QHRH 1R4XA 4UQIM 3VO0A 1IFGA 1RHHB 1XGRB 3MLXL 4H0HB 3WMQA 4R9HA 4KK5D 2K6ZA 2NDFA 1XGUB 2BSSA 3HRZB 4HA1A 4NQEB 4AQ8A 2WZPD 4G8IB 1G87A 3LRLA 3FZUD 4M5YH 4APQA 3T6QC 1OIOA 2AJ3A 3LZFH 1B4TA 1NANH 1HU8A 4M1DL 1XHHA 3HEIB 1XB6A 2XV6B 3QRFM 2E7LA 1MVUB 3L2MA 4HEME 3WNKA 4YZWA 4DPBX 4NOBA 1JOIA 1CJYA 5D70H 4OD2B 4PJXF 2H41A 4TM9A 4ODWA 2UWEB 5LGYA 4I13B 5TQ0H 4OJEH 1S9XA 4KV5E 3BP5A 3FO1B 4E9YA 4AIZA 4AE0A 3MV8B 3K2KA 4KNSA 4L8BA 5I1JH 2DWSA 1SFHA 3ATAA 4NQTA 1OB1A 2YPLA 2Z8VC 3IU3B 3F6LA 4U6YA 2OFQA 1KPUA 2R2HA 4QXVA 5I18L 4OQ1A 4ELKB 3EF7A 3UTTB 4U1MA 4GRWB 3QH3A 4XBPA 4X7FC 5ESQA 1SJEA 1B88A 4LSUL 1TF4A 1SRDA 3MMEB 4BFNA 1RQ5A 4NZTH 5BW7A 1LO2L 3F12A 3NIFB 1HT6A 5CGYC 4YN3A 2V3FA 2WIIB 5F89A 4ADGA 2FX8L 3D07A 1GR7A 2BY0A 4BXSV 5KYXA 2ZZUT 5L9DL 3CSGA 2I9TA 3KBPA 2UY7A 3D6GA 3K2UH 1T21A 4RSVA 5C7XL 2BIHA 1A7PH 4J3OH 2F2HA 4MASA 1C08B 3OKMA 1A65A 1U8JA 2DICA 4H25B 1FGVL 4W4NA 4M6MH 1BJ1H 1FNEB 4I0PA 2WANA 2RA1A 3QEQB 1H15B 2YD1A 4JVPA 1N3NB 4HK3N 1UA6H 2OP4L 3FO9B 3Q05A 4EVNB 3VD2A 3A22A 1TZGL 2F6AA 3H2WA 1L6XA 3TYFA 1G7JA 5IROC 1RU9H 2PCFA 1U8NA 2BSEA 1Z5YD 5TQ2H 5DJ0B 5CLXA 3PWLA 3BAIA 3CMGA 3FONA 4NQXB 4UMGA 1BWMA 1LD9A 3LKSA 2ATPB 1KGUA 1QSFD 1SHXA 2GUOA 3OXSB 2EIMB 3TPUB 3O8XA 1TMCB 5IMKA 2WLMA 1NEZA 2RBLA 3ZHDA 3VJ6B 5C09A 2X87A 5IVZA 1MFVA 2J8HA 4A2LA 3FFOA 1H19A 4JHWH 3T4AC 2P48B 1NIAA 2XFGB 4NENB 3NFPA 4IBVA 1LGVA 4Y5VA 3GDCA 3EYOB 3RGBA 4K5LA 3Q3GA 4G80B 1LO3H 5DD1H 1PD1A 3FT9A 3VXUA 1M71B 3HI6H 2CBTA 3KLAB 2CA3A 2F53B 4MCZB 3DPBA 1WGOA 4JREC 5L88L 4FFYA 1IC0A 4O2FA 2I5YL 3GRBA 3K6OA 4RFNB 2NQ3A 4S1DC 3TFBA 1GOHA 4MD4B 4JRXA 3P0VH 2FWOA 5E2UL 2BP3A 2ORBH 4DW2H 4XPHH 1X4ZA 2OR9H 2QVKA 4W9DC 2DQUL 2VRAA 4BFFA 4JDTL 2K9FB 4ATTA 3GSRA 2WTRA 4KTEH 3NBNA 5EFIA 2A6KA 4OCRL 3D33A 1DZ0A 4UNVA 1AH1A 2DRUA 1PY9A 1KXQE 3MUZ1 2A5UA 1J9CT 5DJ8B 3HC3H 5L8LB 2ESVD 1QUPA 4MZ3A 1BP3B 4DGYH 5KVGH 4RGNC 1MI5A 3A6CL 2ZUVA 2IQAA 2Z31D 4EJ1C 2WO2B 1RZIB 3QORB 3IAGC 4IIQB 3U6XA 5ITFA 5D1ZC 1YEEH 2A9AA 3T0XA 4LHUG 4UQ9A 2DIBA 3U2IA 4B9JA 1M2VA 3P77B 1T2JA 3FCSB 1Q0XL 3FKUS 3FXIC 2OJZH 1TITA 3ZE0B 4PJDE 3T0ED 5C0EA 5CLTA 5IVOA 1R1CA 4U7SA 3QZWB 5I75C 2X0WA 1J8SA 2XXCB 1H6TA 5DA4A 1B4LA 1RUPH 1JS4A 2Y7OA 4PJ5E 3U0TB 4NO0D 1H3GA 4WFED 2EUVA 4O51B 5C08D 1I8AA 5CHNA 4PV8B 3V0VB 3VA2C 3C9NA 4HLJA 3VMNA 4GQZA 4X8CA 3ZKMC 3O3AB 2ZG2A 1ZK5A 4XO4A 3WNPA 5KTEH 4OKVA 4A68A 3U7YL 3PAUA 1EJOH 4F8QA 4PS4L 1TVBA 2C9RA 4JY6A 1AACA 5HBBA 5C0BA 1YEDA 4JRFA 3IDIA 4HS8H 2X70B 1WFJA 3KPSE 2Q76B 5ID1B 2CU9A 5AW4B 1CVSC 3A24A 3BD4A 3IE9A 1EZVY 3JTTB 2EIDA 1TCRB 1L9RA 3P4NA 2EINB 2JCCA 2VABA 1E5CA 1FGNL 1ZHLA 4U1SA 3E2HB 3HS0C 1XF2A 4M43H 1ORQA 4QT5A 25C8L 3TURA 3WIHA 3KL0A 2B16A 4XNQB 3EG9A 1W72L 1J8HE 1KN2H 1E9QA 3CVIL 1U93B 4OVUA 4W9FC 4DUVA 2EDHA 2B1AH 3GRGA 5AZ2H 3QJHA 5C0RH 4JY5L 4BCZA 1DVYA 2ZP8A 4LB8A 4ZW3A 1MREH 4OJYA 1E7UA 5EBLA 1QFOA 1PZAA 3TNMB 2C9AA 1WCQA 2H32H 2NNRA 1DQKA 4LIQE 5ID0A 3EOBB 4KTDL 1M42A 2Z0BA 5F70A 1MFBL 5IHLB 3JYCA 1BQUA 1GC1L 1KY6A 2DQDL 4U0RC 1I4FB 3I74A 2OYLA 2AMUA 4M48L 4NUJB 2B1OA 4X42A 4WEEA 3TASA 3HE7C 4R7NB 1F58L 4L1BA 3MKGA 3Q7JA 6PCYA 3I75A 4MYWB 1LO5A 3BKCH 3NABL 4DPCX 1I3RB 1A7OH 1JPTL 1LNUB 3N91A 4QO1B 5JPMA 2NYKA 2BX5A 3IFPB 1S3KH 3M45A 5MENB 5DDHA 3PPEA 4FMFA 4UNIA 1MUJA 1Q9OA 3UP6A 4RA0C 4BH8B 1ZK9A 3K4ZA 3VW3H 3QG6B 5DHXB 3AJ7A 4I48A 4NO5B 4U1KB 3ZYIA 2VE6A 4L4TB 5I1CL 2P5WD 5CZVL 3HE6A 3WEXB 1T83A 5GS0L 4UT6L 1PKOA 2FHBA 2K6WA 2HAZA 3PFQA 4KNTA 4PMEA 5HJGA 4PI0A 2Y06H 1AQKH 5JORA 3RVVD 4XH2A 4P59L 4G7VL 5J3HC 4YDKH 5KJ7E 1UOKA 2ZXWB 3I6LE 1RUQH 1T5WA 3IPFA 3MSPA 4NP4L 4K3HA 5FA3B 1R3LA 4Y1AB 5L8JB 2ADJA 3GINA 4GRMA 2QR0B 4BSWA 4YHML 3LEYL 2YRPA 4FDWA 4HIHB 4ODTH 2JELL 2YRBA 4ZUSB 3BUIA 4LBEA 3EADA 3VFPA 4TVPL 4RAVB 1SHSA 2X1WL 2IG2L 2GQHA 3FHQA 4XP5L 2VN7A 2WLLB 1H6EA 2BSRA 3ARDB 3PV7A 3QIWD 3VU2A 1D3CA 3M7FB 3VTAA 4PH8A 2DN7A 3MRRA 5DVMA 1SXAA 4O5LH 3LIZH 4ZXBB 5CIPH 5LBSA 4YGVA 1JZIA 1A14L 1CL7L 2QQQA 4QRSB 4LLVB 2VDKB 4G43A 2OJEA 3CZUB 3W9EA 5SWZA 4CMHC 2QV4A 4JQIH 5IB3B 2HRLA 1N0LB 3V7MA 3K72A 1XIWA 2F5BH 3LPOA 2IIJA 4JUSA 3U4AA 3I9PA 5KUKA 1ZV5A 4QXTB 3AAZA 4YK4C 3CSPA 4G7YL 2B9BA 2DJSA 2FJFB 1Q0YL 3N41B 5IT2L 3FN3A 3QJVB 1Z3GH 4WW2B 3HPJA 5AOZA 4ZFZA 1FL5B 5JW5A 1IAKB 1FC2D 1NC2D 2XG5B 1LXMA 3S6CA 2C9UA 3SBQA 4O2EB 1RFDL 2HJFA 3HBQA 4F9LC 3EJRA 2KDGA 4XNDA 1I3GH 3QNFA 1P7QA 3ROLB 2NY3D 4G8FA 5BMFH 2P49B 5ICXA 1L9QA 5AB1A 2ZG1A 2XG4B 3MX0A 5K5YA 3COOA 5D8JH 5HI5C 3B5HA 1K8DB 5CJ5A 2WHVA 3RL1A 2XV3A 4WO0A 1W9XA 1WFOA 2AEPL 2FIKB 5K9JH 4NQSB 2D03H 4HPHA 5F6HJ 3QGVA 4JL1A 1TJIH 5EIIB 3F3HA 2SODB 5AOJA 3SE8L 3U48A 5J11C 3QO1B 4IMKA 3I50H 4TQEH 3T65A 1T0MB 3DA0A 1QR4A 2A0LC 1HHIA 1QNZL 1AR1C 3FUEA 4ONHB 5D1QD 5KVDL 1A1NA 3NPZB 3OXRA 5EU4B 2AAVA 4AVJA 4MJ6B 1XD1A 4OLZL 3DVIA 4P2RA 2X38A 1MAMH 1TVHA 2WXMA 3DXAE 4P4KC 4BRJA 1RP9A 3L3GA 3X3FH 3IFNH 4NJAH 3AG4B 3H9SB 3KNBB 3O2VL 2F7OA 4OLWL 4XB8A 4BZ1H 4WI6A 2ALWA 4X4XA 1DJYA 1NM9A 1ZLUK 3SJVA 1QI4A 3OBAA 4X6DB 1D2OA 1I7RB 4PGCB 4CVZA 2QVFB 3WEOA 4NQCE 1YEHH 4DN3L 1JRHL 2B3RA 2ZOKA 3K3QA 2ITDB 3CFMA 3KLDA 3OR7A 3HR6A 1L0QA 4X7EC 4KPHH 5IFHH 3TTYA 3L1EA 2H32A 3KJ6L 3UBXA 5B39B 2YPVL 2OX5B 5JXEC 3D4GA 4DP9X 2J5LC 3B9VA 3RAJH 4LSVH 4P8QA 3OR6B 3E8VA 3OX8A 1GYUA 1VESA 3EDKA 3S35H 2R39A 5HGHA 1XSJA 2XRAL 2ZXDA 4ZMWA 3MCLL 2YFNA 3FPYA 3L16A 4NQDA 4K73A 1IGYA 3JWOC 4NUPA 1I1AA 5GS3A 3RWFA 3Q8FA 4R4FL 3KXFA 3QIUD 4Z7VA 3VFOB 1DQDH 5JIMA 3B1UA 4H26A 4FXTA 1DP0A 4XO3A 5DYOB 4EXPX 1MCEA 5I0WA 1ZHBA 3W9DB 5IKCB 4RQQB 1FZJA 2YD7A 3P4LA 4HUUB 3FQ4A 5J6GB 1T7WA 1CL7I 5DT1H 3RGHA 2WCGA 2WZPA 3CSBA 2C8NA 4K9JA 3AU1B 2G60L 1QVOB 3IDJB 5IJDC 1J5OL 5G5DA 4TPRH 4N25A 5JOEA 4C59B 15C8H 3EH4B 3U7AA 2X6AA 1NIFA 5A2KH 5GGQL 1CICD 3EJUA 4I77H 4RZCA 3FH8A 4NZUH 1U92B 3ARGD 1HH9B 5FDWA 5MP6L 2IWFA 3MXWH 2EYTA 3VM7A 4ZUUA 4DO5A 3LN5A 3I02B 1A6VL 2IPUK 3HNSH 3DKHA 1MCOH 4U6VH 3GLDA 2LE9A 3EXJA 2F5AH 4FRWA 2V3DA 3O81A 4JO2H 4KH9A 3ARTA 4JFHD 1A7BA 1WFIA 1XCQB 3BWZA 1JPFB 5FWQA 2PYEB 3LIZA 2G2RB 2X4UA 3LNFA 4NNPL 1G9HA 4NO2B 5E6ID 4JZJB 2NXZD 4YDLC 1FO0L 4A6YL 5GZOD 1OM9A 4LSRL 1XF1A 1KIQA 2B8OT 4K7FB 4OZGA 4XVTL 5FGCB 3TS8A 3B3BA 2OXGB 3BPCB 5JIDA 4Y2DB 2B77A 4JQIA 3VWJB 1T1YA 3EJYD 1R5VA 2LR4A 4HD5A 4ZPTB 2OSWA 3MLXH 4WU5A 4NCC2 1T22A 4XHQA 1L0PA 1E8ZA 1RMFH 3U1QA 1AQHA 3TBTB 1OV8A 1TQTA 2VGLM 2XWCA 3PE9A 4WY7L 4KI5D 3KM1A 5I6LA 5IM7A 1S46A 4LMQI 5ES4B 1AXTH 4YE4L 1Z1WA 5GS0D 1FORH 3IBOA 2HA1A 1NAMA 2FEDC 3FULA 3HNVL 4M1DH 1I7ZA 3HLKA 4Q97A 2O72A 5FYJE 4MMYA 5IOPA 4HOZA 4JMXA 2YPKA 4P5TB 4YL9A 1BMZA 3K0YA 5E2TH 4BJLA 2AHIA 3TNNB 4IHBA 2AEIT 3UBHA 1JRHI 1QSFA 3WYRA 1DVQA 4P2QE 2VXTL 4TVPD 2APTA 5B3JE 3FTYA 2MQ3A 4P4KB 1HJBC 4XGZB 5I18H 4TLUA 2K3TA 1BBJB 4Y5XA 1UVQB 2R4SL 3SO3B 4L1DA 4G1MB 2R9HD 4HKBA 1EHKB 5DVNA 1U9KA 3GJEB 1U8CA 1BM3L 3HBZA 4FTDA 4X6CF 3RGVD 4FFVC 3NG5A 2PCPB 4XPAL 3O2DH 3VXME 1CIDA 5C0IB 3OGCA 4ELMF 2I07A 3FT3B 4L1HA 2H6PB 4JB9L 5E94A 5L9DH 3OZKA 4UI2A 5J56B 2LOEA 2AZAA 1H3TA 3KCPB 2Z7ZA 4HU8A 4HMDA 5FYLL 4HS6B 3NFNA 4QJ3B 4F15C 3VVWA 5D71L 1ZT4A 3OHXC 3JWNC 1XF3B 4G5ZH 1ZPUA 2N7AA 1Y1UA 2C9PA 1OK0A 3ULUC 5I1IH 2QVTA 3ZMNA 2GI7A 2OP4H 1CS6A 1QMUA 2Y7QB 5DGQA 4KO7A 1AP2A 2GPZA 3RRQA 1RUMH 1T4KA 1OF2B 3L1GA 4X0KB 3ZUNC 4ZX6A 5BJTA 5SWQA 3U25A 4ZMAT 2IJ0C 2YUVA 5GQBA 3S4SB 3EYQD 4LP4A 2ESVA 3WFBL 4CU8A 2FSEB 4HFWB 1W15A 3WFHB 4M5ZL 4DQOL 2CDFB 1AO7E 2CBOA 2FH8A 3FU5A 2Z31A 3ULAB 1T0OA 4L48A 2QSCL 2HT3C 2YZ8A 4H1LH 4KX9A 5E9DD 4RFEB 4Y4HD 4GO9A 4DVBA 1I8IB 3PXJA 4HWBH 1DQJB 1WAAF 3BEVB 4HV8A 2ADFH 3T0EA 1JERA 3SD5A 1RZ7L 3CBRA 4JO1L 3WUWG 4AI7A 2B0SL 3AREB 4TQPA 4N2BA 5I8CA 4Y4KD 5CLZA 3CFCL 4BGLA 5CEZH 5FECB 1E9OB 2VLKE 5BVJB 3NIDB 3QPQC 4NO0A 2Q0ZX 2VDMH 4N0YL 4OY9A 1HYSC 7PCYA 3DRTB 1WBZB 5C08A 3Q48A 5BVPL 4PJEA 2QKSA 3O6LL 3T3PB 3U1PA 3GJFK 2V2XA 2VIRB 1XGPA 3TA3C 3TWYA 5FCUL 2Y36L 4ABVA 4GYBA 5HD8C 4N8VA 5CU5A 3ISWA 4B60A 2O26U 5E2UH 2VRKA 1QSVA 3D8MA 3OZ9L 1U3HC 1JV5A 4XXCA 4G6ML 4M00A 5DD6B 3WS6C 4AMKH 3BH4A 4E5XA 3BFWA 2GITA 2EP6A 3LS4H 5C0CD 1HHGB 3ARXA 4AM0Q 5I8OH 1U4EA 1KJ2H 5IIEB 4N0UA 3IMWA 1ZS8A 1EERB 3LN9A 1XF4A 2PTTA 4U2ZA 3HHSB 5JA8B 3CSYA 3A6CH 1O9WA 3EYFA 2XTSA 3FT2A 2R1XA 1UXLA 3SQRA 4DVRL 3DMMB 1OGTA 2L7EA 4LGPB 5F93C 2YQ2A 1EUUA 3LZRA 5KSBF 3QC6X 4N87A 1X7SA 1N19A 1Q0XH 3L81A 2BP0B 4F58L 1A3LH 4JN2A 4X9BA 4HJSA 3UJJL 3B6SA 3C6LC 4V2CB 5C70A 3PWPD 2QBWA 4O02L 3S37L 5JOFB 2W07B 3DJSA 3KYNA 3DX4A 5TDOB 4JO4L 3AXLA 5GRUH 4L8SC 1NDGB 2XN1A 4WO4C 2EH7H 3F7LA 3NVQA 5CBAB 3L13A 1BD2D 4JFEE 5AYQA 4L8CB 4AL8H 3NIFF 2YSSA 1I1CA 4S1QL 1MFEL 4PJIA 4NNYB 4CMMA 3GBLA 4LLDA 2MHAA 3OKEB 3RUGF 4L8DB 4N0FA 4OLXH 3QZBA 3VG0H 5FEBA 3MLWL 1TVDA 2FYVA 2AJVL 4ES9A 5K33A 4CBPA 2DJUA 5DLMH 2UVEA 4TNFA 3IMBA 5A6IA 1T2QH 3RWDA 5LCVL 4XN2A 1N4XH 4Z3JA 2JJTC 1B0GB 2YAFA 1FGNH 5CMAA 4R2GC 4O2CA 4LPXA 4HS3A 3RDTB 3BAKA 2CNZA 2HLAA 4PRDB 3PIQB 2FBOJ 5KBMA 2P5WA 1W8EA 4L1LA 2FWUA 25C8H 4POZD 4LCIH 2B2XL 1NOFA 1J1PL 4V1DD 4F24A 2C1PB 4NXKA 2VR9A 4X6FB 1W72H 3ARFD 2E9WA 4K3JL 3CVIH 4F5CA 2Y6SC 2QQKL 3CK0L 4M4RB 4EBQH 4HSAC 3SYOA 5IHBA 3NCWA 4JY5H 2R69L 2BMKB 4Y5YB 3H4HA 4E36A 4JG0L 1CDHA 4QJ5B 2GHZA 4ZFQA 2VR5A 3RFZC 2YAMA 3GNMH 4NRXB 4PSPA 1J0HA 3TC9A 4FQXC 1F4XH 4OZFH 3LD8B 5LGKA 3US0A 5KYYA 5D6DA 3QIWA 2M1KA 1MFBH 2VDLH 4MB3A 2WOYA 3HZVB 1C7TA 3CFNA 2IGTA 3S5LA 3K6SB 4M48H 5KVFH 4S1SL 1AY1H 4FG0A 3X13B 1QSEE 1BJ8A 4NBZB 1F58H 4NC1E 3N44B 2AKRB 1T5XB 1KCKA 4B3VA 3DVGB 3NABH 4MXWL 1JPTH 4ONFL 4X9GA 5D7LB 5IW3A 1TMQA 5B21A 5SV4A 4Z3GA 4F2MB 4AYDC 3MBEB 1HEHC 3LKQB 4JCWA 4YDVA 4XVJH 2W8CA 2BNUA 3WOVA 4OCYL 4XOAA 3DOSA 4IIZA 4AM0B 3QNYB 4AK2A 5BZWA 3V0FA 3VH8G 3GXDA 3HMWL 4JPIA 3WIFB 3DYMA 3X17A 5JNYA 5CZVH 2WUCH 5HHOB 3LKRB 1CLYL 2EEBA 3QNXB 4UT6H 5GS2H 5GS0H 4H1LA 3X14B 1PX4A 3L3DB 5FA4B 4PJCE 2Q6WA 4AG4L 1HHKB 3X1GA 4F7CB 2KH2B 1CF8L 4P59H 1J1OL 3UOAB 5FLVA 1T6VN 1SGKA 1B3JA 2F68X 1C5CL 1SZNA 3U1SL 4KMLB 2YMTA 2EQDA 4YHMH 2PR4L 4U49A 1TO4A 1C9SA 3ABGA 4NT6B 4QD2E 4U3SA 1RUAL 2Y22A 4HF5L 4TSCL 4WEMB 4BSJA 3S9DB 1ZPLA 4P49A 4KFMA 4XP5H 2IXQB 3ZE0F 4YSAA 1RZQA 4ZTPL 1A6TB 2Y5TB 1D6EB 1UKTA 1AIFB 4WZ9A 3AY4A 3VGBA 5KYNA 5FYLD 5D1ZI 3WY1A 2WPGA 4PJ8C 1D6VH 5D1QA 5EA0L 3SN6N 4PGEA 5I6KA 5KSAC 3R06A 3NCJL 4KO9A 1U8IB 3BH9A 4YR6B 5CGYD 5B8CB 2R1YB 3G6JB 4H8PA 2PWHA 1G9NH 4ZMPA 1L5GA 3HAEH 3DETC 5FB8B 4M7KH 2IBGA 2H4EA 5E2WH 3A0OA 4A7SA 4J5VA 1JZ5A 3CE1A 3G6AA 4AJWA 4G7YH 4IS6A 3RL2B 1D5IL 2JF1A 4GAGH 3SO5A 3DK2A 2MWCA 1Q0YH 2WYIA 3US9A 5IT2H 2VM9A 4P4RA 3UZQA 1OAUL 3AS1A 4NQQA 3BZFB 3SKOA 3WNLA 4Q9BA 2F1BA 3P54A 5FYKU 1HOCA 3T0WA 1NJ9A 2VUKA 1KCRL 3H3PH 2QMKA 4FJZA 2XTJE 4QLRA 1PPIA 1ILUA 5EC1A 1Z5LB 5I5MA 2BDNH 5IROD 1JF6A 4DP6X 1XZWA 1X5ZA 3QIBB 1UJ3B 5K1NA 3BAWA 3NPSB 3B7UX 2CUIA 3O6KL 4NZJA 5HGDA 1T66C 1X5KA 1UA7A 3UYRL 4TYUA 4CRPA 2OTWA 1URIA 4PWGA 1KOAA 4G1EB 2NYZA 3EH5B 1VGEH 1SMDA 2AEPH 1DUZB 5A40E 4U1HB 1DDHA 1S9YB 2YD8A 3QARA 5DVOA 1PZ2A 5EUOB 3RE0A 2AFNA 3WO4B 1HHHA 4UT7L 4QHUA 3VYPA 3JZ7A 3QIUA 5SX5K 1LEIA 3O3DA 4WDIA 1JYVA 3EH2A 5KVDH 1W0VA 4BQCA 3KWXA 3JV6A 3MJ7B 2ZWSA 4JFFD 1HKFA 4EI6B 4MAYC 4WUKL 4Y1TA 4HIIA 5MHSE 3H55A 4OLZH 3CTTA 3I9GL 1XCXA 4TUJA 3VGDA 3FQRA 4Z3EA 3CC5A 1QLRB 5FFLA 1AGDA 4FFWC 4X6EB 3NCCB 5E8NB 4S1DD 3TO4B 4POUB 2QPSA 4RDBA 3K74B 4UIKL 2FJGB 3RLSA 2MPVA 2CLZB 2QFPA 5IESL 4N68A 1RZPA 4PJFA 1W72A 5GRZA 3GEFA 3LVTA 1CD1A 1CICA 5LNGA 2VJ8A 3TEZA 4E9TA 2VKWA 1OT2A 1WEJL 3ARGA 3NOIA 3T4YB 1IBGL 4QRRD 6FABL 4N2HA 5D9SA 4B97A 4GRWH 1G9ML 3RWEA 5DD5H 4OV6F 2CGZA 2NCEA 4GMTH 1RURH 1NFDA 3DIVA 4A7UA 1MWAL 5HYJA 3NRPA 3DSFH 2YPVH 4PLNC 3MV9D 4OZFA 4RGND 2JKXA 4FYSA 4HP5A 4BCXA 2WVVA 3QJFA 3GIVA 3WO3B 2H3NB 3QZMA 4HIJB 2PXYC 1EJ6A 3QEGL 2D0HA 4NDMA 4HK0B 5DJYA 5D1ZD 5BUAA 4PGDB 3GSNB 5DHYA 4CSSA 4HUNB 1A7RL 3QZOA 3EJZC 1U58A 5E6IA 4OB5L 3VXSD 1A5FH 1GGIL 1G7LA 5GZOA 1P5VA 1UZ6E 4NPKA 2EYRA 1PNCA 1QATA 3GMMB 2BSTB 2GJZB 3QO0B 4JPQA 3IK2A 1EFXB 2AQNA 4Z7UB 2D3VA 1RIVL 1A22B 3QR2A 1TPXB 3Q2CA 2CM6A 3ZKMD 2I7OA 5LJYH 3JWOL 4I3SH 4WFFE 3ZX1A 1JZ4A 3GLAA 3A5VA 2G60H 4LL4A 4ZTOL 3IFOA 4K71C 4UT6A 4X50A 2FX9L 3CFDA 3ARQA 5D1XC 1JMXA 5D7IE 2W0FB 1MZYA 2P7TB 2A6JA 2CUMA 5GGQH 3KBHE 2Q8AL 3N41F 5AG9A 4PRAA 1DR9A 5IB5B 4YC2B 3B34A 4WW2F 3ZDYE 3ZKNC 1YY8B 4GO8A 4QWWC 5I8EA 2RFXA 3VFTB 2EC8A 2A6IA 3HC0A 2RQEA 2O5XH 2WXNA 3WFCH 1URZA 5L2KB 2O30A 2YBGA 3ETBF 5FO8A 5DRNA 4YUEL 2HVJA 3BVDB 2XSKA 4MXQC 5IMLB 1QLEL 2N4IA 4R7LA 1FFQA 3U46A 1AD9A 2NY1C 4E41E 3GMNB 3QJQB 1KELL 1OO2A 3L3OC 2AEOA 4NNPH 5IB4A 3DRQA 4H8UA 3GYRA 1A2YA 2CIIA 3BIBX 2HX8A 3RGVA 3VG9C 1FO0H 4A6YH 4DP8X 5CZXC 2HXAA 3SGEI 4TQ8A 3UAAA 3APFA 3FU7B 2APFA 2OSXA 2VLRD 3CH8A 4NNXA 4OIBA 4J2QA 4D9LL 4E9WA 2D7MA 3FB8B 3OAZK 5FWRA 3V6OE 2QSQA 4KXAA 5F9AC 3CFBB 5HGBA 2ICEA 1DVFC 2BVPA 3M1BA 1SDDB 3OJMB 4LCCB 4HZLB 1OCCB 2GJRA 1MJUL 3HE7D 4WY7H 4MSWB 1R5WA 3VXNA 2JI3A 5DJDA 1QBML 3P40A 1RJYB 4YE4H 1TU2B 3AGWA 3QXDA 4L4VB 3HNVH 3V0EA 4JNXA 2JI2A 3OWEA 1KYDA 5BZZA 4I89A 4X5QA 1T7XA 1X5GA 1JN6B 3APNA 2YGVA 4QR7A 5JIPA 4KZCA 3D3VE 4GAJH 5EOQH 4FC3E 1JUFA 2W1NA 4X6DF 2J4WL 2VM3A 5E9DA 3DV6A 4EZJA 5CD3B 3IDMA 3DX7B 3IPBA 1BQLH 3IJEA 4Y4HA 1KGIA 2VXSL 2DJMA 4P9HH 2Z65C 5JHMA 1F4WH 5EO1B 3ETTA 3BVUA 2AK1H 3P0YL 5J3HD 4WHDA 4DFHA 4LPCA 1B4RA 5GHWL 4GRLC 1S7XB 1XGUA 4K9EC 4Y4KA 1KTLB 3AB0B 1A9BA 1SBSH 3U9PL 4O9HL 4QDGA 2WWNA 4MDIA 4TSBL 3C08L 1AANA 1G6RB 1P4UA 1BQHG 4MNQE 4XOBA 4ODUA 2J88H 4JVWA 3WJMA 4MJ2A 3V4PB 2F8XC 3MROB 3U0PA 3W57A 1KV3A 2OV0A 4M7JL 4V33A 3STLB 4DKFH 5I6XC 4N6RB 1M7IB 5DSCA 3RDJA 5F3HB 2XYBA 5FYLH 1TTRA 3MA7B 5F7DA 3BDYL 5JHDE 2ZUQB 4Z7WA 5D71H 1AZRA 3FQXB 1SMAA 4OD2A 4Z95H 4JANA 1M1SA 2UWEA 4LGSB 2FQGA 3BUYA 5ERWA 3VI3E 4GMSL 3KLKA 1A6PA 3L95B 4CADA 1YJDC 5HHME 3O41A 2DLFH 5C0CA 1E27A 3S48A 1ZANH 2VR4A 5JDSB 2Y6TE 3G08A 5FM5M 3TF4A 2DZEA 3DGDA 4R5XA 1E4WL 3WFBH 1ZDSA 5ANMB 2YGOA 3T2NH 5E00A 4M5ZH 4DQOH 1HI6B 3QEUB 2DWEB 1M9WA 2YPVA 1FNHA 3ULUL 2VR8A 3BRGC 3MNWA 1N5YL 2QSCH 4ZTEA 3OZLA 1A0QH 1F8TH 2EKJA 5DHVB 4I4WA 2ZIDA 4LLAA 1PS3A 1MFNA 3DX6A 4F7PA 1N26A 4LRNH 3O6ML 2E9IA 2ZQKA 3UMTA 4XNZC 5IK3B 1IEAA 1RZ7H 1MFCL 3FTVA 3PWPA 4Q6IB 4NAQA 2FQEA 2B0SH 5T3ZE 1Q94A 4F57L 4A7GA 1BOGA 2R2CA 5F9WB 2KLRA 2BS9A 3HUJB 4MNGE 3PGCA 4KFZC 5K9OA 5HI5D 4DO4A 3ABLB 3OM3B 1H15A 3TA4D 4AW7A 3ULVC 3FYEB 4W70A 1BD2A 4A7VA 3QJSB 3QYCA 2J72A 3O6LH 1AZNA 4N85A 4OFIA 1JIBA 2WNWA 4W81A 1U8HB 5DMKA 3KYOB 2A0LD 1E30A 1AR1D 3IKCB 4UM9B 1MXGA 3NZ8B 1C7SA 3NSYA 1SJXA 1GJIA 5FYKH 1IC5H 3KVPA 1I8MB 4XO9A 3LPGA 4OZHB 3V5HA 1KCWA 3OXSA 1AS6A 3VFWB 1EXUA 4NPYA 5IQ7L 3SQBA 2DWYA 5EN2B 1AGFA 2P8MA 4G3YL 4V1DA 2WLIA 5DJAB 3AMLA 5FOBB 3ARFA 4PJ6A 4Z3FA 3EYOA 4CU7A 1ETZB 3H7BA 4XE5B 3RWIA 2XU9A 4WNJA 2DLHA 2ENYA 1R75A 3CX2A 2G2PA 3E1ZA 2EDRA 3GBNL 4OCXL 5T5NG 4F58H 2NT0A 5AW7B 1NFIB 4WGKA 4CDHA 2YLKA 2XQBL 5H37H 2XZCL 1MQ8A 1J9TA 1ONQA 4JGMA 5E23A 3TZVC 2W60B 1FO0A 4A6YA 5JXED 4YNYB 1TYJA 2Q3ZA 3ARWA 4ZW5A 3ZDXB 2E7HA 2X6MA 3IGLA 1BVZA 2VDKH 2V5TA 4LPVA 5AFAA 2ZUTA 3N40P 2EE9A 5E6ZA 3A47A 3BKMH 2PP7A 4W4OA 4FEIA 5E99L 5MERB 4ERSL 4LSSH 3KPPB 3TN0B 1CYWA 3C8KB 3WTYA 4P23B 1A64A 4KZDL 2J21A 2Y07L 3EDFA 4LT7A 5GRJH 1NCAH 1Y6NR 3A6BL 4IK7A 4KQ0A 4HSQA 1FLTX 3P30H 1R19A 3X11A 2I7SA 4Q6YA 3D0VB 2XICA 3GSUA 5E8DL 1JCKA 1PY0A 3MCG1 3CIAA 3IEAA 3LSOB 3LH8A 4PJ9B 3Q43A 1WFMA 1F6AB 1Z9PA 3JWDH 3ABMB 5HYSB 3AQDA 1VADA 3GFUA 4R4BB 2DF3A 3ZO0A 2B2XH 4QGYA 4IKKA 1J1PH 2X1PA 4AC4A 4AYEC 1ND0A 2WYHA 4WJ5B 1DBBH 1GPOL 3V6FB 4PRIB 4Q2ZA 2PP8A 5LN4A 2QVIA 2QPDB 2QQKH 1GIGH 3Q1EA 4FNLL 4PV8A 4F80A 4CL7A 5K9KB 2EDWA 3BYTA 4C56B 3CN0A 4HX1A 3O3AA 3C8DA 2YJQA 5GSRB 3BSHA 1N7ML 4YBQC 4F20A 3QPXH 4I1PA 5FIEA 1ML0A 4Z23A 3QUXC 3QUML 5DYFA 1RJCA 4NQUA 3T77B 4WFHE 1R46A 4MYPA 1KXVA 1EX0A 1XEUA 4YXHH 4GG6B 1LO0H 4QRFA 2VNCA 3CPLA 1R5IB 4RX4D 3D0LB 4Y8AA 1UM4L 2OLDA 4YIQB 3B83A 5C97A 1HK6A 1P7HL 1R3KB 3SKNA 2BM3A 3GXFA 2MKWA 3MFFB 2R0KH 1U3NA 2GBAA 3C6SA 5DHDA 2AJUL 4OCWL 4CNIB 1GZQB 5CJOL 4XNQA 4MXWH 3V5KB 3DJ9A 3GMQB 3G5XB 2XY2A 3ZIMA 3ZGHA 2A73B 1TXKA 3P9MB 4XNZB 4HWZB 3B2PA 5HHVH 4F8OA 1KB5L 4FQQB 2C3HA 1F1AA 2CIKA 4OCYH 4X5WA 2DKSA 4ILDA 1I9RL 4KY2A 1PEZA 1EHXA 1OSZB 2F19L 3QZLA 3U6XS 3SYQA 3NA9H 4LVOC 5CEYA 1LYQA 2FEDD 3Q0HA 3VVVA 1LE9A 4M93B 4M8UA 1MRDL 4XPTL 2FJUB 2NY6B 5IROA 4LLWA 1J1OH 1IKFL 4HULB 1SDAB 1C5CH 3N55A 5EU6E 4AMWA 1IL1A 5DC2A 2MCPL 3HN5A 3U1SH 1MCPL 5JR1H 4DESA 1HSAA 3K81A 4BINA 4EDXB 1IBFA 1RUAH 4HF5H 4TSCH 2FYYB 2CE6A 3ZTJG 2MNJB 4PIBA 2ZXEB 2AXFA 1Q9KB 2EKSA 1PQZA 5BV7C 3IFPA 5CP7A 3LHPH 2CO4A 2MCAA 3SIKA 2Y1ZA 1YN6B 3T4AA 4BFEA 1S7SB 3TBWB 1YG9A 4NWTH 4FABH 5EA0H 5K59E 5JIQA 4JFFA 2DQGL 4HPOH 4X8JA 5IBLC 2I27N 4FFVD 1J88A 5HJ3A 1MAJA 4DFIA 4XCEB 3MXVL 3S3JA 3P3YA 4LEOA 3JTSB 2NNAB 4PB0L 3ARYA 1ZTXL 1L4IA 2NY4C 3EOTL 5EF0A 4RRPM 1KG0B 1EHAA 5E56A 2X4NB 3WS3B 2HWZH 1BXAA 5TH2A 5CS7A 2QR0A 3T8XB 2XJLA 3BEWA 4HIHA 5DURD 2DIJA 4G42B 1QI3A 3ULUD 3IS0X 1AVAA 2MOGA 4MWFB 3VD4A 4DP0X 5C3TA 1KCRH 1U41A 1FVDB 1BVKA 2J8UE 5T3XL 5D6CB 1V3JA 4YE0A 2ERJC 1J9RA 3MGOB 1LDPL 1U0QA 4GUPA 4GXVH 5I1EH 2NX5E 3U4BL 4OLVL 4O02A 4IK6A 3MV9A 4KJPC 3P4OA 4HGWB 2A77H 2JKSA 5IB1A 1J0JA 2MFNA 1Y7VA 2O6FA 3MGTB 3VFGL 4K94H 5FW6A 2HT3D 2W95A 5C86A 1SEQL 1M9SA 3TCLB 5IB3A 2Y69B 2EIZA 4PUBH 3UTSD 1UB5A 4PJGA 1Z0MA 3SGEH 3ZE1E 2AABH 3VXSA 4G9DB 4P46C 5CD5C 3VSTA 4OF7A 4UQCA 3K6FA 3RWGB 2X3AA 4U1GC 5EUKB 4ZMVA 5DZOA 3ZKXB 3SPHA 1N8OE 4D0BB 2FL5A 3QPQD 1HYSD 3MGAA 4ATWA 3TEYA 5LCVA 3I9GH 3OLEA 1TSHA 3QQ4A 3N44F 4LP5A 3TA3D 5HD8D 4NWUH 3TT1H 4FULA 3PGDB 4HJGB 3AC0A 3QUXB 4MJIE 4MCYB 3BIKB