2A3TA

Cu-containing nitrite reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
b'LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Rhodobacter sphaeroides
publication title Structures of the oxidized and reduced forms of nitrite reductase from Rhodobacter sphaeroides 2.4.3 at high pH: changes in the interactions of the type 2 copper.
pubmed doi rcsb
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2a3tA02
3U25A 1TEGA 2PPCA 2VSKB 9PCYA 1PZCA 4KO7A 2VW6A 4G71B 4A68A 1GSKA 1AACA 2CBPA 3EHBB 1AR1B 3ASNB 2H47C 2UX7A 6PAZA 2YAQA 1I53A 1IBYA 5IY5B 1AAJA 2EIMB 2GC7C 1JVLA 1KDIA 4HIPA 2XWZA 6PCYA 1M56B 3NSDA 3IBOA 3SBPA 1CURA 1ILSA 5B1JC 2J57A 2Q5BA 4HCFA 1OE2A 1PNCA 4QKTA 1PLCA 1WA2X 1AQ8A 1FA4A 2HLEB 2EIJB 2GHZA 4AKOA 1FFTB 3AG3B 1KBVA 4HALA 5B1KA 3FU9A 3C75A 5I28A 2HRHA 5ANHA 4HZ1A 4HCIA 2WO3B 4NERA 3ABLB 1L9PA 4CSZA 1N70A 4DP2X 3FU7B 3FSVA 2R7EB 4WKXA 2PCFA 4G7SB 2IDTA 4TXVB 1KBWA 1ET8A 5I6NA 1PMYA 1ZDQA 2GB2A 3NJKA 2FQDA 2OV0A 4AKPA 1AS6A 1AS8A 2EIKB 2IWFA 2IDFA 1SDDB 2IDSA 2H3XC 2BP8B 4F2FA 1A3ZA 4BDVA 3QJVB 4F2EA 7PAZA 1KCWA 2UXTA 2PPDA 3OMAB 1OE1A 2HX7A 1BYOA 3N55A 4BDVB 5I6KA 2AANA 2BP8A 1JZGA 1RKRA 1SFDA 1SDDA 7PCYA 2IWKA 3PAVA 2XX0A 4HCGA 3ABGA 3CVDA 4NAJA 1NPJA 3S3DB 1ID2A 1A65A 2DY2A 3L45A 3NSYA 3FU8A 4NB7A 3X1EA 3X2QB 2HX8A 4E9RA 3FU7A 4YSPA 3BQVA 4DP6X 1E30A 3EH5B 4G7RB 4X4KA 3ZDWA 4BWWA 1AZRA 2YAPA 3WG7B 5PAZA 1W6WA 3DIVA 2BWDA 1DYZA 2VM3A 1MG2C 4YSRA 4A67A 2DYSB 3NJFA 1OOWA 3CVBA 2FT7A 3CVCA 2I7OA 1ET7A 1NPNA 1PZAA 1KV7A 2X88A 1JZHA 2EILB 3QJRB 4KO6A 1CUOA 2GI0A 2JXMA 2GIMA 2DWSA 5D4IA 4KNTA 3SBRA 5PCYA 1JZIA 1OCOB 2UX6A 5AZUA 2YXVA 3S3CB 1JZJA 1ZIBA 3FSWA 3OMNB 2PPAA 2ZXWB 2P80D 4E9WA 4AKQA 2J5WA 2AZUA 2UXVA 3QJSB 4BWTA 1NIEA 3UGEA 2W88A 2BZCA 2OCCB 2BWIA 1XB8A 2J56A 4L0PB 1GYCA 1EHKB 1BEXA 1WS7A 1JXDA 4AZUA 3X1NA 4DP1X 3D12B 4GYBA 1TKWA 3FQ2A 3BVDB 4N8UA 1RZPA 1X9UA 2DYRB 3EH3B 4DPCX 4YSUA 3T71A 3NJMA 1WA0X 2VMJA 1NINA 3V9EA 5I6LA 2UXGA 4DP0X 3IE9A 4RH4A 1PNDA 1RCYA 1L9QA 2FJSA 2TSBA 3S8GB 1SNRA 3IN0A 3TU6A 3FQ1A 1JVOA 2ZONA 4DP8X 2XVBA 4DP7X 1URIA 5LDUA 4HHWA 5EHFA 4M3HA 2EINB 4ZK8A 4YSEA 1NDTA 1JXGA 2IH9A 1A4CA 1AZNA 1YLBB 3ZIYA 1W8EA 1OE3A 3NJIA 1B3IA 2YXWA 2FTAA 1ZV2A 2PP9A 2XU9A 3PAUA 1BYPA 1NICA 3X1FA 3NJJA 4JHUA 4W9ZA 4JHVA 3TBCA 1ZDSA 1NWPA 4A2FA 1BQRA 3NJNA 3X1GA 2PPEA 4A2DA 4E9TA 3JTBA 4KOCA 2HXAA 1PAZA 3NJGA 1ASOA 2FT6A 2NRDA 3HEIB 2IDUA 3FPYA 4YSOA 1BXAA 3TASA 2QDWA 1J5DA 1NZRA 1L9RA 1IKOP 1WAEA 2MTAA 1IC0A 1BQKA 1NIFA 2RACA 5I5MA 4K9JA 2BHFA 1A4AA 1HFUA 1NIAA 4HAKA 8PAZA 2FT8A 3KW7A 1QHQA 4A66A 1SHXA 2XV0A 3ASOB 2XV2A 3IEAA 4M4RB 3QJTB 1E65A 4YVUA 1A4BA 2LLNA 4JKNA 2QPDB 3V9CA 1CYWA 4BXSV 1W6LA 3ZX1A 1ASQA 1PLBA 5D4JA 4WTQA 2TSAA 3GXUB 1J9TA 1UATA 2YAMA 4A2GA 4E9VA 3NP4A 4AX3A 1PZBA 4YSTA 3CZUB 2QPEB 3CG8A 5AFAA 4BXVA 1GR7A 4MFHA 1AIZA 1AG0A 4DP9X 1J5CA 1X9RA 3CDZA 2VN3A 4Q8BA 3IN2A 4UAHA 3AW5A 1NTDA 2QDVA 1CC3A 5B1JA 3SQRA 1L9TA 2FQEA 4EF3A 2B08A 4YSCA 3ABKB 3SBQA 2YAOA 5I26A 1E67A 1AZCA 4KO9A 3OM3B 2ZOOA 3PXLA 2HX9A 3ERXA 2CCWA 1BAWA 1F56A 1GS6X 2OJ1A 3EF4A 4E9SA 1RZQA 3WIAA 2FQGA 1FWXA 1KGYE 2XYBA 1SF5A 1J9SA 2FNWA 1M57B 1L9SA 3NJHA 2BO0A 4A2HA 5TK4A 2IAAC 3FYIB 1PCSA 1GW0A 2E86A 1AZUA 3UAEA 2BZ7A 2AVFA 3CDZB 4DPBX 3DTUB 1E5YA 3G5WA 3AG4B 2YAFA 2Y1AA 3ZBMA 5B7FA 1SHWA 1HAUA 3H4FA 4GP5B 4BWUA 1KYAA 4PCYA 5B1AB 1BXUA 2YARA 4QLWA 4YSSA 5F7AA 3PPSA 3GDCA 1AOZA 2CALA 4DP5X 1OCZB 4W1TA 2I85A 3FPXA 1ZPUA 4G7QB 3H4HA 3GYRA 2XX1A 1IUZA 1VLXA 4DP4X 1ASPA 1PF3A 3WNIA 2Y69B 1NIDA 4FA7B 3QJUB 4KOBA 3WI9A 3WKQA 4UANA 3TA4D 4HHGA 1AANA 5E9NA 3T6XA 3MBWB 1MDAA 1L9OA 3AG1B 2FWLB 2DV6A 3UACA 3AG2B 2AZAA 4GY4A 1ZIAA 2DWTA 1OF0A 2A3TA 2ZWNA 4E9XA 4P5RA 4Q89A 1MZZA 4UF7C 4P5SA 3FT0A 3TBBA 4YSQA 3ABMB 1SF3A 1QLEB 4KNSA 1JERA 1OV8A 1KCBA 2CUAA 3UADA 3S3BB 5FC9A 1MZYA 1JOIA 1GS8A 3N2JA 3T6WA 4YSDA 3NSFA 4GXFA 4YSAA 2GBAA 2PP7A 1JXFA 2I7SA 2IDQA 2MRYA 1GY1A 1IBZA 4A2EA 3WKPA 1BXVA 1WA1X 4E9QA 3NJLA 2VW7A 3DKHA 4G72B 4GP8B 3T9WA 1OCCB 1NIBA 2PCYA 4KNUA 2CJ3A 3FSZA 2BW4A 1TEFA 3T6VA 5I5JA 5TK2A 3UAAA 3OD3A 5I6MA 1ADWA 3X1BA 3OQRA 1R1CA 5AKRA 1SFHA 1V54B 3NYKA 4PAZA 1HAWA 4F7KA 3PAZA 1JZFA 1XB6A 5B7EA 3UABA 1DZ0A 2HRGA 2GSMB 2YAEA 2IH8A 2H5UA 3S8FB 3PCYA 1TU2A 2XXGA 2UXFA 4BK5C 1SJMA 3HB3B 4YL4A 1N68A 1XMEB 3NSCA 2XXFA 1J9QA 2BW5A 1JZEA 2BP0B 3AZUA 3FSAA 1A8ZA 1PY0A 5I5IA 1T5KA 2WO2B 5B3SB 2P80A 4N4YB 1PLAA 2B3IA 1GS7A 1AZBA 4FAAB 4YVNA 1OCRB 2YAHA 3QPKA 2X87A 3AY2A 1AG6A 3MX0B 1ET5A 3QQXA 4G70B 2GC4C 2XUWA 1NWOA 2VW4A 2PLTA 4GP4B 2CAKA 3JT2A 3NP3A 1ILUA 5I6OA 1WS8A 3RYMA 5D4HA 2HZHA 4DPAX 2FQFA 1QNIA 2YQBA 2XLLA 4E9YA 1V10A 2Q9OA 3KW8A 2W8CA 3FYEB 2N0MA 2JFCA 4KO5A 4AI7A 3EH4B 4ENZA 5B1BB 5F7BA 2PP8A 1BQ5A 5A7EA 3NT0A 2BP0A 1CYXA 2J55A 3OMIB 2WSDA 1J9RA 1MG3C 4CSPA 2QT6A 3PLYA 2R7EA 3FS9A 2VM4A 1ETJA 1XB3A 1M9WA 1GY2A 3WNJA 2VSMB 2XV3A 3H56A 2PPFA 1E5ZA 5B7MA 1AS7A 2AFNA 3QJQB 2JKWA 1EZLA 1KDJA 2IWEA 1V55B 3FQYA 5I6PA 3T6ZA
chains in the Genus database with same CATH superfamily
1NSNH 3QAQA 1CI3M 2VR7A 3PWPA 3FT3A 2DW5A 5E94A 4UNIA 3BLBA 4UB0H 2VW6A 3VO0A 1EZVY 2FO1A 1CG9B 1B2WL 4PYGA 4E42B 3G6DL 5DVMA 3UTTA 3B2UD 4XP5H 4FLSA 4F8PA 1GL4B 1KDIA 3V0IA 1NFDA 2XWZA 2WZPD 3QG7H 3L1FA 4U6XB 2XZAH 5B1JC 4NP9A 3SPIA 1NDMA 1TVBB 4HXBL 4MXVE 4WJKB 3INOA 2CJTA 5CMAB 4B41A 3I6KA 4OFDA 2HLEB 3MA9L 4BH7B 3MRNA 5KVFH 1J18A 1F5WA 3L2LA 2FWUA 5GRWA 3V5DA 2X2JA 2YD0A 5FHBH 1UT2A 1WAAA 2HKHL 4K3EH 4M62L 4BFEA 4OZHF 2EKJA 3ELQA 1H15A 4Z7WB 2LFGA 1MF2L 3EFFA 4UQ3B 3ZDZB 3TVMA 4L37B 1IGJA 1E4JA 3FSVA 3O6FB 2X89A 4QHMA 3QORA 3MRQA 1SUJA 3N42F 4KRNA 1ZLEA 3ZT5A 3X3FH 2VXTH 4MJ5A 4PJCE 4Z5RA 4FQCL 3KXFD 1PMYA 3NJKA 3SB3A 3EOAB 3WXVL 5LBVA 4KKBC 1BFVL 1FNLA 1SN5A 4YLQT 5CUSL 3KLAA 1NCJA 2KLTA 4N2MA 5B39B 4WRLA 2P3YA 2MCMA 1LK2A 3OLGA 1E4XI 3U6RA 3QJVB 5CBAA 1ZLSL 3RWFA 4H88L 1VHPA 1UVQB 3TCLB 1OF2A 4ADJA 4F7CB 2B9BA 2BWQA 2ZYSA 4ENEC 5I6KA 4Q9RH 4HK3J 4PHXA 1MKFA 1F4WH 4PJIE 3L5XH 3MLPA 1JZGA 1RKRA 1N6VA 5SWQB 4OM1H 4KITB 4GB9A 4N20A 3VFVA 3BDYH 2PWGA 4QDGA 2X1WL 3QHFH 3C2SA 3SQOL 4ZPTA 3RVWD 1NC2D 1Q0YL 4AVIA 5AB1A 5CSBA 3VXUA 1DEEA 5KYWB 5E8DL 3U79A 1HDMA 4HGWA 1E7VA 4BQ9A 2NYZA 5HD8C 1S5IL 3TC9A 4G7RB 1CR9L 4MCYA 4ABWA 2WGXA 4Y4KA 4EPSA 3B37A 2GSIB 5DHDA 5EO9B 3UXFA 4FZEH 4MA8H 3CFIC 4X5WA 3VI3F 3N04A 2F5BL 3IDXH 3T2NH 5DD5H 2A2QT 4JFFE 5J7CC 4HYTB 4PJDB 4S1DC 1YUHA 5K9JL 2NY3B 2AV7B 2VQ1B 5BRZD 4NM8L 3IGKA 3CVCA 3QDGA 2EC9T 2IVFC 3MLRH 4ZMYA 2K8QA 3RIAK 2IQ9H 5LGJA 1EO5A 2QLVB 4R7XA 5AALA 3EIFA 3MJ7A 2H8PB 2IPKA 2YA1A 4LAJH 4JW3A 4PJHF 3ARWA 2VL5B 3BSZA 5D4IA 5HHOD 5A1AA 2FL5B 4KZEH 1DVFA 3QUYD 3FRUA 3MOQA 1A7OL 3WENA 4H8QA 3MODH 4XTRD 4TSAL 3W0WA 2WLIB 3TCXA 1K6QL 2F74A 3HAEH 4QAMB 2ZAHA 5DD6A 4OV5A 3BXNB 4HD9A 2BSCA 2BC4B 3UERA 3VDBA 4MNQD 1E50A 5ALCH 5FYJL 2ZCKH 2HT4D 5FYLD 2ZUSA 2HKHH 1CGYA 5J1AB 4WW2A 4LHUD 5LGYA 4EQ2A 2NX5E 2WQWA 2FYVA 4WFHD 1WITA 4X6EA 4RZKA 4NLAA 1OALA 5ISZD 1PBYA 4GYBA 4K3JL 1H5BA 3HVNA 3TBYA 3K5RA 3WL9A 4NENA 1LO4H 3TO4A 2YMXL 3G6JA 1RMFH 1NGWA 4WJ5B 1FVCA 2DYPD 4ZOAA 4FABL 5HI5C 4DPRA 3OGOE 1BZOA 5I0XA 5AVTB 5EOTA 4F37K 5HHQA 3OPUA 5F7NC 1O7DE 4YE0A 2UY6B 5IOPA 3E80A 1Q0XH 3MTRA 3EYVA 5FLUA 3SE8H 5LQBL 4OUOA 1KLFB 4RAHA 1P4BH 4DOHE 4PD4K 5IQ9B 4KJQD 2IANA 1WZLA 3LIZL 4DP8X 4JN2A 1A21A 2G3ZA 4XOAA 3TX4A 3Q44A 4YLBA 2EC9U 1JNLL 4R84A 2ADGB 1ZKAA 1K3ZA 2YD6A 4I3SH 2LHAA 2DMGA 4KV5F 5E8PA 3RVTC 3BC9A 2OA9A 3ZZ1A 4HLEA 2CA3A 3P11H 3ZIYA 3BAEH 4PWHA 4X42A 5C0BA 4ZFFB 5D2LE 1G7QB 3AS2A 3ULVE 3QUYA 4ZXBA 3EYVB 3JYBA 3CSPA 1A7QH 4M7LL 4ZUSA 3HN3A 1I85C 2DM4A 4IRJB 4R97C 3MV9E 3JUZA 4UMSA 1BD2A 5I2IB 1GTFA 4PRHE 3GHPA 4U7MA 4U7KA 1NLBL 2HXAA 5T3XH 4OLEA 4OLZH 4WGKA 4X6BB 3HN5A 3ZGHA 1QA9B 2WJ5A 5D7HA 1D9KA 2QQNL 4PW9A 2X6UA 1WPCA 4U1NB 4JFXB 3VGBA 5BVJA 2JK5B 1M6OA 3QEQB 4Z76B 4NUGL 3OBAA 1BZEA 5INDA 2F53B 2AXJA 1J87A 2VLMD 4K9JA 1BWMA 4G7YH 4MA1C 1NIAA 5JXEC 3ZO0A 2CDGB 2XN9E 5ANMA 3I85A 2BY3A 3KL5A 4JLRA 1NC2A 4RDQF 2BVPA 4RSVA 5IHUL 2IQAB 4N1EA 4CADB 1LLAA 2G4GA 3IFLH 3WDIA 4HKBA 4G80A 4QYOB 3MJGX 1KBKA 2W9EH 2ZSVB 4JRYE 2WTPA 2CO4A 1UH3A 3V6OA 1N2RB 2DQDL 5BO1H 1AO7D 2KDGA 2DMHA 1CD1A 4ZJ9A 4G2AA 3LVTA 1F90L 5LBSA 5D96B 2YD9A 2N7AA 2Q8BL 2VQ1A 2YGQA 4Z7WE 3HPLB 5AW9B 4LL1A 3M17B 4P46D 2ZWSA 4FA8A 5GS1B 1PZBA 3DBSA 5KN5A 4OFIA 3FO9A 4L8SC 4PWJA 2DIJA 1N3NB 5IQLA 1FNGA 4ERSH 1GR7A 3V0WL 4MFHA 4YDJB 4UYPA 5AKVA 1RVFH 5F6HJ 1CPUA 3KGTA 4JPQA 4FI7A 2LVEA 5IJBC 2N01B 3O81A 5F9OH 3VXQA 1J1XH 2AS5M 5IB3A 3U9UA 2XBTA 1R5WA 5B1JA 4RGMC 2ZUVA 1EZSA 1R3LB 4FQJH 2F7RA 3TNNA 5FHAL 1R3JB 4FRWA 3HZYB 1PQZB 1TZHB 2W60A 2DIAA 1G9NC 1AC6A 1YUHB 3MV7A 1GC1L 1IC4H 1ES0A 1G5GA 1SN0A 4UI2A 1TPXC 2FATL 5EZIH 1BJMA 1KULA 3OLIA 4BHUI 1A2YB 3OR7A 4HMEA 3MRHB 1CJYA 2FNWA 2FLMA 1RULH 2VDKH 3KJ4C 4IGBB 3M1BA 1R75A 1QFUL 3QWOA 1E5YA 3VFUA 5I74C 3ZBMA 3AADB 2NR6D 2NUTB 3LRSB 5L4IA 5JOFA 1JRHI 2D3LA 3NTCH 3KH4A 3GHEL 4EDXA 5D7IA 2CO1A 3BISA 3REWB 4PJ5B 4QHMB 4AENA 1X5FA 4W1TA 5IQOA 1JV5B 2CJUL 2X4RA 3CLFL 3H4HA 4HSCX 3STZA 5KW9L 4QRPD 5C6PB 4ODHL 3HLAB 5I19H 3KCPB 3ARPA 4Y19B 3SE6A 3MLZL 3CDGB 1E42A 1R46A 1I8LA 1XAKA 4XB3A 4U6YA 4Z3TA 3BCFA 4WCYL 1GPOL 5C0GA 5KVFE 2MCG1 3P0YL 3HNTH 2VXUH 5FA4A 8FABB 1T7WA 5HVHC 2VOTA 4AIZA 2C7UB 4P5RA 1X5IA 1QSEE 3BRGC 2WVVB 2K8MA 1TOXA 3CVHL 2R9HD 4MA1B 3C8DA 3L1OL 4MDIA 1FFQA 1J0JA 5EIQA 1NC4A 2E7CA 5MERA 3O2DA 1V7NH 1JOIA 1SXAA 3RDTD 3T0AA 3V5DB 1HJBC 1FO0B 1NC4B 5MERB 3GS4A 3VMNA 1AQKH 1WZAA 5MEOB 3EO9H 1I1AB 4Y5XC 3ZQ9A 1EIBA 2I7SA 2BY2A 2IADA 3DOSA 3O0LA 2W9DH 1GY1A 2FX9H 3QULA 4I0PC 4K07A 4FYQA 4XMKL 4LDOB 3B7UX 4P07A 4L3FA 4AYMC 1Z1WA 4G72B 4ZUWA 1ZXKA 4ZO6A 4EN3C 3UYOD 5DJ8A 12E8H 1Y1UA 5HVGB 5AG9A 5DGRA 3OKLB 4OB5L 5HVFB 3CFJB 2HFEB 2XQBH 3RBSA 4HUCA 3OQRA 1NCAH 2DAVA 1R1CA 3QUYC 1SFHA 2RFXA 1LWJA 5EZOH 4IRZA 3P30L 1FC2D 4RWHA 4HPOL 1KOAA 2CHXA 1G87A 3IXAB 3LPWA 3WUWA 3U4BH 3QW9A 2X53A 3OAUH 4N9GA 4JG0L 2ZX9A 1EDQA 1TCMA 2ZG3A 3KHQA 4R6UA 5JHDA 1K5WA 1U8CB 4MNQE 5DJ6A 3HZYA 2Q76B 4XXCA 4UQIM 3B2MA 3WLWD 3EUUA 2CGRL 3DBXA 1EVUA 3BHBB 2LTQC 3MREB 5F7EL 2BP0B 3NZ8B 3DXAB 5CWSB 1X5YA 2AABL 3F6LA 3QQ9C 4UT6L 4X6EB 3RU8L 2BIHA 1JF1A 3Q3GA 2ZCHL 4K3HA 3HUJB 4TPRL 1XF4B 1IILE 2X0WA 3L5JA 3BX7C 3LXAA 5IESH 1QAWA 1OGAB 1I8KB 2X87A 1OTTD 5JORB 1F42A 1ORQA 4I7ZC 1H8OA 4KTDH 1ODAA 4FQPA 3II2A 1OW0A 1Y1DA 4XWOD 3WFHB 1T1ZA 2FYYB 4YMPA 4DUXA 4KU1A 4GW4B 2VLRD 1WFOA 1UACL 4BFKA 1A9VA 4OLWH 4FXGA 2PTUA 2PR9A 3EO0B 1WF5A 1V10A 4OQTH 2NY6D 3HKZA 3FYEB 1T7YA 4LCYA 1XTLA 4MZIA 4PV8A 4KV5E 4RFOH 4WI0B 3WEXB 1CDIA 5CHNA 1XAUA 5BO1L 1DQML 5BOJA 1T21A 2DQUL 2W38A 3VXQB 2BHYA 3WJJA 5D1QB 1HSBB 4IJ3C 3MRLB 2N7SA 2O26U 2WQXA 4FXKB 5CCKL 4DKEH 5D1ZC 5JZ7D 5B38A 1OCWL 3EJJX 1I7TA 5D2NE 2VTFA 2WUCH 4OV5B 2AFNA 3B9KD 4P9MH 4XP1H 2I9LB 1OP3K 4N28A 3IDJB 4FQ2H 1TEGA 4HISA 1JK8A 4JHAL 3TH4T 1A7OH 3RPBA 3OWRA 3U46B 2QQNH 3ULUF 2V4LA 5HJ3B 2DEWX 2VN6A 1BREA 1H6TA 3M88A 5EBWB 1JGVL 3P1VA 4O58H 5DR5L 4HJGB 2EEDA 5DJXA 4EI5C 1TYRA 4Z1PA 2HVBA 5E6IB 1XWVA 3ZYJA 1ILSA 2NY5L 2WNKA 1P6WA 1EGJA 4FULA 1T7XA 1HCVA 3I6LE 3NIGF 3S5LB 4K7PL 4AEIH 1AQ8A 2NX5A 1OAZH 1JYVA 2AEQH 1BD2D 2WTOA 2L7QA 4FOMA 1ACCA 4X5WB 5FYKH 3ULVH 2CPUA 5BCAA 4GKNA 5HHVH 4RQQA 3V2AR 4JFUA 1T3FA 2YPKB 1DEEB 3D9AL 5KYWA 2RH0A 5F7DB 4X6CE 5J6GA 5KBKA 5GGRY 4NO0D 2NXYD 1J8HE 3JTTA 2Y7SA 5HPMA 1ZDQA 3P77B 2Z7UA 1AS8A 4HXBH 4C4KO 2HMIC 1S7QA 1EUUA 4CILA 2EZ0D 5D7JD 4P23C 3K4DA 2H3XC 1J12A 4KKQA 4Z7NF 1HC1A 4MJIB 1JK9B 5F3FA 2WXHA 1W16A 3AQDA 1CFNB 3ZKSD 4ZMPA 3S3SA 4URTB 2XTJC 3FH7A 3P9MB 5C07B 2JJSC 2BP8A 4WW2B 2B39A 4MJID 1HHGA 3ARDB 4HCGA 3PNWB 4OCSL 3QEGH 3S3DB 1A65A 1DQKA 3RFRA 3V0GA 4DZ8B 4AMKL 1AGDA 3U4KA 4LVHC 2VXTL 3ZVVA 1OTSC 2AXGB 5T33L 1OLZA 1JPFA 4NB7A 4CDGC 4IBUA 4FFYL 2DJSA 3OAYH 2JJTA 4JREC 3S2AA 3BQVA 3T1FB 3QUHA 4XT1C 5IMOA 4HUVB 4TUKL 3FB7B 1VA9A 2XPGB 2DKUA 1OP5H 5FB8A 2CNZA 5JDJA 5HDOA 4GRLA 3MJ7B 1UADC 3ZYZA 2G5UA 1SBBA 1MI5D 4G6ML 3ZHFA 5A6MA 5J1AA 1R3JA 4QRSB 5F7HA 2NY2D 4ABUA 3D34A 4HVBA 1G7HB 1HI6B 1RIHL 1TQWA 2ICEA 5FOBA 2A77H 1INEH 1R5IA 2X88A 4FZ8L 1JZHA 2A9NL 4YDNA 1UCBL 3CHPA 2XQBL 3ZDXE 1QUNB 4TVPE 1ZVSA 3T2NL 4HUVA 4LAQL 4IIQC 5CEZD 3FRPB 1I1AC 4Y5XB 3PY9A 4OY9A 3U0WL 3CFTA 1A02N 2ED7A 3DA0A 3EOTH 3QH3B 5PCYA 3JZYA 1JGIA 1NANI 4ZYKB 3HNVH 1OHQA 3FSWA 4N3TA 3N1QC 1YHPA 4TNVF 3BEWB 1GZHC 3SY6A 1J8RA 2BJML 4L4TE 1G0XA 5C0ND 3IPBA 1P7QA 1RERA 1H0DA 2CKBA 3RVUD 4YUEH 1CICD 4L0PB 5ETUB 1IBDA 5F7WC 1ADQA 3QZNA 3L9RA 1KTLB 4LMQE 1KCVH 2GW5A 3VXUE 1WICA 3US1A 1NANH 2DYRB 3AB0C 1GCYA 4M61A 1RXLA 1QFWL 4MB4A 4NCC2 2YSTA 2CKBH 1ZLWH 3QUMA 1R6VA 4B0MB 4NRYB 4XN5A 4YAQB 4BSVA 3NCCB 2AP2A 4K23L 2HRLA 1EH9A 2FJSA 4LIQL 1E4HA 2AVGA 3V0VA 3PWUB 1KIUA 3AXIA 2P24A 2XQYG 4M4PA 2FJFA 5IW6B 5LJYH 2XVBA 1RZJH 3WNPA 3UTZA 2C9XA 5EZLB 4CSSA 3D4ZA 2GSGB 3LV3B 3PV6B 4FTDA 3KPNB 2WLMA 4LLUA 4HWUA 5I2IA 1A4CA 1U8NB 2EYRB 2X2YA 3T8VA 5J0BA 1KCRL 3W5NA 5HHNA 4J27A 4MA7L 1ZV2A 3MYJA 1AR2A 3X1FA 2H6PB 5EUOF 1G5AA 43C9A 2X3CA 3VVVA 4IRSC 4A2FA 3P73B 3NJNA 3X1GA 4UCFA 5HSFA 4X7SH 3OXRB 2YBGA 3RZCA 4CGUB 3A47A 2WP3T 4HUUA 3S5ZA 3IDMA 1KLGB 2QFPA 2AEPL 4J6RL 4K94H 5IK3B 1JPTH 3CFCH 1CVSC 3NAAL 5K9KB 2VXUL 3K0WA 2WD0A 4KTDL 5ERWA 4Z3EA 2MFNA 1XF2B 1A1OA 4L9DA 3EGDB 3MZTA 3PWNB 5C0DA 2P4AB 1P4UA 3LNHA 4BM7A 4E41A 1EHAA 3KW7A 4LEEA 5D1QA 4MXWL 5IEHA 2HT2D 1T22B 5F9OL 1JPGB 5FUZL 3DUUA 3QCTH 3DX1A 1CN4A 1OGTA 4NJAH 4ZDHA 3Q6FA 4FMFA 5C0JA 1U8HA 4B95C 4WTQA 2DLIA 2YJQA 3GXUB 2AJYL 2QPSA 1VADA 3PGFH 4IIQB 2WY3B 1XCTB 4QGTA 3O6KL 2WKLA 32C2B 1H3WM 3L4VA 4AX3A 4BQCA 3RDTB 3KHOA 1NKGA 3DVGA 1OGAA 1IM3B 3HZ3A 4Y4FA 1H8NA 3GBLA 1RULL 4BXVA 1Z9SA 4KQ3L 3P69A 2OX5A 4JM4H 3W0WE 2MKWA 4LQFH 1R0AH 1G94A 3IN2A 3FQXA 3PV7A 5IHUH 1EAQA 3O3DB 2OMWB 3FMGH 4F92B 4H40A 3DBXB 4UTAH 4U3CA 3PXHA 2FQEA 5DK3A 5EC1A 2WLNA 3V4PH 1EQWA 5GHWH 1JDCA 3RWCA 4KO9A 3RDTA 4NIKB 3RVVC 4KQ3H 3AXHA 5FO2A 5KBLA 3KPSB 1F56A 2FAUA 1D3CA 5EIIB 3D05A 2DH2A 4OD2B 4J4PD 4TQHA 1M7XA 4QOKE 4UT7H 3ZL1A 4Q2ZA 3ARGC 4GBXC 4G8IA 3L5IA 4E0RB 5KYXA 4HT1H 5FYLH 3E1ZA 1DQIA 3DJTA 3EZ8A 2ZJSH 2Y7OA 1INDL 3SPVA 3SY0A 5EU7E 1T5XA 5D7KD 2CLVA 1J5OH 1T04A 5AZ2H 1P5UC 3WN5C 2VDMH 3DV6B 3D07A 5GGRA 1HYRC 3G5WA 4YNYB 5GGSB 3MFFA 4F7PB 2XIDA 1X3DA 2ZTBA 3S2CA 4WCYH 4UQEA 3TWYA 2GQHA 1KJ2L 2J6EA 4DCQB 1FDLL 1I1AA 3MV7E 4PJFE 1L7IL 4J3VA 3RA7L 4GKSB 3SQBB 5INDB 4LARH 2BJMH 4IEFB 1MEXL 1IUZA 3QS2A 1NFIB 4R90L 1NGPH 1LK2B 3FN3A 3RTQC 3C60B 5LG6A 4PJ9A 4ZMOA 4C47A 2QQQA 3FT9A 5I1JH 1FV1B 4KOBA 1KIUB 2OR9L 3BUQA 1YSOA 3O2WH 4L5FH 3ZDXB 2Y1ZA 4JFYB 2P28B 2ZUXA 5E9NA 3TA3B 2J71A 3X14B 4RVBA 2WCSA 2WIIA 5D4QA 1SJVA 3BD4A 5L2KB 2FHCA 5TH2B 5ESAA 4OTXL 2OM5A 3MKKA 4AC2A 4GAGH 4TTDD 2DBJA 3FT0A 1FSKC 4AV4A 1QSEB 2C9PA 4W6XB 2HB0A 3BWZA 3C5ZB 5IBUB 5FWRA 2VLRE 3CN3A 4Z7QF 1KC5L 4IYKA 3LN4B 3ESUF 5LAPA 1CF1A 3DJRA 1U8KA 4K2UH 3O6MH 4HCRL 5G55A 3PIQB 3RNKA 5CN2A 1NEZG 5IVOA 3GSNA 4AJVA 3HI6H 3PXJA 1G7LB 2MRYA 2X10A 2E6QA 4GO8A 4OQ1A 5GRXG 4I3GA 1KXVA 1BXVA 1IQWL 1BQHA 1KN2H 4F93B 5CD3B 2XKUA 5ANME 1JFHA 1FAIH 1U8IB 3TO2B 4XHJC 1I7RB 2C8NA 4U3SA 3KLHD 2Z31C 5H94B 3G5ZB 3VFRB 3OD3A 1HCFX 4Y9FA 1PZ5B 4QO1A 5T1MB 5TQ2L 3C5XA 3GQFA 3S37L 2NR6C 4JFHE 4XE5B 2B1HL 2E7HA 5E00B 4FG6C 3FU0A 3DX9B 4MXQD 1SQMA 2B9AA 2X1QA 2X2HA 5IROC 4U6HB 3R18A 2XJLA 1I1FA 2XWBA 4NKOB 4NXKA 2UUDH 1IL1A 1DVFC 2ZWYA 1D7FA 1TLMA 1GXEA 4JM2D 5C0CA 3LKQB 1UZ6E 4X5XA 4QWWC 4KJYB 3CN2A 5C2UB 2XKNA 3GBML 1M42A 3BEVB 3VTAA 5D7SH 4G8GD 4N2IA 2APTA 1Z9OA 2XTSA 1FL3A 3LKSA 1K4DB 2OMVB 1CDUA 1SEQL 5DMGC 5AKTA 1UXSB 2EVFA 5CEZL 3LTVA 3U6XS 1AHWA 2CHWA 2QPUA 1F4XL 1K8IA 2DQJL 5I1LA 2R0WL 3QWRA 4GP4B 1MCKA 1O75A 5C08E 2DLFL 1KB5B 2JKJA 2R23A 4AW4A 2I9TA 4E9YA 5I0DA 3KW8A 1DVSA 1WEJH 1T5WB 5A6IA 2BIMA 3GZOA 2EDTA 3LD8B 3QCUL 5B1BB 4M8QB 4JN1H 2J55A 2MOVA 4PJ8B 4G8FA 1FORH 3ARYA 5DJAB 3SDDA 1UT9A 2VM4A 1IBGH 1EMTL 4J3OC 1JD9A 3H56A 3KPLA 4UT6A 2R51A 5KVDH 2DH3A 1RLWA 3MJ8B 3QPQC 4JDTH 4BFIA 5I1GL 4QY8B 1J7VR 5FHBL 3U4EB 4LVOB 1I9RH 4NWUL 5I82A 1JPST 4WUKL 4P2RA 3TZVB 1P1VA 3N3EA 1N4XH 1KB5L 1BDYA 4MNQB 5H37A 9PCYA 3C5ZA 4AMWA 2DJ4A 3BI9X 3KL3A 2B4CC 3ASNB 1U93A 2YD5A 1ZS8B 3S5LA 4CJ0A 5AAMC 1F6FB 2ENPA 2W91A 4ZUSB 1GZHA 4OCWL 4PU2A 5HHMD 3NSDA 2WQRA 3IBOA 5DVOA 4XVSL 3ZW3A 3TT3H 1CURA 4I18C 1QFHA 2XG5A 1KJ3L 1YEEL 2P1YA 2XN1A 1H6FA 3TA3A 1F41A 4UB0L 1UHVA 2CJSA 5J89A 2VLRA 1TJHL 4JCMA 2H4EA 3OHXB 4LCWE 1FFTB 2AJUH 3TGXA 4NWUH 5H37H 3WEBA 1B6DA 1RSYA 3V5HB 1DUYA 4MZ3A 1MI5E 2JELH 2Z4TA 1DLFH 4Z0XA 1OGTB 5DT1L 1FYTB 2M8XA 1BG9A 4X8JB 4N2LA 3WBDA 5SX5H 1IAKB 1QSFD 2NSQA 5IB2B 3B34A 5EORH 5D7IE 3X13B 4JS7A 4MXVF 4PJCB 1UGNA 3A67L 1A14H 1H3GA 5CKGA 2F1AA 1YN7A 5EU5B 2LLGA 1EBPA 2OSWA 5FAAA 1L6ZA 4UT9H 2WYHA 5E99L 3TTSA 2Y5TB 1I8MA 2GCYB 1S8DB 1VFOA 3ARDD 3FHEA 4XO5A 3WL9B 4L8BB 4QCIA 2YEQA 5E2WH 1BZ9A 3VWKB 4F2FA 4FFZA 4RZCB 1JBJA 2P46B 3P0VH 4BDVA 2P8LB 2IQ9L 1SDYA 1CG9A 3K2UL 4JAMA 4Y4KC 5AW5B 1WWCA 3KD4A 3U0TB 3MGTA 1ZEAH 1IX2A 2MNJB 5C86A 3OMAB 4RBPH 3V0JA 1ZANH 4BDVB 2NQDA 2R0WH 3H3BC 3OF6D 5DI8B 3UDWC 1QRNE 1ZT7A 5IF0A 1FG9C 3RVVD 4NKMA 5DJDB 3EHBC 3BP4A 3TWCL 4F91B 4KKNA 2BMKA 4L4VA 4TTGA 2EH7H 4J4PC 4OFKA 1T7VA 2E7MA 4KRPB 4P2RD 1KXQE 1QMUA 1LEKA 3CVIL 3FU8A 1DE4A 4O2FA 1C1EL 4PJ8D 3U36B 3VCLB 2VXSL 4G9DA 2FL5A 4RA0C 1DBMH 3KXFE 4DP6X 2C7FA 1E30A 1V3JA 2YMOA 4ALAL 5A43C 2YRPA 1VB9A 3WUWG 2OTUA 3TWCH 1L7TL 3PWUA 3VXMB 1A3RL 4MRBA 1HOEA 4W6WB 2BVQB 4XCEB 1JZ7A 3IDYB 1HEHC 2Z31A 2ICWI 3PWLB 3DK0A 5CGBA 3LXCA 3QXWA 5IZ7A 2V5SA 1I75A 4ELKA 5I71C 2H7WA 4GG8A 4BSVB 4YAQA 1F18A 4HFWB 1FO0H 1CUOA 4MQSB 3L3JA 2UZXA 4OCLC 4YHPB 1PJWA 3FTXA 4W4OA 4A1RA 3BPLC 3P40A 3QR0A 4D9RE 5FF6A 3LN5B 1OCOB 4K7FB 3VXSD 2NNAB 2ZCHH 5ETUA 5D6CB 3HHSA 3D87B 3GMQB 3Q2VA 3HCVB 3KE0A 4JQVC 1NAKH 2YSSA 3FTVA 2K0RA 7TAAA 1MAKA 3AGVA 3ZTEA 3VXRA 4DESA 3MX0A 3O3AB 2VSCA 2GABA 5SWSA 5CBEB 5IK3A 5GGTL 2GY7B 4PJHE 1F45A 3X1NA 4Z7QE 5LNGA 1U58A 4HGWB 1TKWA 2G30A 4QXVA 2XWTB 1HDMB 1LE5B 4APQB 3SDCC 1PEWA 4TUJB 4YFLI 5AL0A 3T3PB 3VXNA 4LVNC 1P1ZA 4MNHB 4DPCX 2QFRA 3ULUE 4CSTA 4Z7VB 5DQ9B 3QUXC 4XAKE 4HPYL 2MJWA 4DP0X 2F54D 12E8L 2E59A 2TSBA 2VISA 3WHXA 3N44F 1RZ8B 1NUNB 4BKLA 3TJEL 4PGCA 2HJKA 4M5SA 4N2FA 2AK1H 4OFVA 1E9PA 4ISVB 2NY5C 2WN2A 4HBQA 4KQ4H 1IEHA 4P5KA 5HGAA 4BUQA 4J1UA 2CXGA 1VFAA 1FAIL 2OMUA 1NA8A 1ETZB 2IANE 3K81A 1HQRB 1IGIH 2IH9A 3WS3B 3IU4L 4KK5C 5D5MB 5LNEA 1F58L 4WO4C 2E27H 5IMKB 3FQNB 3DXAD 4N85A 3S4SG 3SYAA 3CXDL 3QEUA 1LEGB 3H9HA 2PP9A 1JWUB 3WKYA 3WNNA 1TZAA 3UG5A 3FQNA 4P04A 2L4OA 5F1NB 3IJYB 4W9ZA 5ID0B 5J3HD 4MDJA 5HHOE 3TBCA 4Z78B 2V7HB 2W65A 1WBXB 1HILB 5J6HB 1KCKA 2X4QB 1I3RA 2EQDA 3QT2A 2R8SL 4KOCA 3RHWF 1G7PA 1XGYH 1HN1A 3OPZL 4KBPA 1IAIL 3GKZA 5I9QC 4N8CH 3ECVA 3DDGA 4GI9A 1QLEH 4HJUA 3KM1A 1T1WB 4PJ9C 5IVXB 1L9RA 1IKOP 4GXUN 3MVSA 3BKYL 1PQZA 4B9JA 1HSAA 4R4BB 3U30C 3HW7A 1S6NA 3GMLB 5FECA 3IJYA 2Z35B 4G59C 2XFXB 1QHQA 4XZ4A 2NNXA 2XV2A 2B1AH 2WAQA 1F4AA 3FO0H 2CDEA 4IBSA 4LPUA 2XN2A 4M4RB 1IVTA 4PMFA 1G4RA 1N7ML 1UM4L 1ADQH 1AD9A 4LQFL 4PJFF 1AQKL 4GS7C 4LVHB 4NUGH 2IAMA 4PI2A 5AVRB 3FCUB 1MWOA 1D5MB 1V3MA 1DQMH 1BVLA 1FBIH 4BZ2A 1QLEL 4L3EA 3QDGE 1ZK9A 4LCWA 4UTCA 3PQYE 2R0LL 1EEQA 3CHRA 3NP4A 1M1SA 2PCPA 3HG0A 2IFFH 1NH6A 2DI9A 4GUOA 1U4FA 1SY6A 2Z93B 3GMQA 3WJJC 3GFUA 3IB4A 3TV3L 2IMNA 5AZ2L 3V4VA 2QPEB 5DURD 1L6PA 1IBFA 2EDBA 3M1CA 4H5SA 5ADOL 2CUIA 4ZYKA 2CIKA 1YZZA 2OP4H 2VN3A 4NYLA 3FB8A 4LDLB 3DDFA 5JA9A 5I74B 3W5MA 5AENA 2H2SD 2QDVA 5AW8B 1FL3B 1NOFA 1WIOA 3SQRA 3D2UB 4JO3H 4HWBH 5I19L 1OGPA 1NDGA 4JFEE 4M7LT 5CSZA 4Q6IC 4DGYH 1FRGL 1U3JA 3QEHA 3UAFA 4ETQA 3QIUC 3ALXA 1JRHH 1R33A 3VXRB 1HHKB 1A4KB 2OL3H 4EEEA 1JGDB 1CXLA 5DFWH 3K91A 1NBVH 4UDUA 3VU1A 1EK3A 1MRFH 5F6IB 4QOKB 1Y6NR 1SXCA 4QT5B 4G6AC 2DLTA 4UM9B 5DFVC 4JFDA 3P3TA 1TJMA 2NTFB 3L6FA 2QQLH 4KROB 3SEPA 5EEYA 3L3HB 2VDOB 5FF6B 1NJ9A 3QXTA 3WHE1 3DARA 1YCSA 1BFTA 2BSEA 3H2WA 4HKJB 3UPRA 4P2OD 1QX1A 3TO4D 4FXLA 4BWUA 3DX0A 4LSUH 1AGDB 4PCYA 4KK8D 2RCSH 4GO9A 2CBTA 1IEAB 4LEOA 3UO1L 2CALA 1MWAL 3DOHA 4PP2B 2J6WA 3HFMH 4HZLA 2I85A 3GSOB 3EGXB 5C07A 2V33A 4KKLD 5KVMC 4UAOC 4ZO7A 2RMNA 1KPRB 1BGXH 1JF1B 4FA7B 3QJUB 1XGUB 5E4OA 1FDLH 3C5SB 4PWIA 4AYFA 4U1KA 1XMWA 1HS6A 4MKTA 1HWWA 4KVPA 4CBZA 2EDDA 2FWLB 4NZJA 1OP9A 2Y2WA 4JPVH 4PJ7F 2DWTA 4OGAC 1KYOJ 4P2RE 1OZTG 2O72A 3TN0B 4XB8A 3S3PA 1IAKA 4XVJL 3AT0A 3EBAA 4WU5A 2B7DT 2ENSA 2MTPA 5BRZA 5TE6L 1QBLH 2BNUB 3A24A 2CUAA 4L05A 4LRNH 2DQCL 2VLRB 1EUTA 4V1DE 5D1XC 2WWMD 3K74B 3S36X 2H0PA 2JKNA 1DBKH 2V2XB 5KW9H 4J23A 2G2PA 1VCBC 4A2EA 3HRZA 1I7TB 1MIMH 2X4NA 4GBXD 3D85D 3BGFB 1WA1X 4YXHL 4BFBD 1G6RB 4Z7AA 4QD2E 5I17B 3EYOA 1RUKH 2I60L 2CJ3A 1P6FA 1A6ZB 2BW4A 2E6JA 2YZ1A 3O9WC 3HHRB 3ULUH 1AD0A 2FECI 3SD5A 1S7XA 1G7JB 1AXSA 4X7DC 3FTYA 4WHYG 3LS5L 1UD6A 4PCSA 2HFFB 4ANWA 4FFWC 2Y3NA 1CS6A 4QTIL 4NN7C 5D71L 3CQFA 5IOKA 2QVFB 1HZHH 4I0KA 4RMRA 3BE1H 4U0RB 3S96B 3UYRH 5B3NA 1KJVA 4X9GA 3BOVA 5EIIA 1W9XA 1A5FH 3GMOA 4RAVA 3BAJA 4BYHA 1QTYT 5CGYD 4EN3D 4UV7L 5E56A 3CK0H 1MFMA 4PJGA 3P2DA 1T6BX 5DWPA 3UTOA 2Y7QB 5FPIA 4UZSA 3S88L 4G5AA 3ARFB 4KX8A 3KXFA 4XP9H 3R0NA 2IGLA 3AZUA 2NSXA 2Z91B 1T21B 3LKPA 4EN3B 3JYCA 5BZDA 7FABH 5L2KE 1TSHA 1A1MB 3OB0H 2Q7AA 3RWGB 3HLAA 4YVNA 5C3LD 4QHNB 4X6DB 3FCSA 1OXYA 4ELMF 4GRLC 2WKOA 1ZV9A 3FXIC 3FOLB 1JE6A 2X9XA 4G6KH 4AYEC 3MJWA 2K6WA 1EERB 2E7DA 1AH1A 2XBDA 2EUZA 4DGUA 2DLGA 1CGTA 1OF2B 3KJ4B 3RYMA 2IFFL 1MFCH 3VFTB 4C59B 2CG9X 3U0PB 4FFYA 4NUPA 4PJCF 5J8OA 1JSYA 1JXKA 4M61B 2ZSWB 1TTBA 4OLYL 2HFEA 1HNGA 1KYUA 3JV6A 3LB6C 3DX8A 3TVMC 1E8YA 1UOWA 4P5TB 2IWGA 5F7BA 2XPZA 4LKCB 1IM9B 3C09B 4G9FE 1EEUA 3BPCA 5I8EA 3RILA 1J9RA 3BAYA 2C9QA 5EPMA 1HEZA 4PREB 2XVLA 4XHJD 4R5VA 1H19A 4DQOH 1M9WA 4AJYV 5CZVH 1A7RL 2BSRA 5SWQA 2PPFA 1BVOA 2OKMA 3VFWA 4CVXB 3QCVL 1YAZA 3BPNB 3QJQB 3VG0H 1MQKH 2DRUA 2DIBA 3A5VA 3MUGA 2OQJB 4RAUB 1KLGA 3HC3H 4R26L 1YNLH 3DX3A 3SDYL 5GS0D 4IRJD 4KJWC 3EHBB 4M7KL 4RZCA 2AEWA 3OPZH 3CSGA 3N9GH 2O4EA 3WDJA 2OTPA 2GC7C 2HKAA 1IAOA 2KZKA 3MV9D 1VIWA 4G11A 4UZUA 3BH8A 1REIA 3VSVA 1R5IB 4P06A 5ILTH 4BSWA 2ICEB 1MVYA 1MRCH 5EO0B 3WS3A 2FJHB 4E42A 1GGYA 1ZT1B 2Z6FA 4R26H 1NAMH 5GRYA 3SDYH 1OAXH 4BD4A 5BOZG 1FL6B 2EZ0C 1OAUL 4ZNCD 1CLOL 3DGGB 1H8LA 2JSFA 2VXVH 2V2WB 2JI1A 2MQGA 2WXMA 4HCIA 1FL6A 4AH2B 1PGRB 4B0MM 1Q8MA 5GJTL 3LZLA 4LKXB 3KVDD 1OIOA 4FQQB 2EEXA 4Y9CA 4PP1D 3IT8D 4AIOA 2X38A 3HS0C 2C9AA 2QEJA 1N0LB 2PCFA 4G7SB 4BSWB 5MEQA 1RH8A 4KNQA 2XV6B 3TYGL 4P4KD 1I3UA 3VFUB 1KJ3H 4OI8A 2VXVL 4YOKA 4P57B 2B2XL 2JJTC 5FYKL 1FYHB 1KENL 4R2GB 4JY6A 1OAZL 4FZ8H 7PAZA 3THMH 1WIUA 1TO5A 3WNMA 3UTSE 5TFSH 2W07A 4CMMA 4GKZA 3QUZD 5CNHA 4JPVL 2IH3A 2HPOA 2IWKA 4N2EA 2C1OA 2XX0A 3KPQA 3CVDA 4FTVE 1BFVH 4JFZL 5KVEL 1P7QB 2IG2H 3VFPA 1TZIA 2X4UB 2DMBA 3A67H 2A38A 5D72L 4PJ8A 4JHWL 3IMUA 1K8DB 1WGOA 3L16A 3ZTDC 1W8OA 2ZWZA 2ICWJ 2HYMA 4POZC 2F18A 3U1PA 4H1LA 1JD7A 1I7UB 4D8OA 5LGHL 2MQ3A 1ZPLA 5BS0D 3NJVA 3CZFB 4YE4H 2BFVH 4JFZH 5FUCE 3TO4C 3WG7B 1PPIA 4H0LC 1AE6L 2BP5M 3NFPA 1DYZA 4KXZI 1OP3H 5KJRL 4XNXH 1NCWL 3ORJA 2CR3A 1TENA 1QZ1A 1E8WA 4MAZA 5T3ZH 1KIQA 2HH0H 1U92B 2JCCA 4AK1A 2V5MA 3ESPA 2LV4A 2O61A 4FQLL 2D31B 3SGKC 4M9OA 1FLRL 5L2KD 1NCDH 2X5PA 4WO4B 4ZSOE 1GZPB 4NN5B 3ZE1F 3L4WA 5A7BA 1JZ2A 2YFNA 4MCNA 3ATDA 3SPCA 1S7UA 5IB4B 1I8IA 2A0LC 5E8DH 2PPAA 2Y7NA 2ZXWB 5C0AA 4U1IB 4WIQA 1QBBA 1BQUA 1DQJA 4KUCD 4N0UA 5EBMA 4B6ZA 4HOZA 1FUNA 4D2NA 2XZQH 3ESVF 5FO7B 3BWAB 1I1YA 2YBRA 2YN5A 1TU2B 2EYSA 3OZLA 3QEHB 4L29A 2BWIA 4RRPG 1CE6A 5I23A 2F74B 5JOPE 4HU8A 3U0TA 1MW1A 4Q9BA 3MV8B 2P5WA 3L4YA 1U8HB 4D7PA 2DQFA 5IB1A 4LRNL 4FYRA 3M7FB 1RZPA 1CTNA 4NZUH 5E6IC 3FN9A 1QWUA 5DXWA 4CADA 1RUQL 2WCGA 3P0GB 3WJMA 4EUPH 2PWFA 3MXWL 1A25A 1KBBA 2G9HA 3O6LL 3WFDL 5IWLA 2HLFD 2OSXA 2VXQL 3BUDA 4N1HB 3D69B 4MHHI 3TT1L 2L0DA 3VSUA 1IM3A 4Y4FB 1T1ZB 2FYYA 1NCCL 5LCVL 3GTNA 3L54A 5A2JH 3FQ1A 3QQ3A 3QG6B 4OAWA 2ZONA 5I1KH 3FOMB 1F11A 1EXUB 4Y5VC 2P5ED 3SGJA 1DDHA 4DGIL 2R59A 1OAYL 4Y7OC 3Q5TA 1PLGH 4YWGH 3ZU8A 2EDLA 1BD2E 1BM3H 4MZ2A 4EI6A 2F54B 5C0JB 1FN4A 3F7QA 5MENE 1WGVA 5ABZA 2YN3A 3UL4A 1G43A 1N5YL 4FNTA 3GB7A 1CGSL 3Q1SL 1B3IA 5DA4A 3UC0L 1A3QA 1D7BA 5JIQA 2HG5A 2ROYA 2GAZB 3NCMA 4EIBA 2XWJB 4GQRA 5HTSA 4TULL 3TCLA 2FJGB 3O4LA 4I0PB 2X05A 4MCZA 3NPZB 4DGVH 1S7WA 2IDUA 4XP4H 2BSTB 3POCA 2GG1A 3G04B 4BFGA 4UTBH 4Y4FC 3IGAB 4NKDB 4QRPB 5IVXE 4D3CL 2DEXX 4N9OB 1GGUA 4JFOA 3LHPL 4KHXH 4U1SA 4BQBA 2H9GA 1NIFA 2GITA 4H1LG 4FFZL 4DKAA 3D18B 4TPRH 1IGIL 3GRWH 3VDAA 4G8GA 3ASOB 4NOFA 2OXHA 1OSZA 4APXA 4HLJA 4B3EA 4WDIA 2IAND 4Y2DC 2ADIA 3SE3C 4ZD3H 4JKNA 4KX9A 1D5IL 1E4WL 4YNYA 1H15B 3TIDB 5BV7L 1BPLB 4BE5A 5E8NA 4ODTH 3D33A 5AG8A 4FEMA 4QT5A 1AGEB 2X40A 4UM9A 4UNTA 1OGAE 2AXFB 4HXAL 5KYYA 3DX2A 5KZCD 3R8QA 3N1MC 4N8VG 3I6KB 4MBOA 1UKTA 3RNQB 3AUWB 1XH3A 4ZUUA 3S6CA 4OLVL 2BSSB 4P2CG 4P05A 3WLWC 4G82A 4BZYA 1LO3L 3VFNA 3CZUB 4IQHA 1BMGA 4G43A 2XXCB 1P5UA 5BQDA 3WN5A 4S1DD 3KGSA 4YHZL 3HNSL 4AGNA 4D0CA 5MENB 4IBVA 1U41A 3FRUB 2IBGA 4K73A 1YC8A 3AW5A 2J5LB 4LLAA 2HLAB 2A73A 4A7GA 1RUAL 2J1ZA 1JHTA 4MD0B 4E41E 5LXGL 2VRKA 4YJZL 3O3AA 2RAMA 4LPYA 3FULA 4K4KA 1MRDL 3D06A 5EEZA 1S7TA 2R1YA 2FEEI 4R7NB 2AGJH 4OCMC 2VZSA 3MFGB 3VE0A 4C58B 3KWWA 4K8RD 1L7IH 1LHZA 2BXZA 2IIJA 1ZSDB 4F33A 3CSYB 4PREA 1ZHNB 1JF5A 3TBVA 5C97A 4WW1B 4ZXBC 3LNIA 4EUPA 1PZ5A 4LOUC 4JO5A 1U0QA 1RHHA 2A73B 3FNKA 4K3DH 4MNGE 3J8F7 4HXAH 3CFEB 1WBXA 3CDZB 2MKLC 4GSRA 4P57A 1BMWA 1BCIA 2WQUA 1U8IA 1ZT4B 1F97A 3GSNL 3MRBB 1JNJA 4UM9D 4DTGH 2P5EB 3FQTA 5KAQG 4TQEL 1QI5A 4WI3A 1AOZA 1MHPH 5EA0L 3EGDA 3ESMA 5IEKA 1IQWH 2ROXA 1M53A 1HXMA 4LRIA 5GS1C 4D8PB 5GHWL 1BAGA 2JWYA 2A6JB 4DK6A 4OZGB 1DVQA 2Z9TA 2V3EA 2DQIL 1CL7H 3WIHA 2IPTL 1YYML 1EEYA 1MFEH 4S1QL 3LDBC 3NIDE 3VWJA 2Z92B 5BPPA 1KELH 4HHGA 4LLWB 5ITFB 1DE4B 3HMXL 1I8UA 4TS6A 2AMUA 1QD0A 2FLBT 3CQQA 1J8HB 3VGGA 5ISZB 4GY4A 1AZVA 1FNSH 1QEWB 3MRDB 4QRRE 2Q20A 3RTQA 4B7IA 3O8XD 3NESA 3RJQB 1G9EA 3IDNB 4TUOA 4FL4B 4HD5A 3BGFC 1CD0A 5DS1A 3PHSA 4QIRA 5B3JE 1OANA 3KBFA 1KCBA 4OLXL 3GM8A 4W9GC 1FNEA 3DGCR 1AGFA 1EPFA 4AVJA 1BMZA 3GSUB 2OR9H 4OU3A 3HN8A 1YY8A 2NX5B 4UTBA 5E8NB 2ALWA 4XBGA 1XF3B 3DETD 2DQIH 4M1GH 2YZ8A 2IDQA 3EFDL 1UXWB 2VDMB 3MNZB 1F58H 5ANMB 1LD9A 2Z8VC 1UM6L 1W80A 2BCKA 5AOZA 2CRIA 1OCCB 1JWMB 3AGWA 4TTDC 3LS4L 3TURA 1QSFB 5HBBA 5I8EB 1B4LA 1TEFA 4MS8C 2DL9A 3GLZA 4Z76A 5ACLA 4MASA 4WHCA 1CFVL 4NJ9L 1ADWA 3C6LD 2PN5A 5SWZA 5BVJB 1TZ8A 1ZTXL 2GJZA 2BZDA 1XF1A 5GS3A 5KG9A 5I1DB 3U7WH 1AY1H 5K9QG 4KJPC 1IFRA 5DVNA 2ICWA 3O41A 5B7EA 3S97C 2X42A 4IBQA 4HC1H 4PRBA 2E9BA 1CE1L 2GSMB 4RMTA 2H5UA 1OTSD 3GF8A 4M56A 3DUSB 3GEWB 4IKNA 4IRJA 3SJVB 2GJRA 3VI3A 4BA0A 2VT0A 2ENQA 1D2PA 2AJSH 4N24A 4UMGA 4YL4A 1XD0A 2G9HB 5E6IA 2BW5A 3VXSB 4JQVA 2DTML 4C83A 4IK6A 5GRJL 1T6VN 2M2DA 3IM1A 2NXYB 3TJHD 4MNQA 4JM2B 4KRPD 4P2RB 5DQJA 1SEBA 3Q01A 5KVDL 4AL8H 4Q56A 2I5YL 1LMIA 2WANA 4PGEA 4EI5A 2DB8A 5ID1B 2EH7L 4LF3B 3M8OL 2X70A 1DQQB 1JHKH 4IHOA 1UD3A 4YDIH 1PD6A 4YFLF 3ARGB 4PP2A 4Z7NB 1KTCA 1WUNT 1INEL 2CAKA 5HDLA 4MZRA 5JXED 3E6HB 3FF8A 3WD5H 2JKRM 4YIQA 3ZY7A 4YHML 1E9QA 2X28A 2XN9B 3MYZA 4GQPH 1YN6B 1S7RB 1ZHBA 1A6TB 3F85A 1A9EB 1MUJB 4PH8A 1ULVA 3A23A 6CGTA 4YO0B 2YEZA 2DQFB 4JLRB 4OT1L 3TF4A 1QSFE 5BZZA 1XCXA 1X5XA 4WSGA 4XOCA 4OM0L 5ESQB 4HP5A 4LSQH 4X5LA 5CEZH 3E1F1 2QQKH 2XV3A 2Q0ZX 4XO3A 3IF1B 5AD0B 1GCFA 2XOTA 3BWAA 2PYFA 2B20A 1NGQH 2BS8A 3RY6C 3AREB 3ME0A 1KWKA 2B5IB 1DUYB 1EEZB 4DKEL 4I48A 2P8LA 4I2XA 4ONFL 3TN0D 1LE9B 4J6RH 4NZRL 1A4JA 1IB5A 2WQSA 4KRLB 2GHWB 3OC8A 1I53A 3G08A 3DI2B 5J1SC 3MRMA 3RWHB 2H2PD 1JVLA 2BS9A 3MSPA 5C6TH 1E43A 1CGXA 3VB9A 1QNZH 1ZANL 1RMFL 4IOFD 4HCFA 3SE3A 3UEZA 1XF5B 1Q9OA 4NKOA 3VXTA 1YEGH 1KV3A 2HT2C 2YD4A 3GINA 1DBJH 4KTEH 2BH0A 5A2KH 3VD9A 3LKNA 4NO2B 4YDVA 3ZE2E 5C2BH 2C5DC 3MOAH 4ZODA 1MHHA 3PU7A 1L0XA 4PCTA 5CIPA 5F9JA 4KRMB 5IHWA 3WTTA 3MRKA 5G4NA 2IPUK 3S98A 2V2TB 3CDFA 4G5ZH 3N50A 1F4YH 2BDNH 1CD8A 5C9JA 5DHXB 4YHNA 5E9DE 2CRMA 3CTTA 2X0UA 1AMYA 1KLFA 5FA4B 3ULVL 3V7MA 1JTPA 2CGRH 3NIFB 2JTDA 2EEBA 1JWMA 4NRYA 2VE6B 4NZDA 1DQLL 1BM7A 5AW1B 2XNAB 1J1PL 5DD1H 5AVSB 4GKLA 3MBXL 4JZOA 3FFCD 1U4EA 2F53D 2IH3B 3IDGB 4Y19A 3LXUX 4GKZB 1MN4A 3AQYA 4B7LA 5JXAL 4WTZA 4CW1A 4QRFA 2WLHA 4MJ6B 4JQIA 4RA3A 2FNBA 3ISWA 2HTLD 3CHQA 3L7FB 4XCCH 4FCAA 1NEZA 3KS0J 4Y1AA 3T6QC 3BCDA 1P84J 1E2WA 3G5VB 3G6JF 5JPMB 3ROLA 5J11B 1X4XA 2B2XH 4U1JA 3CUPA 5IHZB 4Z18A 3BQUA 2J2ZA 2DY2A 4R96B 3UAJA 4Z5RB 3GJFH 3L45A 3D8MA 3NSYA 4RFEB 5AVYB 5AOIA 3UTQA 4XAWL 4PVBA 2FRGP 2EXYC 3QC5X 3T0EC 2LW3A 3ZGIA 1S3KH 4BV1A 2OMUB 2UVEA 3JBG7 3DROA 1MCCA 3SDDD 3FONB 1KNOA 4FNRA 1NMBH 4AQAB 2BVOB 2EDWA 4Z0BH 3FJTA 4A7GF 4WQOA 4WWKA 4ZMAT 1FORL 1UM5H 2DLEA 1TZHA 4YSRA 2V9RA 1KCSH 4G1EB 2WK2A 3WFBL 3GJFA 2HP4A 2WINA 1Q9LB 4KH2A 2I7OA 4GRLB 3LPPA 1ET7A 4MQ7B 1SYSA 4E5XB 1MW2A 2YOCA 4JG5A 4G6MH 4Y2NA 5K1VA 2H0JA 4NX0A 3NIDF 4PP1C 4LBEA 3KBEA 2WKGA 3N42B 2QTEA 4HFUH 4ZSOB 5BNXD 5DUBA 2NY6C 1TQUA 3QXVA 4S10A 1WAPA 4CMHC 2O93L 3APDA 3GMPA 3ARBA 3MLZH 3QUXA 3GNMH 4HEME 4UT6H 4X6FB 4HHAA 1MFDH 4LO9A 3M17A 4A37A 1SUHA 2YRBA 4HS8H 1EAJA 3GMLA 2X09A 3ZQWA 5FECB 3COOA 2W88A 2K6YA 4HCRA 2OCCB 3VQ1C 1TTUA 2WQ8A 2WWKT 5F71A 4MMZC 1UWXK 2J20A 4A39A 3MZGB 2BOCA 4MD5A 4OLXH 3DNKA 4AZUA 5KSBE 1MSPA 1MFAL 4QF1B 1ZVYA 5H4ZA 1GJWA 1HNYA 1YNTB 3TBWB 3G5ZA 4Y5YC 2D7OA 3ZR5A 4R0LC 1LTXA 1TYEB 3HI5H 5EZOL 4JREB 1MJUL 1HIML 5DURB 4Q4IA 5DMYA 4WO4D 3LQZB 4HDIA 5CCHE 1MFCL 2BNRD 2PO6D 3PWLA 4ZRGA 3S8GB 4B9YA 3WNKA 3TU6A 2D4FA 1Z5LB 2O5YL 3H42H 4MA3B 4GOSA 4UV4L 1AKJA 3UIZA 4F9PA 3IYLW 1VACB 2NY0B 4YXHH 1DSFH 3GIZL 3GIVA 4PJEA 5LDUA 3BW9B 1ZLUH 3CC5A 5E03A 2IOMA 3U82B 1KY7A 3LKNB 4JUTA 1BLIA 4JFSA 4NO2A 1NKRA 2H0FA 4WK2B 3MRCA 1MFBH 3D09A 1KCUH 3QUXD 4OM0H 1WH0A 2N1KA 2WYIA 5HHPB 4Z77B 4JO4L 2I32A 2Z64C 1WFNA 5KTEH 1BA9A 3LHPH 3ZHNA 1F86A 1AQDA 1OM9A 3WHE0 4ZFFA 4X8XA 4WK4B 5DQDH 4KFZC 4HIQA 2EIDA 2DMKA 4G8EB 3MBWA 3JTBA 5EEWA 4OI7A 1THCA 3X12A 1OAQH 4OJDH 4AGOA 2HFTA 2VM9A 4OTXH 4YSOA 1JYXA 4QAWA 3SBWC 4DO4A 2VB5A 1NZRA 1T66C 3BN3B 1UQSA 4YDIL 1OB1B 4R5XA 1IC0A 1TNNA 2LOEA 5DZNA 3GMMA 3QVAA 4JKPL 2I25N 5J6SA 3GBNL 3HCVA 2HUEA 4HS3B 1W72H 4FS0A 1EGJH 2ZKHL 4AZ8B 5F7LB 3TPUA 1D5XB 2VGLM 4LLUB 1TETH 2NNRA 1RFDH 1MCNA 1DBKL 4HWEH 1I3GL 3ZX1A 1UGKA 4GT0A 1CDYA 5T1LB 5GGQL 1ZGLA 3TLRA 3PRZA 4HU2A 1UATA 3ZYOA 4LSTH 2GEQA 4XVUC 4JRXB 4OLZL 5DK0B 1IFHH 1BQLL 3Q5YA 2OULB 4GAFB 4K0OA 3U1SL 4LGSB 3NZSA 4WI8A 3EBIA 4CU7A 1D2OA 1C12B 1VEMA 3QDJD 1F3RB 1MWAA 2AQTA 3MV11 4EI5B 5ID1A 1YDPA 2ZYHA 3BPLB 5ESQA 5HI3C 4I4WA 4P59H 15C8L 4EXKA 3F7YA 3GSWA 5BV7H 1X9RA 4PJXA 1AXTL 3GXNA 2VQUA 2G3MA 4H8WL 4DVBB 1O9WA 3L3DB 1JPGA 1YJDH 2K4AA 1UFUA 4G9DB 2X89D 2YS4A 3R1GL 3TBYB 5B3JF 1Z9SB 2BY1A 4WU7B 1ZSDA 1GJUA 1IGCL 2FO8A 4C4UA 4E41B 4YR6A 1FGVH 1CDBA 2NYYD 2PW2B 1P7HL 1KBGL 3ZN6A 1JHLL 4OCNC 1CU4H 4P59L 2ATPA 2HX9A 4W9EC 5E2JA 4RBPK 1RK1A 5IIEA 1RUAH 1L9NA 3NCBB 5MP6H 2FQGA 5LUMA 3GZQA 5C0CD 5K93A 3T0VA 5HDBE 2Q8BH 3VGHA 4D3CH 4FQXC 3NQKA 2BO0A 5CEZE 2AJVH 4QCIB 4JRYD 3MV9A 1J0HA 4C56A 3JWNG 4MLSA 2RQEA 4ZUTB 4NHCH 4XP6H 2I27N 3SPJA 5A2CA 3IETB 4PRDA 3FQUB 2YAFA 1E28B 1FH5L 3RUGA 4K71B 3SKOA 5DMKA 1KYAA 5GXBB 1YNTF 4KVCL 4M43L 1JV2A 1LNUB 4JRYB 4YSSA 1R3KB 3MGOA 4LVOC 1FVEA 3GSXA 4LCVA 4BSJA 2HKFL 5DRZA 5DRXA 3SDAA 3MUY1 4XCNA 2UZYB 4G6FD 3JWDH 4X50A 5CZXD 5ALCL 2NNCA 1J86A 1UH4A 3KDMB 5IGXH 3EYFA 2C9SA 5FUZH 4YXLH 3HE6C 2OAAA 4PRPE 1PF3A 2Y69B 1LWHA 4N90D 2B0SL 3WI9A 3ZO9A 3AU0A 2OXHB 4J3WA 4X6BA 4APXB 3O3BA 5HGHB 4NYLB 5D1XD 2Q8AL 1AANA 1UUSA 5LDSA 1COBA 4QHKJ 4QKXB 1FP5A 3AC0A 2H6PA 4PQXA 1N6QH 2K7PA 4C57C 5HGBA 2G5BB 2BRQA 1ZIAA 5FGCB 3VFOB 3BYYA 1TZIB 5AB9A 3LCYA 5DZPA 4MMZA 3TFKD 5JPMA 2TAAA 1WT5C 4MJIE 3RGVD 3VFVB 3ILEA 4DW2H 3ULVD 3G04A 2EYRA 2JKLA 3CN1A 4XN8A 4BFFA 1SF3A 4L4JA 1AXIB 1DR9A 5IBLC 4EIZC 1X4ZA 1ETA1 3QZLA 3QPXH 2V8LA 3MV7D 5D55A 3U7YH 3RFZB 4MA8L 3MRNB 1FBIL 1C16A 4M48L 5DVPA 1B3JA 3X11B 3RWEA 2B0SH 4OFPA 4YSDA 4HIEB 5HI4C 1RZFL 3MLYH 2OSLB 1PY9A 5BW7C 4LOFA 1DBML 3GSQA 5AB0A 43CAA 3V4PL 3FFCE 1CFSA 3FTZA 3BMVA 3ZHDA 1FIGL 3DKHA 1WBZA 4AC4A 2XN9D 5IVXF 3DVFA 5DUJA 1QWHA 3FMGL 2ESVA 3CX5K 2E76C 3MAWA 2DI7A 5FYJD 1B6UA 3PIQA 5I8KL 2ZE0A 4LAQH 5KOMC 1MJJA 4HUWA 1QLRA 2P5EE 5F9WC 4ODBD 1YQ2A 1UCBH 4ZW3A 4P5KB 2HH0L 5F9AC 4L0YA 3EYSL 1ZHNA 1CICB 2HN7B 4DH2A 1AHMA 2KL6A 3UYPA 1V8HA 3CX5J 4PGCB 4R2GC 1R9FA 3FUDA 3HFFA 4PJFB 3F64A 1SGKA 2X2UA 5M95B 3S8FB 3BIKA 5KSAA 3C5ZD 1J05A 2DKSA 2ZOKA 4UOW0 1CIDA 4UUJA 1GZQA 3NSXA 1ERNA 3VFSB 5EU4A 3U9PH 2B16A 3BGAA 1M2VB 3OC5A 1NAKL 3C09C 1P7QD 4FFYH 1V7MH 2J8OA 4YUEL 4QRRB 1DSWA 1XHHA 1A8ZA 5T33H 4CN6A 1YEJL 1GIGL 3SHSA 3ARBD 1AZBA 3I9AA 4PJBA 2VERN 5FO9A 4TSCH 4L48A 5FOBB 5I71B 3ZKXB 4TL4A 5ECGA 3K71B 3R4DA 3S35H 4XNMA 5B38B 4AXWB 3L3IA 1JZDC 4GUCA 4DN4L 2YD3A 4H20L 2XWBB 4YR6B 2HSIA 2YPLB 1YEEH 3CC1A 4NM8H 2A6KA 2EE2A 5E5MB 2XWCA 3KPMA 4YHLL 2FB4H 3OZKA 5BXFA 5C6TL 3STBA 1TR7A 2ADFL 2IAMB 4OLWL 2XIIA 3RX5A 3PREA 1MJ8L 3LH2H 5TF0A 4ZO9A 3O2DL 4U3SB 4YC2B 4GRLD 1PX4A 1BF5A 3HZVA 2YKKA 4G8IB 3B3IA 1EVTC 3UJTL 3MRGA 4JY4A 3TS8A 2VLLA 1ETJA 3L95A 1WHOA 4PGDA 4R4NC 1M6UA 3K1DA 3OV6A 2X44D 5C07D 5FR3A 4FG0A 4JRXE 1AS7A 2Z3FA 3FO2B 3OSVA 3FUIA 4NS0A 4WWPA 5D9SA 3UCRA 1KDJA 1V55B 4H1LB 1HL9A 1AIFB 4Y89A 2FJGA 1NQBA 2OTWB 3BVNB 3RWGA 7CGTA 2VLKE 2K45A 5DJYB 3ZPDA 1D6VL 4XPTH 2JKSA 1JIBA 1MQ8A 2YAQA 1IBYA 4OZIF 4LGRB 3SODB 1DANT 3QIBC 1OTUD 4L8SB 4HIJA 4TKWA 1M56B 3M1OA 4FQHB 3ASWA 2XBZA 1FGNL 3VFOA 2C1OB 4XPFL 3U2IA 5TFSL 3RKPA 4FNPA 2AKRA 4PCKA 3RZCD 4Y19D 1T7ZA 4RAVB 3H9SD 3TIEB 1A8JH 2RALA 2M26A 1DJYA 5I8CA 5LGKA 5BQ7A 1BV8A 3D6GA 3DSNB 3QORB 5ESVA 5D7LB 4H8VA 5DD5L 1E6JL 4C54A 3KPSE 5IR1B 3H1ZA 1RP8A 5ANHA 2YRLA 2ZP0T 3X12B 1J0IA 4HJEA 3D51A 4DAGH 5A2LH 2J73A 3HBQA 1O9ZA 4I3SL 1X5AA 5HDBB 1SEQH 3ELAT 2HJKB 3FU7B 4XRCB 3K6DA 1QSFA 2VXQA 2FZ3B 2AK1L 2KLSA 2DWEB 3TBSA 4EN2A 2AJUL 5F3BA 1U3HB 1HE8A 5IFHH 2L8AA 1U8OB 4LSDA 4YHYC 4BIKA 1J8SA 1ZY9A 1ET8A 1DBJL 1KXTB 4KTEL 5IMLB 4WK0B 5CLYA 2ZX6A 1OB1A 1AS6A 2EIKB 5TD4A 2YA2A 5EF2A 3RKDC 1A9EA 1MUJA 3KYOA 5GGRB 4W70A 5J06A 4KDTC 2PF6A 3SCMD 2EDHA 5JR1H 2WBWB 3L1OH 5D2NB 4PJBF 5JW4R 1TLKA 5E1AA 3U30B 4LCWD 2AJZB 4O2CA 4L29B 4L8BA 1K85A 4G6KL 1I8MB 3PAVA 4TNWF 3ZDYB 2UYLA 3BH8B 5EDSA 1NCIA 2W0LA 5JORA 3QUGA 3QQDB 1ECYA 5E5UB 3W0WB 3D4GA 1ZWIA 4XNUL 1ZOXA 4QTHB 1N67A 3W9EA 5HDQL 4LSRH 3X2QB 4ZPVB 2LR4A 3BP5A 5CWSA 3O11B 3WJMB 3B5GA 1U8PB 1ROWA 4M1GL 1FQ9C 4HFUL 2E6PA 3GSWB 1CK0H 2OL3A 1NFAA 1GHFH 2X4RB 2YUXA 4BWWA 4I4WB 4TLKA 1Z0MA 3QDJE 1CDHA 2KZBA 2GVYA 5DMGD 2FEJA 2X9WA 3ATBA 4GRWB 5CLTA 3OJDA 1LEIB 4RDBA 1E9OB 2YGNA 4MB3A 2BM3A 1X5ZA 3GMPB 4UDTB 3OG6B 1VKXA 3IJ7A 3QG7L 4M6NL 3PWJA 5EBGA 2GIMA 4J4PA 2XG4A 4OBRA 4POZD 3W2DL 3TF7C 1A6AB 3BKJH 5I75B 3UBXB 4NHUB 4Z95H 5DYFA 1FHGA 2VZTA 2OTWA 4PBDA 3S3CB 1GC1H 4AL8L 1M05B 3A6CH 4L23A 4NNXB 2BVYA 4JK0D 4WHDA 35C8L 1TDQA 1W0VA 1O5DT 3L2NA 3MCKB 4Y0GA 3C8HA 4LP5A 2CD0A 3ILQC 4G6AD 4HWNA 3FCSB 4XNMB 5FUOL 1XZ0B 1I7ZA 5ABDE 2HVKB 3Q13A 5HJGA 2XY1A 4S0SD 5B4MD 1UVQA 4XZUA 1CLOH 5D8JL 3QPXL 2UV3A 4OD3H 2EICA 4Q9RL 4MDIB 2NXZC 4G9FA 5FEBA 4HJSA 5E6YA 4KK8C 3K2UH 4J3UA 5JLZA 2B1HH 2VUKA 3B7YA 1SXZA 2YMTA 3NIGB 1UA6H 3AXLA 4EBQH 5JHBA 2EDJA 5E2WL 5CEYB 5TJWK 1E8ZA 4OLUL 3V9EA 2JVUA 1T20A 3MYJB 1ED3B 1QO3B 4WAFA 3SE9H 3QULB 3BWUC 3BVTA 4PRPD 4QXUL 5DLML 5CFHA 5CJOL 4FX5A 4PJFA 2PCPB 3MRCB 1LDSA 3IJ8A 3MMEB 1UOLA 3BESR 1G9ML 4YHYB 3HG1A 4YDZA 3KPNA 3D3VD 4XP1L 3I50H 4HHWA 5EHFA 2EINB 3VNYA 2BOBA 5CJ8A 4JFHD 5DHEA 3STZB 1P0SE 3CU1A 5BVPH 4PJ7B 1W72L 1N8ZB 4OCXH 2GTZA 2WVVA 1YLBB 3PL6C 1QBML 3BO8A 4M43H 5F89A 2X6VA 2R1XB 4R3SB 3VWJC 3F8UB 2Z1PA 4WFGD 3X3GH 1L0QA 3RPIA 2F58L 3F2LA 2QVTA 1BFSA 2P8PB 2NQ3A 2BRRL 4Y2DA 3CCHA 1KGWA 1YO4A 5E9DA 2RQ8A 4FI8A 4HF5H 4U31A 4GIAA 4L4TB 4YGAB 4DT2A 3P4MA 4FTVA 1E5CA 3B4NA 1KMGA 1U91B 4L5FL 5F3HB 5JHDE 5CN3A 3VFWB 2E56A 3JZ7A 4OJEH 1ES0B 1NMAL 4Z7OE 3L9EA 2MPAL 5E8EB 1WC7A 3VQMA 1I3RB 3CZGA 4F7MB 1I7RA 5EC2B 2KBGA 1A4AA 4QYAA 3QYCA 2EDQA 1F4HA 1A6UH 1T1YA 4JPKL 3IJEA 4A66A 1SHXA 1E4XH 3QUXB 3C5SA 4OZFB 3T3PE 3BIAX 2LLNA 3H0TB 2QPDB 2I07B 1DDHB 1HKLL 3MNMA 4M6ML 2MPAH 4HH9B 4OVVA 1ZVSB 3HMXA 1YA5A 1MCWW 4HG4J 4RAUA 3SDCA 3S7GA 2PR4L 4LU5H 1GKEA 3BDBA 4L8CB 1CLZH 5E9AA 2X4TA 2BIIA 5TQ0H 1C5DB 3WEAA 2Q86A 1F90H 3DHMA 5E8OB 4OIBA 4KGJA 3D69A 4UINL 3VD5A 3DPBB 4K8RC 2BRRH 3LEVH 3L9YA 5HYJA 1O6VA 4JPWH 5GGQH 1NCAL 1NGZB 1XGTB 4HJGA 4Y2DD 1VFBB 1LILA 1UXSA 4TL5A 3DJZA 2EE9A 1IEBA 3O8XB 1NTDA 1IGFH 5DEZA 1K4DA 1HX0A 1JPEA 5CKAA 1XIWC 2V5TA 2IF7A 2X9ZA 3G5YA 4I5BB 5EUOB 1CL7L 3SBQA 4DGIH 1ND0A 4XH2A 4OD2A 1KZQA 2H9GB 5EEXA 2M1KA 1ND0B 2CCWA 2IO5A 4XNZB 4XX1G 1OPGH 1Q1PA 3K4AA 1EFXD 4KZDL 4DFHA 3EJPA 1OWRM 3WIAA 2H1PL 1RPKA 3FQUA 3O6KH 4GH7B 3K0YA 3ZL4H 4F8TA 15C8H 1MAJA 4KPHH 4MNGB 3DV6A 3KG5A 4XC1L 3BRFA 1GAFH 1Z5HA 4Y16C 1QW8A 2BZ7A 2AVFA 5BZDB 1XT5A 1MVUA 3QZPA 5JQ6L 5L9DH 4IOIB 5D1XA 2WTRB 4ATWA 4XMUA 1CQKA 4MWFB 4X4ME 4PS4L 2WBJD 3GMNA 5K59F 3D3VB 3C6LA 4UT7L 3IE4A 3VH8A 5BRPA 1M6OB 3QEQA 2W0FA 1FYTD 2EIZA 5SWSD 1FL5B 1SJEA 2XCMC 5CJQL 5ACZB 4LOUD 4FFZH 2P44B 1LDPH 4JRLA 3LRMA 1PZSA 5K1JA 4DP4X 1ASPA 1GTNA 4U33A 3PDOA 3LMJH 4X9YA 4FF9A 1IKFH 3BZEA 5LQBH 5BZWA 3BP5B 1SPDA 4NNYA 4NC2B 2QHRH 4IOSD 3QRLA 3MRFB 3APMA 1YAIA 1OF0A 4ZBJA 3U2JA 2WIIB 2R0KH 2E7BA 2OCFD 2WWKO 2ZD0A 3KJ6L 4YFEA 4HJIA 5C0RH 2ARJQ 5DK0A 2V7NA 2DJMA 1UEMA 3F7PC 1IE4A 4L4TA 3IRZA 3PG2A 3QR2A 1UB6A 3HB3C 5I1DA 2OI9B 4LU5L 5FC9A 1FFPA 2P9RA 1DVTA 2A74A 2EVJA 1KIRB 4YE4L 3T6WA 1GHFL 5IR1A 4Q74A 1IGTA 4NQED 1PSKL 3RZCB 3OX8A 2A9AA 2CGYA 1G0DA 1QFOA 5DJ8B 5MHSE 4OIIH 1KACB 4WU5B 3VU2A 5IJDC 3SIKA 3BJLA 3WKPA 4HZAA 5GSVB 3MNDA 4F2MA 2B1OA 4TSAH 4WWKC 4K9EL 2XN0A 1IBBA 3B9EA 4U2ZA 4ZI8A 1KWGA 1J9CT 1MF2H 5T5NG 5IT2L 3B6SB 1UD8A 3T6VA 3AB0B 2JCCE 3FT1A 1J8KA 1X6LA 2NY2B 2BNQD 1EEYB 5DJ2B 3WJLA 4X8JA 3HR5A 1HXKA 2VR6A 4YDLB 1MCJA 2VLME 1XEDA 2YPVH 1QP1A 2GK0A 2FJHA 1FJ1A 4GW4A 4HT1L 4APQC 1KCVL 1C8QA 1KPUA 2X6AA 3BPOB 3FRPG 2J3SA 5ALBH 5HYEA 5ISZA 4YZWA 1BX2B 2UXFA 4D7BA 3DVIA 4LSPH 3MRGB 5JW4Q 3T2PA 1HH6A 1MLBB 1YEWA 2KQMA 2XXFA 3L7EA 3OAYK 3QUMB 4KX7A 1A66A 3AWFA 1JZEA 2VMCA 1H5BC 2XZQL 2X4PB 4NQVA 2CCLA 2Z4QA 3ML9A 4KDTA 2WXPA 4XZUB 3D85A 2YPVA 1NOAA 5DUPL 4YZFF 1PLAA 1KTLA 1UA7A 2AQPA 3B9KB 3E8UL 3UBHA 3W0WD 2VN7A 4O4YL 4TQPA 4LSQL 3EXJA 1DVFD 1PTZA 4QLRA 3Q7JA 1BOGA 4G3YH 2QBWA 2VW4A 2E75C 1PEZA 1X5GA 2GUOB 4UOZA 4KZEL 5C07E 3SO3C 4XH2B 4F24A 3UG4A 3B3IB 3RWFB 4XMLL 1NDGB 1BIIA 1CLZL 4PG2C 4YGVA 4AYGA 1OARL 1AHWC 2A0LD 1W91A 3NFNB 3BKML 3QNYB 1U3HD 4YN3A 5FOJA 3PWJB 5DZJA 5F2FA 3I9PA 4M7LH 3TEYA 2YUWA 2XFXA 2YRZA 1B4TA 2J72A 3MLUH 5BS0A 4XPAL 3HBZA 3CV5A 3UJIH 4H5SB 5AW3B 4A7UA 6TAAA 3IS0X 3IU4H 2Q3XA 3WLBA 1MFBL 4LNRB 1F4YL 5F1OB 4YS4A 2VSMB 3CMOH 1JGLH 5DSCA 3V10A 1E5ZA 3H53A 5CO1A 4XB7A 2A6DB 4V1DA 3WKMH 2LQRA 2Y06L 4W9LC 3A4EA 3UJTH 5CBAB 3U6RB 4NKQB 1JPTL 1KNOB 1DVXA 2F15A 4G42A 4HQQL 4HUUB 4AEHH 4Q97A 5D70L 1AR1B 2WAHA 2Y7QA 3L3GA 5D2LB 3APNA 1JPFB 4WI9A 4OLYH 5DC9B 2EIMB 1SM3L 4RFEA 3RL1B 1LEGA 3H9HB 4YHOH 2QSVA 2DBLH 4FL4C 2H32B 5T3XD 4YHLH 3OQ3B 4R96A 1MW3A 1JI1A 3PJSB 1I8AA 3HOGA 2EUWA 1XH3B 1HHGB 3KWVA 3QPQD 4NZRH 1VFAB 1Y07A 4H44C 5JXAH 3DHJA 2OSLA 2P8MA 4X4ZA 1U6AL 4MB1A 4WWKB 2Y06H 2A9BA 2OZ4L 1UEYA 4HZ1A 3NCEB 1GOFA 4D8PA 3UTZB 4M1CC 4XBEL 5T1MA 3QNFA 1N70A 3SKNA 4AIXA 4DP2X 5A2FA 2NY0D 2OBGA 4X5QA 3SCMB 5EN2B 4AYDC 2AABH 5IQNA 3GS7A 1J0KA 5GRVL 4P4RB 1HILA 1E6JH 1SJXA 4NNYB 3BAKA 3D50A 4FKEA 3TO2A 1AI1H 1DN0A 4MX7B 5GS0H 2IALB 4QRTB 4K15A 4N8VA 4N8PA 4AKPA 1WG3A 4NM4L 5ILTL 5T1KD 4PRAB 2BP8B 4JO8A 2QVKA 3RY5A 3FT3B 4B27A 3MRPB 5C0RL 5J1TC 3SDDC 2CNYA 2UZIH 2PPDA 2ILLA 1BYOA 2HCZX 1OHZA 1OM3L 1XBDA 4J6IA 1AHKA 4PJIA 5T3XE 5DRXB 1EWHA 3SDAB 2W60B 1XF5A 1NPJA 2V9QA 5K5YA 3C2AL 4GMSH 4RGOL 4WV1A 3CVHA 1NUGA 5IW1A 5HDRA 5I9QB 5CZVL 5GISL 4OGQC 5DYOA 1OD9A 1QBAA 3LQAH 1QYGL 4H7VA 3DJ9A 3JTSB 1SYVB 4PG9A 3EYQD 3A4FA 3A6CL 2EE3A 1OTUC 4Z95L 3FO2A 4J3OH 3QNYA 2NR6A 1NAMA 1PDKB 2GJ6B 1S9WA 3LHAA 2LE9A 4DTGL 3L95B 4HBCH 4A67A 2P5WE 1R3HB 4ABQA 3IMTA 1ZEAL 4GRWE 3U7WL 1OT4A 5C92A 3I3BA 5DTFB 2QGBA 1AE6H 1JXJA 1T5WA 2WVTA 5ELIA 1ZLWK 1PKQE 4HH8A 2NNAA 3TO4B 2BFVL 3DC0A 3EDDA 4JO1H 5I73B 2ZXEB 4G7VH 4TSBL 8CGTA 2JCCB 3QJHA 1GIGH 2KMWA 4F7TA 5KVDE 5KSBA 4G8GB 2ZF9A 5AAWA 3A0OA 5KYXB 1NGYA 2JXMB 4E9WA 5CCJA 3NH7H 1KIPB 2IGFL 3QJSB 3E8UH 4UIMA 1CIUA 2BZCA 4ELKB 3KWXA 2R2EB 3QZMA 1OSPH 1XB8A 2RHEA 2XZCH 3QAZB 5F1IB 5T1LD 1CLYL 3VW3H 1MREL 4OJFL 4UTAL 3CXFA 3QQNA 1YEFL 5J5EA 2GPZA 5F6HI 3GGWA 3CDCA 3KLKA 1NL0L 2IPUG 2PXYC 1YEHL 5FM5O 4I77L