2A4KA

3-oxoacyl-[acyl carrier protein] reductase from thermus thermophilus tt0137
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
237
Chain Sequence
b'GRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALPLEAWEKVLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGLGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl carrier protein] reductase
publication title 3-Oxoacyl-[acyl carrier protein] reductase from Thermus thermophilus TT0137
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 87
structure length 237
sequence length 241
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a4kA00
5IDQA 3D4PA 3QV1A 3PFWO 4Y6PA 3QQPA 3CSDA 4GWKA 2VRBA 3BTSA 2G76A 3HDJA 3NT2A 4EJMA 1GPJA 4L75A 4ZHSA 1I36A 2QRKA 3L9WA 2RAFA 1YH3A 3ON5A 1NHWA 3NJ4A 1PL6A 2IODA 4R1SA 3BHJA 4KWIA 4DA9A 1AE1A 1SAYA 4JK3A 2I99A 1BW9A 3BMQA 4J91A 5DOZA 1ONNA 2JHFA 3L6OO 4TZKA 3TZHA 2PD3A 3O4RA 1JN0A 4E6PA 5L95A 3IUSA 2BGLA 3IP1A 4A10A 1P0FA 5EPOA 3BIOA 3LVFO 1ZCJA 3TWOA 4PG7A 4FGSA 4ZU3A 4YVFA 3W8FA 1LJ8A 5B1YA 3Q0EA 4QO7A 3GOHA 4E3ZA 4WLUA 3CMCO 1NAIA 1W4ZA 2VYND 3QLJA 5JXWA 5G2OA 2NVUB 1BG6A 3JD2A 1B2LA 2CF5A 4FFPA 3RAJA 1HDXA 2VHZA 5KNLA 2HQ1A 3F47A 4KOAA 1XYGA 1JDJA 4DIOA 1UXGA 2X5JO 3GZ4A 3ASUA 1B8UA 2AQ8A 4QQRA 2HUNA 2O48X 2B83A 1JVBA 2D59A 2G17A 3RKRA 4BNUA 4H3VA 1LLQA 3LT2A 1LXCA 5B12A 1GFSA 3IJRA 1TT5A 3DEYX 4GVLA 4XEHA 1E92A 1R6DA 3JQAB 2PZJA 4NBWA 3KYDA 3PIIA 3BYZA 1N9GB 2FHSA 1NPDA 1Q7GA 3I9NA 4IPTA 1EUCA 3ZV5A 1IPEA 4YEDA 5I8WA 4GLLA 3DXFA 4P4LA 2OP1A 3A4VA 1EE2A 4FW8A 4BNIA 4E5MA 5BNFA 5THKA 1NVMB 1PL8A 4A27A 1ZK1A 3ADPA 3ZZNA 1EK5A 1PQUA 1U2GA 4KTVE 5JAIA 4MIYA 2ZB4A 3VZSA 4BO6A 1Z82A 2GF2A 4B4OA 4NZ9A 1IOLA 2JCXA 4IZIA 3VH1A 2XAAA 2YV1A 1HT0A 2W8ZA 3GFBA 3SLGA 2IXAA 1BXZA 3HFGA 2Z1MA 3NTQA 4FCCA 5C5IA 3CMMA 4IMPA 3KYCA 3TQHA 1VE9A 1ENYA 4YT2A 3P2OA 3JQ7B 3PHLA 1ZVMA 2Q4EA 4YJFA 5AOVA 2VQ3A 4FSHA 3UICA 1LLUA 4B3HA 3ZWXA 3NDIA 3GDOA 3LT1A 4RDHA 5G4LA 5CG2A 2ZB3A 4WASA 3ITKA 4J7XA 9LDBA 1ONOA 4G5HA 3D0OA 4RL6A 1HE3A 1YVEI 4NI5A 5I7SA 5A9RA 1HKUA 1UXJA 1XELA 1NFQA 4WOJA 4TSKA 4D41A 2DBVO 4W9NA 1JTVA 3PTZA 4HNHA 4BO3A 4BS9A 4IDDA 4E33A 4FC6A 4DC1A 3WNVA 1JQBA 4BV9A 3AU9A 4A7PA 1VRWA 4IDEA 4AJPA 3S1LA 3VDQA 1BRMA 5F1OA 1CDOA 5A06A 4NQZA 4ALKA 3GVXA 2C82A 3L0DA 1ZSYA 2D8AA 5TNXA 2Y0EA 1SEVA 1IHYA 3PYLA 4GX1A 1HSZA 4YJHB 4Y6SA 5DNAA 5F1PA 4CJXA 2FPPA 5JBIA 3EVTA 3DOCA 4R16A 4F45A 3WGQA 2I3GA 3U4CA 5DBGA 1CIVA 4ZA2A 3HDYA 2HMTA 3C7AA 4KUHA 4ZQGA 4DQUA 1FDVA 3GGGA 4CQLB 4ILKA 3RI3A 5TJ9A 1BVUA 3ONFA 4Z0HO 3VOSA 1DC4A 4RVUA 2O3SA 3WQRA 3SX2A 2Q46A 3GHHA 3JQ8A 3RUEA 5F5LA 3H65A 3WQQA 1ZK0A 4ALIA 1GU7A 1U1IA 2GGSA 4YQZA 3WYBA 2VNSA 1B15A 2CSUA 5F21A 3ZNQA 4D79A 2DBQA 4YXFA 2GD1O 3JQ9A 4Z9FA 1IUKA 4E31A 2BHLA 4QO8A 4RZIA 2EW2A 3Q9UA 5L40A 2DUWA 3K31A 3U49A 1A7KA 1LC3A 4Z0TA 2H63A 3OM9A 3RUDA 1Q7BA 4N5MA 2AQIA 1V3UA 4JJGA 1TXGA 4NK4A 2IZZA 3FTNA 3INTA 4WLFA 2B4RO 4GMGA 4BOYA 1R12A 1U3WA 3F46A 4HY3A 2P9GA 2A9FA 1DFGA 4ND2A 4MVJH 4N7RA 4J1TA 3CIFA 5B4TA 4U0KA 4MKZA 4WOKA 4NHEA 4E0BA 1BGVA 4ZQEA 2UVDA 4E2WA 3WGTA 1E6UA 4IS3A 2J5RA 3AFMA 3SC4A 3HNPA 5CHEA 2I65A 4ID9A 1A9YA 1NR7A 4FGWA 5CAEA 1YBMA 2W98A 4FFMA 3DBRB 3VDRA 1SB9A 3F9IA 2JAPA 1HF3A 3GRKA 1C1DB 3M2TA 4OH1A 5C37A 5FI5A 3CPSA 2V6GA 4LSMA 4E4YA 4XB1A 5ILOA 3GR6A 3K92A 4BMVA 2A94A 5KTKA 3AUSA 5JMWA 4C7KA 2RBEA 4CLDA 4I5DA 3MZ0A 1PS8A 3DO5A 3F3SA 3LC1O 4NBTA 4WKGA 5G4KB 1R15A 1PGOA 1M67A 3DOJA 3DZIA 4GBJA 2VT3A 3PZBA 2EP7A 1A9ZA 3PQFA 4BIIA 4ZICA 1WW8A 2IXBA 4CLHA 4RVGA 2ZQYA 5L9AA 3KVOA 3DOOA 3PHIA 1TA4A 2CVQA 3WIEA 3OETA 1VL8A 5TQVA 3RU9A 2UUOA 3HFSA 2WE8A 2VWQA 2G5CA 3M2PA 1EE9A 2Y1OA 3GMSA 3LZ6A 2QX7A 3VC7A 3OQ1A 2OP0A 4YAIA 1MG5A 2H1SA 1ZMOA 4M54A 3WFJA 1J4AA 1UXHA 1M66A 4WE3A 1Z75A 2Q1WA 3RU7A 4E2YA 4UVHA 2ZYDA 4TMFA 3Q2KA 1FDWA 2DT5A 1SB8A 1HRDA 5DT9A 1RJWA 2E82A 4CM9D 2H9IA 2QZ9A 2QQ5A 4UREA 4KTTE 5J23A 1QYCA 4JQCA 3ZWAA 3JD0A 1GPDG 4OJNA 1DC3A 2B5WA 3FWZA 5A03A 1EUZA 1KIFA 2P4HX 4QXMA 2Y1FA 3G1UA 2B5VA 5ENVA 2HMVA 2NUAA 4YRBA 1XEAA 3FN4A 4IQ8A 4PZEA 4AJ4A 5GZ3A 2D5AA 2DTEA 4CMIB 1T1RA 4W82A 1IZ9A 2ZQZA 3BMNB 3DC2A 3GVPA 1FMCA 1LDMA 1ZKMA 3K30A 1Z45A 2VNAA 1YWGO 4LW8A 4M49A 1UP6A 4NJMB 4R4JA 4ZD6A 1T24A 1YDEA 3HN2A 3GF4A 3K2EA 3STHA 1DC6A 1DPGA 2X6TA 3HJAA 3QVWA 3A9WA 1W0CA 3TOZA 2UDPA 4PLPA 5T5QA 3X2FA 1PGPA 3E82A 3KOUA 3KHUA 4Q9NA 4CMEC 4Y98A 3HDHA 3WR5A 3RKUA 1H2BA 3R0IA 4DBZA 5HBRA 1CF2O 3PHHA 5JE8A 3CH6A 1YB4A 2GNAA 1T2FA 2QYSA 2BFOA 2Y0CA 3UW3A 2VUSA 4GL4A 4NU5A 4KDFA 4PGFA 3FCOA 3PHGA 1OOEA 1ENZA 2X58A 4KMSA 4BGVA 3VPGA 3ZDFA 1KEUA 4PIVA 5L4LA 2W2KB 1ZK3A 3DHYA 4GH5A 5DBFA 2BGKA 4IBOA 1XIVA 1I5RA 2FPIA 1KVQA 3FPLA 4AJIA 4OOFA 4DQXA 5JMPA 4B8ZA 4R5MA 3WBFA 2Q1TA 4J1QA 8ADHA 2BF7A 3RBZA 1I10A 2C2XA 3ZW9A 1QMGA 2EW8A 2P5UA 2ZB8A 4IM7A 4BO7A 4D7AA 1C0KA 2V6FA 3OEWA 2I6TA 3AW9A 4P4NA 3GVHA 4TROA 3C7CB 3WJ7A 1YONA 1QKIA 3KV3O 5JS6A 2ZCVA 1A71A 1NM5A 3QVXA 3V1UA 4DYVA 4JNKA 2JFHA 1ISJA 4G2NA 4GI2A 1NX6A 4GPD1 4J0FA 4PFJA 4RVFA 3VZQA 4A0SA 4D44A 3OIDA 1C0LA 1U4OA 3GQVA 3ONDA 4I9NA 4PLCA 5ICSA 3W6ZA 3PXXA 5LC1A 3INGA 3D7LA 4DPLA 3DL2A 5HTOA 1F8GA 5A05A 2DBRA 3CZRA 1H5QA 4IJKA 3DTYA 1XA0A 2OBYA 1UDCA 1Y8QB 2VWHA 4IIUA 5G0UA 3VZPA 3B1JA 2VHYA 3TL3A 3TF5A 4FC7A 1UXKA 2FR1A 4Z3DA 2PLAA 2HMUA 5AXCA 5ENDA 1D8AA 3NT5A 5IAAA 4R3NA 1E1KA 1PIWA 3TN7A 3PI7A 1XDWA 4W99A 1PQWA 5CDUA 6ADHA 5EQFA 3VH4A 3CXRA 2HK8A 4HBGA 3RFVA 2HMSA 1AHHA 1EQ2A 3NJ8A 1I33A 2JD1A 2EJVA 4XGKA 3SBOA 1I8TA 4GKBA 2JHGA 4MP8A 4J6FA 1U8XX 1GZ6A 1I3LA 2VRCD 3L9XA 3GVIA 1EVJA 2ZK7A 2ZKLA 3Q9NA 1GV1A 2OGUA 5I9MA 4AJ2A 2UV8A 3P19A 2EKPA 4U5QA 1NQTA 3UUWA 5CDTA 4FIZA 3DAGA 3EYWA 3HSKA 5A1TA 1JKIA 1ADGA 2OHXA 1DIGA 3I9JA 3W1VA 2W2LD 3WGHA 5ITVA 3G79A 3UVEA 1KEWA 3NTRA 5KVSA 2X9VA 4XCVA 1FDUA 4A2CA 1L7DA 5JSFA 4MVJA 1ISIA 4BO2A 3PEFA 2ZYGA 1AXEA 1EVIA 1MC4A 3NGLA 3NAQA 5F3RA 1KERA 3I3OA 1R0LA 5BNIA 1JW9B 3LLSA 4BMSA 2R2GA 4CV0A 1DJNA 4FJ1A 1NBOA 1N2SA 4BKPA 1EVZA 2DQ4A 2HU2A 2VYNA 3C24A 3H8VA 3MJSA 4BNXA 4CLOB 3ZU2A 2A35A 1M2WA 3KXDA 1T4DA 3QIVA 1O0SA 4Y67A 1YRLA 4NG5A 4Q3CA 5TT1A 5I9LA 3ZWNA 1CRWG 4R54A 4JN6B 3GG2A 2AMFA 3W8DA 2PD4A 1ONPA 5DP1A 3TL2A 4B79A 3V2GA 3UHAA 1UXIA 1C1DA 3OA0A 3DBHA 2FSVA 4RQTA 1MX3A 2HKIA 2GN4A 3DZKA 3KO8A 1QR6A 2NU9A 3GUYA 2EIHA 4U0JA 2C7VA 3BMOA 1V3TA 5COAA 5ICMA 1R0KA 4YJGB 3VAZA 5A9SA 1YKFA 5G4KA 4IZHA 3L77A 1N7HA 3O9ZA 5IDYA 3TRIA 1Y1PA 1FK8A 1ZNQO 3RC1A 1YBVA 3D3WA 2IEBA 1U9JA 2D2IA 5I9NA 4WJZA 3ZWOA 1P1JA 3CINA 4JP3A 4HKTA 2V6MA 1HDZA 1MXFA 3FWNA 2I5PO 1ULUA 3GA0A 3IIEA 3UF0A 3AI2A 3H3FA 4YT8A 3HB5X 1DO8A 2NTJA 3H9QA 4HP8A 4MINA 1U28A 2CDBA 1HDOA 3JQFC 1O6ZA 2VUUA 2WYVA 3PQEA 1PJQA 2J5QA 2X86A 1EK6A 1PEDA 3WBBA 4N54A 3IL2A 2FR8A 1BSVA 1ENOA 1I01A 2TMDA 4IXTA 2EKQA 3ROPA 1XQ6A 1OBFO 2V6BA 3NRCA 4FOSA 4EDFA 3H5AA 1C0PA 3HUDA 3JCZA 4GMFA 4NMHA 2DTXA 5IG2A 1BXGB 4DMMA 1HSOA 3KB6A 4P38A 5CEJA 4RQUA 3VPSA 2ZJ0A 3WWYA 4LISA 4JLWA 4XB2A 4UEKA 1DAOA 2CVZA 3MWDB 1CETA 5BQFA 3I4CA 4Q39A 4EI2A 1HE2A 2D5CA 4YWJA 1QYDA 1ID1A 5EIOA 2WD7A 4JJFA 2GZ1A 1EDZA 1GY8A 1PR3A 3L4BA 1EDOA 1AHIA 4YCAA 1YJ8A 5IZCC 3T4XA 3GPDG 3ULKA 4DVJA 4IDAA 3LK7A 4O6VA 4CMIA 4EUHA 4IS2A 5TRTA 4E30A 3ZN2A 3BMNA 3TZ6A 1B26A 2OFPA 1WLYA 2EP5A 3EK2A 1LBEA 1PU2A 2G0TA 5U1PA 4D3DA 2A4KA 4DC0A 5JAZA 1O89A 3LDHA 4NPCA 3OJLA 2NQ8A 3GAFA 1D3AA 1KVRA 4ND3A 1UAGA 5L7YA 4WLEA 1LU9A 4J43A 2UUPA 3KLPX 3U62A 4E21A 1EUDA 4O0LA 3WQSB 3GT0A 5BR7A 1U4SA 2Y0DA 2DVMA 4YBZA 5IN4A 1GDHA 1E6WA 2X0IA 1HZJA 5T8KA 5BSEA 3BTOA 3PJEA 2Y1DA 4PLWA 3U4DA 1LNQA 1NR1A 1LRJA 4XDYA 1R4MA 2X0RA 3PIDA 4JBIA 4FR5A 4L0QA 1IB6A 4I5FA 3DBLA 1E7MA 1F0YA 1N92A 1NNUA 3D4OA 2DBZA 4RVSA 3B6ZA 4HX5A 2W2KA 3S2FA 2PKRA 2DU8A 1Q0LA 2JCVA 1Y5MA 1P1FA 2YV3A 4CMCA 3GRPA 1GTMA 4OKNA 1LX6A 4BB5A 1EBFA 4CL3A 4ZQHA 3Q1LA 3QWIA 5C7IO 3IS3A 4EEXA 3GNTA 2VCYA 4IUYA 3DR3A 4YACA 4EJ6A 5I7VA 3W8EA 1GZ3A 1X14A 3KLMX 3Q6IA 2O23A 3R3JA 4XYBA 4BNZA 4XYEA 3RJ9A 1N1GA 1ENPA 5MDHA 2Q45A 1RM4A 2Q4BA 4J9VA 1C3VA 3ROMA 3GZNB 1ZXLA 2H6EA 5KJCA 2NVBA 4FBGA 4LVCA 3BHMA 3GAZA 4MVJD 4PCVA 2IRWA 1P9LA 3ZNPA 3E9QA 4BNYA 1TI7A 3MEQA 1VI2A 4NBVA 3N74A 4BNHA 1EVYA 3I23A 4PVCA 1VC2A 4EJ0A 4YQYA 4MJLA 4M55A 3TNLA 1XHLA 4E32A 4W4TA 3VPHA 1VJTA 3SJ7A 4PN3A 1QXSA 2OZPA 1MUUA 2A92A 2EXXA 4B7XA 3PLNA 1KS9A 2JD0A 4KUEA 4QX6A 1XR3A 3QE3A 3VZRA 3F4LA 1H2HA 3EHEA 4YR9A 3NT4A 3C7DB 5JDCC 5JAQA 2AE2A 1XQ1A 3LQFA 4PLZA 1MFPA 1XWFA 3MJVA 1E3EA 1GQQA 5AXDA 5L4NA 1E7QA 3D64A 1JKJA 1H6CA 3UXYA 4RF4A 3EVNA 2AQHA 1VM6A 2JCYA 1T2EA 4LCEA 3ZV4A 3KRTA 3RFTA 1R37A 2I9PA 3ETEA 3AOGA 3ABIA 2Q50A 4CM9A 1GAEO 2YDXA 5BT9A 4RLSA 2EV9A 3W6UA 1IE3A 2D0IA 1XSEA 2E37A 1NPYA 1NQ5A 2YFHA 4MVJG 2J3IA 1EMDA 2CVOA 3U0BA 4CLXA 2WD8A 3K96A 1Y8RA 1LDNA 4HADA 3ZWCA 2OXIA 4BMNA 5AXBA 5A5FA 3IQDB 2DPGA 5G0TA 2AE1A 1F8FA 2GDZA 4TVOA 4CM3A 4QUKA 2GUGA 3GLQA 3I9LA 3AOEC 4ROSA 5T64A 3ZU5A 2QG4A 1GYRA 3V1YA 5JLAA 3MJ4A 2IEDA 1M6WA 2NU8A 3OMLA 3PQDA 5H82A 1ZJZA 3S55A 3TDKA 1I32A 3ZNNA 2X22A 1GL3A 1D1TA 1HL3A 3DTTA 3OIGA 3ENNA 1A4IA 5TSDA 4HFJA 4ZVVA 3ST7A 4W6ZA 3JQGB 4LRTB 4Q3BA 4Y8VA 4XJTA 1CQIA 2BLLA 1R4NA 2PKQP 3AY7A 3JQCA 2P68A 3ZHZA 3JYOA 1ZSNA 2FOIA 2JKVA 1VL6A 1S7CA 3NEPX 3L4SO 2FPGA 2CFCA 2X1HA 2YZ7A 1UR5A 3OH8A 4H7PA 4BNGA 4YJGA 1RM3A 4B7CA 1ZO8A 5DDIP 1K5HA 1H93A 3F1LA 4AJ1A 1LDBA 3H2ZA 4DBVO 2WYWA 4PZDA 3OF2A 3OEYA 3IOYA 3T4EA 3MCVA 3UN1A 4N18A 3F5SA 4BNFA 2W4QA 3AFNA 5FWNA 3WTBA 1G0NA 4MOWA 1VSUA 2PR2A 1MP0A 1X7DA 1W73A 2O3RA 2RHRA 2CZCA 2BFPA 4XQCA 1ZJYA 3CTMA 1W8DA 3O8QA 5FFFA 1VJ1A 3W4KA 5I7FA 1SCUA 1MGOA 2NNLD 2RH8A 1WMAA 3FNGA 3OFSA 4CM4B 2HRZA 4XQGA 1E1LA 2DAPA 3L6EA 1WZEA 3LT0A 1MB4A 5F5NA 5IJZA 1BXGA 4BNMA 3PZRA 1E1MA 4AJKA 2V7PA 2C7GA 2UYYA 4GKVA 3WLEA 3UCXA 1XU7A 4RPJA 4MVJF 5GZ1A 2DTDA 1AXGA 1GQYA 1PJ4A 2Z1NA 3RD5A 2HMWA 5DP2A 4TKLA 4RF5A 7MDHA 3DB2A 5T6BA 4UVIA 4RF2A 2AEFA 4Z9YA 4WPGA 3RFXA 1A72A 1UP7A 4WCDA 4F6CA 1LSOA 3WX0A 3E9NA 3GEGA 4G81A 4XA8A 1H6AA 3Q11A 2VRCA 4NU6A 5CG1A 4MIOA 5ER6A 4UUMA 4XIYA 2FZEA 1ARZA 1FDTA 4CR6A 5EERA 4QFDA 2F1KA 5EL0A 4ESOA 4ONEA 4X54A 4D3FA 2QIOA 1RYDA 3JQDA 2O2YA 2GRAA 2B37A 1PJTA 2W2LA 1HEUA 5JDIC 2DPHA 1NP3A 1PZGA 4UAGA 4WCFC 5G0WA 4A73A 3AK4A 2FRDA 3I9KA 2X8LA 4JGBA 1GYPA 1V6AA 3DONA 5JNLA 2YW9A 5TC4A 3BTUA 4N5NA 3KM0A 5CEEA 1C1XB 1ADBA 3PDUA 1WZIA 2O7QA 3C1TA 3DBVO 4FD3A 4CMGA 2BRUA 2X5KO 4WEQA 4DIFA 1P74A 1CEQA 2ZTVA 2FZWA 1B0AA 2PZKA 1E3JA 2JD2A 3ZHBA 4L8VA 5AYVA 1B3RA 1SNYA 3MJCA 1ZK2A 4FN4A 3OQ6A 3WS7A 4XKJA 3B70A 1VKOA 4URFA 3GEMA 3I9MA 1RM0A 1IHXA 2DFDA 5L7WA 3E48A 4MVJM 4YAEA 5AVOA 3T7EA 4GGPA 3V1TC 2Z95A 4XZ3A 1KEVA 3M6IA 4E5YA 2GN8A 4E2ZA 4GGOA 1WVGA 3B20A 4R69A 1T2CA 3GG9A 1QSGA 3H9UA 2PV7A 1LRLA 1NVTA 3ZCXA 3I83A 5K6AC 4OSOA 1RWBA 2PA3A 2G82A 1E3IA 3EY4A 3L6DA 2J5KA 3QVSA 4CV2A 4LRSB 5A5EA 1ISFA 1DRWA 1MV8A 4NFSA 4H15A 1K6IA 3CKYA 4O63O 4C4OA 2ZTUA 4UVEA 1BTOA 1PJCA 2CF6A 1E3SA 3KYBA 3Q3CA 2C59A 5CEFA 1CYDA 3ZWMA 2HJRA 4K6FA 4GAEA 1PJBA 3GN2A 4K1LA 4XR9A 1G0OA 2J3KA 4RDIA 2HSDA 1DC5A 2NVUA 1YOVB 4JIGA 4KP7A 1A7AA 1T2DA 1QLHA 4IIVA 5FEUA 2GLXA 3JYPA 2GR9A 4HFRA 1CQJA 3WG9A 2XXBA 2B36A 3A06A 3FNFA 2DKNA 3BZUA 3QWFA 3QW2A 1OAAA 3KEOA 3GVCA 4NK5A 1UJMA 2AG5A 4MKRA 5THQA 2O2SA 4N5LA 4NFHA 3NTOA 4DMLA 1YE3A 2C29D 3GK3A 2DC1A 5TJHA 3JQAA 3ANMA 2BKAA 4BKOA 3ZGYA 1RYEA 1N9GA 2J3HA 4E5PA 5A3VA 2J3JA 2FY8A 1E7SA 1H9AA 1P0CA 3RBVA 2PZLA 3FBGA 1WDMA 1K3TA 4I9UA 1X15A 5T67A 3NYWA 4ZQBA 4WNIA 2C5AA 1ZSVA 2W90A 1YS4A 3FNHA 3GFGA 3D1LA 5FYDA 4AJNA 3EAGA 3IKTA 4B3JA 1WWKA 1ADCA 1XGKA 4R01A 2Q99A 1QV7A 2CD9A 2Y05A 4PG4A 3ZNOA 4DLLA 2C2YA 4CMEA 3N58A 5EQDA 1X0XA 4BKRA 1R66A 3WB9A 1E6EA 2O3JA 4RGBA 2ET6A 4OHUA 2QYTA 3QHAA 4BO5A 1YB5A 3FD8A 4Z0PA 5IDWA 1F12A 1DFIA 4U8GA 3RC7A 1C0IA 5KIAA 5GMOA 4I08A 3EZLA 4GSKA 3JQ7A 4L4RA 1UDAA 4XDZA 4KQXA 3ZV6A 4AL4A 1BW9B 3BMQB 4KZPA 3NX4A 1M75A 1LDEA 4EZBA 4D42A 1V35A 3JQ6A 2I3AA 3HG7A 5GZ6A 1CWUA 1E1NA 4YPOA 4ZJUA 2CMDA 2J8ZA 2Q2VA 1Q0QA 3HB4X 3MOGA 4XQEA 5L51A 3ZHYA 1I2ZA 1A5ZA 4J2HA 1NASA 4PVDA 4PRLA 3AUUA 4OYRA 2EHDA 2OORA 1I24A 3LLVA 3ANLA 1KBZA 3VTFA 1PS0A 2D3TA 3SXPA 3DZGA 4J4TA 5TS3A 4OQYA 1H9BA 1KYQA 3IP3A 1O5IA 1OFGA 3AU8A 1A27A 3DFUA 4YJHA 3ZWBA 2BGMA 3OSUA 4P22A 1E3LA 4FS3A 1LC0A 5CPFA 2R00C 3QWAA 4BNJA 4FJ0A 4CQMB 4CQLA 4CM1A 2DLDA 5K0ZA 3DZHA 1JU9A 4KQWA 3DMTC 3GHYA 4XD2A 4BGEA 1HZZA 5JFOA 4LMRA 1U7TA 3BAZA 1HLPA 4M1QA 2X0JA 4U7WA 1P31A 1NFRA 3HZZA 3D3EA 1TT5B 3MTJA 4B8WA 2P5YA 3ZU4A 1O95A 3ITDA 3JQBC 1K2WA 3DAPA 2X9NA 2CUKA 4PLVA 3KYDB 3VKVA 3V8BA 3WOHA 3D5QA 5TIIA 1B3BA 3M1AA 3UKOA 3DWFA 1GADO 2DFVA 4R51A 1IYZA 3A28A 2WEKA 2PH5A 1P45A 4J3FA 4K28A 1QYXA 5TLSA 5B4UA 1XCBA 4JJIA 4JROA 4DGSA 1Z74A 2PZMA 1RPNA 3LF2A 4RCVA 4BNTA 4CM4A 4Q3NA 4C7JA 1P1RA 3FBTA 2VHWA 3RQSA 5BSFA 2P4QA 2WYUA 3RUFA 4NIMA 3FF4A 3JTMA 3FSRA 5JY6A 1P77A 4TWRA 3U9LA 1HWYA 2DUUA 3U4HA 1Q1NA 2HCTA 2NV6A 4HFMA 1PZEA 4BNVA 1DRUA 3E18A 4F6LA 2ZTLA 3WMWA 1I3MA 1YDWA 2WWRA 3GN1A 1YQGA 3C85A 2VT2A 4XQ9A 1FXSA 2XF8A 2NM0A 1DXYA 3A14A 4D45A 1LA2A 1NQOA 2EGGA 3DBRA 3PDJA 2ZYAA 3DMYA 3RSHA 3KBOA 2NADA 4LN1A 3WFIA 1B14A 5EJ2A 5ILGA 4MO2A 3PRJA 3RC9A 4YJFB 3WDSA 3QY9A 3JV7A 4ALJA 3R3SA 4M86A 5KVVA 1DJQA 1GQ2A 4BO4A 3MJEA 4BVAA 2YQ5A 4RVDA 1HE4A 1B16A 1BDMA 4XJSA 2BI8A 4OXKA 3W4JA 2NVWA 4XYGA 3H2SA 3WYEA 2E49A 1VJ0A 4D43A 3H9GA 2RHCA 3RWBA 4R5HA 2TMGA 1ZBQA 4J4BA 4KUGA 1ISGA 4OQZA 1KVTA 4IJVA 3INRA 4FPXA 5HS6A 1B8PA 2AXQA 3QP9A 1PSDA 4D46A 4MPDA 4B4UA 5JYEA 4RVHA 3ETDA 2YUTA 4S3MA 4F3YA 1D7OA 2PKQO 4G65A 4GQAA 3O38A 1KY4A 4CV3A 2Q2WA 1SEPA 1EQUA 2Y1CA 3SC6A 4NNJA 4IGFA 2WM3A 3QWHA 1UDBA 1SBYA 1U3TA 1RKXA 3WTCA 3L4BC 5I7EA 4OMUA 2YQ4A 3FR8A 3GY0A 4DWVA 3PJFA 2I76A 3H9EO 3JQAD 3LSYA 5KVQA 3UOGA 1JLLA 4YDRA 2HK7A 5I8ZA 4KDEA 2CY0A 3ENKA 4OOEA 2C54A 5DOVA 4II2A 4FFRA 1N7GA 1MLDA 4B4WA 1QV6A 4CM6A 2HO5A 4CM7A 1X7GA 2JL1A 1IL0A 3Q2IA 3QVTA 1DAPA 1CJCA 3OQBA 1JAYA 4AFNA 1DIHA 4BUCA 5IXSA 2HK9A 4QT0A 1OMOA 1U5AA 3IDSA 2PNFA 1DLIA 3OJFA 4WLOA 4BHTA 1U2DA 2P9EA 1KOLA 2C0CA 5KJFA 3AI1A 3WSVA 1GV0A 4NR0A 4BO0A 3RUCA 1UZNA 1PQPA 5T8KC 2C07A 3UGKA 4DXHA 1DSSG 2Q2QA 2HRBA 1EBUA 4FB5A 1J6UA 2GASA 4OL9A 4ZQFA 1MC5A 3PK0A 4OGWA 3GGPA 2YDYA 3K6JA 4NJMA 1PGJA 3DZBA 1WPQA 1KC3A 4BKUA 4L4XA 2OO5A 4DREA 2GN9A 4AJOA 1QG6A 4GX0A 4AICA 5ADHA 2Y68A 5HWSA 5JC1A 4ALLA 2X0NA 1YOVA 4A5OA 1QLJA 4YJDA 1BWSA 4OXNA 4H16A 2EKLA 4RPKA 4HNGA 2O3UA 4ZRNA 5L4SA 1V9LA 4LVUA 2FSSA 1R16A 4Z6KA 1SOVA 1GEEA 2ZIZA 3ZHXA 5K9ZA 3CE6A 3P5SA 5COQA 5ES3A 3AUTA 4PZCA 1Y7TA 4RPLA 4DLBA 1NQAO 2YJZA 2VN8A 4CR7A 3AY6A 2AEJA 2GO1A 2EF1A 3LT4A 1JAXA 4CUZA 3GEDA 4CM8B 3JYNA 4J1NA 1JA9A 1WDKA 3A1NA 5IZCA 3ICCA 1T2AA 1N5DA 4BGIA 4ND4A 5HRUA 1NPTO 4Q3EA 1VLLA 4Q3AA 1I3NA 1VL0A 1EZ4A 1I30A 4AG3A 2AG8A 2XPCA 1MFZA 1OZAA 1AUPA 4UUNA 3P7MA 4OO3A 1MXHA 4UVGA 4YRAA 1NYTA 3N7UA 4UUPA 4GLOA 2I67A 5KVCA 4MP3A 2AEMA 4JBGA 2RH4A 4E13A 2VYVD 3PWZA 3WGZA 3WMXA 4W7IA 3EUWA 3GDGA 1GR0A 1O94A 2J6IA 2Z5LA 1X1EA 3G0OA 4K6CA 1VPDA 1PWXA 4GX5A 4GWGA 4WCFB 2PH3A 3BHIA 5COBA 1DFHA 1UAYA 4RPGA 3UFXA 3K5PA 3ZU3A 1TEHA 5IDXA 4BO8A 1ZMTA 2I66A 1PS9A 4J90A 2CNBA 4TKMA 4XRRA 4OKIA 1Y8QA 1FJHA 1WXDA 1XU9A 4DL9A 4CMAA 3PP8A 3R6DA 7ADHA 4HFNA 3RUIA 2IZ0A 5U4QA 1H0KA 2HAEA 2CDAA 1JVSA 1P44A 1KEPA 1T25A 4Y9DA 3BMCB 4YYZA 3F4BA 3G3EA 1U3UA 3EGOA 2O4UX 1X13A 4OXYA 4YB8A 6LDHA 3I52A 5A3JA 4Z3KA 5EINA 2GZ2A 1SPXA 1BMDA 4PLGA 4WECA 1E7WA 3RBXA 4BV8A 1PR9A 3B1FA 3OJEA 5IXYA 4NH4A 4GSLA 4FDAA 4BNWA 3ANNA 4CUKA 1PJLA 4WLNA 4CQMA 4K26A 5KKCA 5DULA 1O8CA 1BXKA 4D0RA 3OHSX 5IZ4A 2X7HA 3QWBA 2IYPA 4BKQA 1BHSA 2NU6A 5L45A 1D1SA 1KY5A 4L4SA 3QA9A 3HADA 1Q0HA 4CUJA 2HLPA 1T4BA 3KETA 4INAA 5CFZA 8LDHA 1PZFA 4JP2A 1I2CA 1D4FA 3BXXA 4MP6A 2IYOA 1U7HA 2ZTMA 2BI7A 3LF1A 1M6HA 1HLDA 4W9NC 5A9TA 3ZWVA 4QEDA 4QSMA 4WNCA 3WXBA 5JDCA 4AJJA 3IMFA 1TB4A 1ZW1A 4P4GA 5ER9A 1W6UA 2AA3A 3E1KA 2NSDA 4J49A 2PY6A 2VTEA 3OICA 3ZWWA 4I9HA 3WLFA 3FTPA 4CLOA 4TZTA 2NU7A 2O3QA 1SO8A 2GPTA 3UCFA 5L7TA 2QRJA 4TVBA 4CMHA 3OJOA 1GUZA 4FJ2A 1HDCA 1LLCA 2CDCA 3C1OA 3G49A 3WIDA 1VKNA 2BD0A 4WK6A 4A26A 1GYQA 1LEHA 4XYLA 4F46A 4IDGA 4RF3A 3ASVA 2IZ1A 1LDGA 4LMPA 4OIMA 1NWCA 2NACA 5JCJA 5KJEA 1DIBA 4DPMA 3NGXA 1E3WB 3PWKA 3M1LA 3HE3A 2QRLA 3HDQA 2PGLA 3JQ9C 4MKXA 4UEJA 4DUPA 2NTNA 4IINA 3PGXA 4HXYA 4I5EA 4QFCA 4IJWA 1PTJA 4WEOA 5JO9A 1H6BA 1U3VA 2Q3EA 3JYLA 4IXWA 4B3IA 3S2GA 3I4FA 3V2HA 3ZWPA 3IJPA 3DDNA 3JQEA 2E6UX 1G6KA 5A4DA 2BMAA 3AOEA 2QW8A 2X5OA 1A4UA 1X7HA 3AY3A 2RIRA 4A03A 4CMKA 3PJDA 3TJRA 4YAKA 1GZ4A 3E9MA 4OM8A 1G1AA 1HTBA 4EBFA 3S2EA 3UH1A 2Q1SA 2E4AA 2FR0A 3U4IA 5DCUA 2JFGA 3GGOA 1OI7A 1Y9EA 2PTGA 3OECA 3EW7A 4TRMA 1J0XO 1YL6A 4RV9A 4M8SA 2ZB7A 3H5NA 2P2SA 3C3XA 5DCWA 4AJEA 1TT7A 3IKVA 1ZIDA 2BH9A 5KCZA 3ETGA 5C7LO 4FFLA 2FMUA 1C14A 3OP4A 5KJ1A 5DZSA 3G17A 1QRRA 1HDRA 5C3MA 4PLTA 1LI4A 3JSAA 2VZ0A 2HJSA 4R41A 1WMBA 2BELA 4BNNA 1FDSA 2O7SA 5JC8A 3AM4A 2GN6A 3CEAA 4ALNA 4JCOA 1AN9A 1UZLA 4ITUA 1ADFA 4RLHA 4XGIA 1ML3A 5HM8A 1WAMA 5KJ6A 2R6JA 3NV9A 4NBRA 3ZH2A 2EEZA 3GC6A 3O26A 2EJWA 5IN5A 3OJ0A 1NAHA 2GCGA 1LSUA 3HQ4O 3QJ5A 1HE5A 2PGDA 4CV1A 3GPIA 4UEOA 1YQXA 1ZFNA 3VH2A 5KKAA 4LCJA 1NWHA 4ALMA 1HYEA 3DBHB 1N8KA 2WDZA 1ZEMA 4LGVA 2Y1GA 1BDBA 1ISMA 1IY8A 3PWSA 2JFFA 1X1TA 3AM5A 4CMJA 5AQ1A 3RASA 3BMOB 4Y6RA 2BFMA 3E8XA 2YHUA 4ZGWA 3DZJA 5A9SB 3WGYA 2IDZA 4R9RA 4E2XA 1P1IA 1DOHA 3D5TA 4W7HA 2X4GA 4ZRMA 1GUFA 4P8RA 3H3JA 3T7CA 3RCBA 4CM8A 3D3WB 4XR4A 4XWYA 1T26A 4EUEA 1X0VA 1ZUD1 4L76A 3DAFA 2VHXA 2EG9A 3PPIA 3ROKA 4BO1A 1GEGA 4R68A 3VVCA 1PWZA 3I5MA 1GCUA 4MIEA 3GH3A 5DBIA 1SOWA 4CQMD 3DZFA 3K2BA 3GUCA 2VZ9A 1J49A 4BQRA 4QTZA 3FHLA 1T1SA 4TQGA 3MOIA 3PYXA 4J9UE 1EFLA 4CMBA 1E7YA 1L7EA 1Q7CA 2OL4A 1GCOA 3S2IA 2SCUA 3AUAA 4U6SA 3I1JA 2OBNA 3K9QO 2Y67A 2ZCUA 4RPHA 4PG5A 1QYWA 3GZNA 5EMHA 2Q49A 4EYEA 1U8FO 5TX7A 5BSHA 5BNTA 3H4VA 2EGHA 2ZJ1A 1PL7A 3GMDA 1ULSA 2OOSA 4IJUA 3NUGA 3WICA 5JDIA 4WCFA 2PK3A 2FP4A 1Y6JA 2YFQA 3H6KA 4CL8A 1HXHA 3ADOA 1O9BA 1NXQA 1E77A 3GNSA 3NDJA 4TRRA 2BFAA 1DB3A 5DCYA 1R0SA 2GERA 2Y93A 2Y66A 3FNEA 2PD6A 1E7RA 2WD7B 3PYMA 1GD1O 2YHIB 3TFOA 1P1HA 1K89A 1XKQA 1WDLA 4FFNA 4YT4A 1Z73A 2B0JA 2AW5A 1JWBB 1JWAB 1Q2XA 1ISHA 1TVEA 3JD4A 4OSPA 3F1KA 3MJTA 1DDOA 2LDXA 5IFLA 2O4CA 3BMCA 1PJ2A 2O3TA 4B4VA 1ZH8A 1ZXBA 4YAGA 4HWKA 1HDYA 2WE7A 2B4QA 3RC2A 3EC7A 4J7UA 1YJQA 4PRKA 5F1KA 3TZQA 1DHTA 4JXKA 1QP8A 3X2EA 5CPBA 4YTEA 4U6QA 4WUVA 1OC4A 5B37A 5K6AA 2ZATA 5JCJD 4PLYA 1Y5RA 1MA0A 4BQPA 3JD1A 4IMRA 1HYHA 3KEQA 3WSWA 3C1AA 1LSSA 4O59O 3H5RA 4E12A 3BA1A 1R4MB 4CLRB 4M89A 3DBLB 3DHEA 4RZHA 2P9CA 4PLFA 4YAJA 3VTZA 3OIFA 1N1EA 1PJSA 2F00A 4J0EA 1DRVA 1LUAA 2GZ3A 2GYYA 2YYYA 1K6JA 2XOXA 3E5MA 3PVZA 5FI3A 3RJ5A 3PFFA 1UP4A 5AXAA 5CDYA 3U09A 5A04A 3TFQA 4J2OA 5TF4A 3QSGA 5HA5A 3ZWYA 3F5QA 1YL5A 3RIHA 3VHRA 4E5KA 4BO9A 3PJGA 3F6YA 1MG0A 1ZZEA 4DTIA 4IDCA 3O03A 3AI3A 3MWEB 5LCXA 3HWRA 2FN7A 3U3XA 4IY1A 4O1MA 2LDBA 1LDYA 1PX0A 2EWMA 2VOJA 3WJAA 3I6IA 3DQPA 3RUAA 1YXMA 3E03A 4FQ8A 4JX8A 1I0ZA 5TGDA 5EN4A 2Y99A 5EESA 1IULA 3NDRA 3VVBA 2XXJA 1UH5A 2AHRA 4R3WA 1S6YA 4GVXA 1I2BA 3JQGA 4LSWA 1K0UA 1XLTA 3KSDO 4IDFA 1E5LA 2X9GA 4J4HA 4ND1A 4Q3DA 4I8XA 1DHRA 1U5CA 1UUFA 3VH3A 1DLJA 5CP8A 2VWGA 5H83A 4R1TA 1B8VA 3WNQA 1YBAA 3VPFA 1E3WA 4JBHA 4MVJE 4D3SA 3SVTA 4DPKA 1LTHR 4RORA 4Z9XA 3TZCA 1Z7EA 2Q1UA 4AJHA 3V5NA 1LQUA 5C7OO 2D4AA 1YB1A 3VPXA 4MDHA 4I5GA 3SEFA 4FOOA 1XG5A 5L53A 2PGJA 1HDGO 4DYDA 5L3ZA 2YV2A 3JD3A 3CUKA 3UAGA 2VWPA 3KZVA 2B4TO 2P91A 3KSZO 5DF1A 4EGFA 2OMEA 4MVJI 3TSCA 4XYMA 2QZZA 1RM5A 2VYVA 4PG6A 1L1FA 1LRKA 4YA6A 5H81A 2IE0A 4ZN6A 2VTDA 3IAHA 1AGNA 3DFZA 4E5NA 4O5OA 1UZMA 2O50A 4PG8A 1E0DA 3WGIA 1HETA 4IQ0A 2OUIA 3PGJA 1OC2A 3TPCA 3H7AA 5G0VA 4BNLA 5MGBA 2AQKA 3WYCA 3FR7A 1P33A 4EITA 1Y8RB 1NFFA 1KETA 3VKUA 3OA2A 3BTVA 1BVRA 2FWMX 3K8ZA 3TZKA 5JO0A 1QYVA 1PGNA 3EZYA 3MTGA 2R00A 3IC5A 2PWZA 5JCXA 4XIJA 1H6DA 2G1UA 5G0SA 3KYCB 5JAMA 3AM3A 5DN9A 3DMTA 4BL5A 3I6QA 4QECA 5IF3A 4NDNE 3L07A 1YQDA 4HUJA 4NJOA 1V3VA 2VZ8A 4L74A 4ND5A 1NHGA 1NVGA 1ZK4A 3NKLA 3AWDA 1YO6A 4WLVA 2NWQA 2NTVA 3JYQA 3JQBA 1P3DA 2YY7A 3B1KA 1HYGA 2NQTA 4EUFA 1ZEJA 2B35A 2JAHA 4NBUA 1F17A 4K9DA 4CR8A 3IUPA 1E5QA 3SJUA 3ICPA 3E5RA 1WNTA 4DRYA 4CODB 1DIRA 2UAGA 2X23A 1QORA 1R4NB 4GX2A 1TLTA 3P2YA 4CPDA 4PLHA 3QRWA 3FI9A 3V2UA 4FFOA 3LYLA 5GY7A 4EEZA 3U5TA 4M87A 2WJPA 4XGNA 1K6XA 4NFYA 2QHXA 3SLKA 1YL7A 2C5EA 4IDBA 5JY1A 3COSA 3LC7O 1F14A 1C1XA 5JYDA 3EDMA 3FPCA 1J5PA 3OBBA 4TRJA 2DM6A 1YGYA 3D4NA 1KVSA 1IPFA 1NTOA 2GSDA 5TT0A 1M76A 3JQ8B 3FRJA 3WWZA 3AJRA 5CDGA 3ZI0A 4BNKA 5JW6A 2ILTA 4BB6A 4J7CA 4MVJP 4CLEA 4KWHA 2VHVA 1F06A 3TOXA 1EEHA 3PHJA 1Z7BA 4AJLA 2D1YA 3QVOA 4HV4A 1V0JA 5CDSA 3PLRA 3O8QB 5JPIA 1PGQA 3WGOA 4DQVA 1SZJG 5ITWA 2VUTA 4TRNA 1I3KA 1KVUA 3S8MA 4AVYA 2C20A 4L9RA 1PZHA 2POQX 3GNQA 2HDHA 4CM5A 2PFGA 4BGUA 3E6AA 1WP4A 4UUOA 1DEHA 1KC1A 1DBVO 5FF9A 5A02A 4XX0A 2Y1EA 3RVDA 4UULA 4DLAA 4I1IA 4J1SA 4B7UA 2E48A 2B69A 4YRDA 4DIBA 5KWEA 5LDGA 2RCYA 3JQFA 2V65A 3RROA 3W4IA 2WMDA 1JKFA 3I9OA 1H94A 1V8BA 1DIAA 2NLOA 1EFKA 2VOEA 1LSJA 3EMKA 4IGEA 2EERA 3ZW8A 2WSBA 2YHIA 4RJTA 1SC6A 1LQTA 4WGGA 4YT5A 1GUYA 4II3A 4XRGA 4J16A 1ORRA 5HS4A 3UCEA 5KOIA 4L73A 5LDHA 3DHNA 2H5LA 2JJYA 3KSUA 1VSVA 4UVDA 4S1VA 4EW6A 4IQGA 9LDTA 1Y9AA 3LU1A 5B4VA 4RO0A 3HHPA 4OAQA 3ORFA 4R9SA 3KUXA 3K73O 3H9JA 5BSGA 3HN7A 3LC2O 2WTBA 1LLDA 5T57A 3KTDA 4D0SA 1SMKA 3R1IA 5U9CA 1P1KA 3C8MA 4R1UA 3ZV3A 3GDFA 4R1NA 3ROQA 1PJ3A 3RUHA 3CZMA 1IZ0A 4CLRA 4LK3A 3WGGA 3ONEA 1B7GO 1Z6ZA 3G1TA 1Y81A 1FF9A 1CERA
chains in the Genus database with same CATH superfamily
3U7QB 3K72B 1V8PA 2NYAA 4QXRA 2FQXA 4BBZA 1U0FA 2FMIA 3UGJA 3BTSA 3CUVA 4ZHSA 4ZRDA 3H7IA 4UC0A 1T5HX 1I36A 1OHHA 5E2BA 3FM9A 4IXDA 2BZ0A 1NHWA 2X8AA 1PJAA 2RCNA 5F52A 2QTNA 2IODA 5EIXA 3CVJA 4K2AA 4AKSA 5JSQA 4A6XA 4KWIA 1P9RA 3P97A 5AW9A 1SAYA 2OCGA 4J91A 5DOZA 4EHJA 2Z5GA 2JHFA 1L4LA 3IEVA 2PD3A 3O4RA 4YS6A 2Q3DA 1PFKA 1N2CA 3G2MA 3IUSA 3T54A 2BGLA 4C3VA 4GZ5A 3IP1A 5L95A 5BOVA 1RLOA 3L84A 2WG1A 3QBJA 4JA2A 4N8SA 2HTEA 3BPSA 2GBCA 3SIPA 1KAQA 3AR4A 1YZ3A 4HGNA 4Q3LA 3UJ3X 5HIAA 2GPAA 1ZCJA 2ZWVA 2ZB2A 5JALA 1KI4A 2BE7A 1U81A 2G83A 4RMNA 3UWDA 1HORA 4M0KA 1FNBA 2YHSA 2YNMC 3AQ4A 3QLVC 1VIVA 3Q0EA 1INLA 4QO7A 2H0RA 1JYSA 4DLZA 5HXAA 5FO0A 3I32A 2WIJA 2J1LA 5IK2D 1X3LA 1KFEB 1W4ZA 2JHCA 2P62A 2Q6IA 2VYND 3MGGA 4KFSA 1VE7A 5JXWA 3A2KA 4K9MA 3JD2A 4V0SA 4YV0A 2C9OA 4D8VA 3R9XA 4NTZA 2E4YA 1ZWKA 2HQ1A 4KOAA 1J20A 1U6JA 1ZG3A 2V7BA 1NMSA 3K9FC 2GZHA 3A9TA 5IJXA 4P84A 3K9BA 1V8FA 2JGIA 4TSRA 3SF8A 4C6HA 1OB5A 2AQ8A 1TVKA 1GSHA 2HUNA 5IC4A 2B83A 2HDNB 1Z15A 4G8BA 4AY4A 3SYLA 3KD3A 1GSIA 2FW8A 2Z8XA 3GA5A 1NXOA 1LLQA 2FW6A 1R5OA 1Z4LA 2XMZA 4D6PA 5B12A 4COOA 3DEYX 1JEEA 1XNGA 4LHEA 3FI0A 1NU6A 1R6DA 2HC9A 4ZAVA 4ZYXA 5J2TB 4I4TA 5IVDA 2FMTA 3KYDA 2I4NA 4CIXA 2FHSA 5KS2A 2UXBB 1FRFS 3DMDA 3DVLA 4EFNA 4IPTA 1EUCA 1QBGA 2BCGY 1SKYE 3ZV5A 3WAGA 2GYWA 1XFDA 3GBSA 4YEDA 3RVRA 3KU1A 3STWA 2Z4TA 1GN8A 3DXFA 3CNBA 3O2SB 4P4LA 1WB9A 4BNIA 4E5MA 2VL7A 1NVMB 4QPCA 4H6XA 1A9RA 4CKBB 1N3IA 1PL8A 1FFGA 2CXXA 4TM7A 3QXSA 5EHQA 2FXIA 1EK5A 2Z5FA 1PQUA 1BEEA 2ZRDA 2RGDA 3DCYA 3PSAA 3DVRX 4G1CA 4P1ZA 1Z82A 1XO1A 3PD0A 1FP4B 4FDLA 2C2HA 2ZVJA 3KVNA 4EYGA 2IUUA 3EQ2A 1DAMA 3N8GA 4OLJA 1W30A 2GPWA 1BX3A 1Y37A 1HT0A 2R85A 2CCKA 3SLGA 3N05A 3DKIA 2Z1MA 4FCCA 2JH3A 1SIOA 3TZEA 1GT91 5LFAA 4FR0A 3RAPR 3I73A 2WW8A 4RNCA 1VPEA 1VE9A 1FNMA 1E9VA 2DUNA 2GCPA 3ZGXA 4TS9A 3AEQA 3CZ4A 3EVFA 1ZVMA 1P2VA 3JQ7B 1W52X 3GL9A 1G9XA 4MVXA 3IIMA 1LLUA 4DGQA 2DEUA 2F17A 1TM4E 4Q4JB 1KU6A 5G4LA 1YRYE 3UM9A 4WASA 4G4SP 2RONA 4GI5A 4LEIA 5BN3A 4HJXA 1JKMA 5AK6A 2H92A 3HFRA 1HE3A 4S12A 4DRZA 1WMEA 2R1VB 1W5AA 4K5QA 3PXUA 4ZHQF 2C9ZA 1XELA 1T3ZA 2XB6A 2XOKD 1T0IA 4GZ3A 1N2XA 5C4MA 2DBVO 3GGDA 4OLAA 2VPYA 1P7PA 4UDXX 3WNVA 3UKDA 1GUDA 4A7PA 1P2FA 1Y3DE 3DF9A 5D00A 4QDTA 1BRMA 1T35A 2X5NA 4NQZA 1I7LA 3BF8A 2XUGA 3TRJA 2DWCA 4ALKA 4Z4HA 13PKA 1VJRA 1QS0B 4GX1A 1TKRA 4BFZA 5DNAA 4CEJA 3U48A 1XDSA 3EVTA 4MUGA 1EDEA 5CVDA 1EFCA 3HBJA 4EA8A 3GD7A 2PYDA 3U4CA 1TM3E 1CIVA 2GVZC 2MSEB 2HMTA 4RV4A 1RWPA 1O2DA 3UWOA 4ILKA 1ZVKA 2I29A 2HTFA 1ZIYA 4ZPXA 2C2OA 5T4HA 3RI3A 3EULA 1Z22A 3B1YA 1DC4A 2X3YA 3WKDA 3WQRA 1QHYA 5ADUS 1GL9B 2OB2A 5D85A 2A9RA 3BX1A 4C5BA 3VA7A 1GU7A 3KQSA 1U1IA 5EFOA 4YQZA 1G3RA 2J3EA 2VNSA 1TGYA 1G16A 4MI1A 1PYGA 2A0XA 2GD1O 3JQ9A 4Z9FA 5FBKA 2WWVD 1E96A 2JZNA 3VQTA 4RZIA 4RX1A 2EW2A 3EIOA 4WVFA 1LC3A 2H63A 3RUDA 1PJRA 1R4ZA 3RHFA 1SVUA 3GFFA 3WAKA 2B4YA 3LY7A 5JSZA 3CY6A 4NK4A 1VPWA 5BWCA 3INTA 2FQWA 4ZO8A 3FPGA 1P75A 3LRTA 2VTBB 3NOXA 3F71A 3HS3A 4M0UA 4UPDA 1DC7A 3RBAA 4HY3A 4P5EA 3QELA 4BU1A 4N7RA 4XJVA 1K27A 4NF2A 5AW0A 2NTEA 2ZE8A 4BVHA 3M6XA 5CD1A 2RH5A 4N6OA 1UT5A 4AXXA 4ID3A 4ZQEA 5E1MA 3ADDA 1E79D 1OKKD 4ZVNA 1TZCA 4ARZB 1D8TA 5I7UA 2UVDA 2X77A 3F4KA 2BKLA 1KZ6A 2AN3A 2RC5A 3FTDA 4P83A 1NN0A 1FLDA 5FOSA 3JAWA 3MW8A 4NZOA 5LYJF 5DBEX 1NN1A 4JQYA 5KNCA 4GO1A 3JQQA 5C8VA 4FGWA 4AW9A 1IY2A 3DBRB 1QFMA 1B76A 3F9IA 3GRKA 4ZI3A 3MWFA 1FYWA 2JLUA 3ROXA 3OOHA 1P91A 2V6GA 3C8UA 4GP9A 4XB1A 4RGQA 1OXBB 2NZWA 1EQAA 1RQGA 2LW7A 4I5DA 4L5YA 4RJKA 1LPSA 3LHKA 4O4LA 1MNAA 3MZ0A 1ODIA 5EIFA 1JG1A 1U2ZA 1IY0A 3QYPA 5EEGA 2FTKE 5EWJA 2DQZA 3AHJA 1YI1A 1YZQA 1PGOA 4JELA 3EGIA 3DOJA 1ZL2A 4G1EB 2ZAYA 4LMBA 3L2OB 3UAZA 2EP7A 3PQFA 3TSAA 1WW8A 4G0WA 2VJPA 1AKRA 4O2LA 2VNJA 3KWLA 2QMOA 5B3KA 3NYQA 1TO6A 3KEMA 3SS7X 4H0NA 2JVIA 4E4TA 5L9AA 1S2DA 4JT8A 3KVOA 5IJ9A 5LP6B 4GMXA 3MWKA 1T2NA 3W5JA 3AESB 1GZSA 2XMRA 1NNI1 2CVQA 3I72A 5EY5B 3HO1A 3L92A 3OETA 1XTJA 4IHJA 2G1KA 4E2FA 5JFGA 1VL8A 4KWEA 2D0OB 3PC4A 3DL4A 2ZS8A 2W2XA 3GJ4A 2D7CA 4PFSA 1VJDA 2I7CA 2QRPA 3LZ6A 4IO1A 3D8UA 5BWMA 3OQ1A 4JOSA 3C2QA 1MG5A 1WB4A 3WMEA 2ZPTX 4HDRB 1T91A 5MF6A 1KZYC 1Z2OX 1Q11A 4YGXB 4CIDA 1Z75A 1KSHA 2CL6X 1XFAA 3RU7A 4G24A 4RD1A 1H3EA 3EZ7A 3R5JA 3R9KA 3SR3A 4DLWA 2R5WA 5I3ZA 4M1MA 2HADA 1C3OA 2ZT6A 4TMYA 1LK0A 4DNQA 5LQMA 4LJRA 5DT9A 2ZZMA 4PFKA 3EH2A 3HNOA 4TV9A 2OYRA 4ERXA 2EQ5A 1QYCA 3A1VA 3N8IA 2YJ6A 3GPBA 4M1YA 2I03A 1RXYA 1TMKA 3QA3E 4G84A 5C4GB 3FWZA 4MWGA 3T9EA 1IZZA 3C7KA 1VP9A 2CBGA 1BEUB 1DO0A 3F9RA 5JOQA 1LF5A 2YN2A 3UJ7A 1ZH0A 3KVYA 3S2UA 2Z83A 5ELXA 2HMVA 3I04A 3U19A 2B4KA 1XUOA 5GZ3A 1V8OA 2DTEA 4DLUA 2WZDA 1T1RA 221PA 1KJJA 4BV2A 4D4KA 4TT8A 4W82A 1IZ9A 3BMNB 3DV0B 3IIJA 1AQUA 1GPWB 2PQ6A 4DJFC 4JU9A 1ZKMA 3HB0A 1T6XA 4DY4A 2LWIA 1UP6A 3SYKA 1T24A 3WSTA 4NP6A 3OLZA 1OZFA 2OSVA 4DR4B 2X6TA 3ISTA 4BRSA 3A9WA 2OA0A 2N75A 3MWYW 1QK3A 3TOZA 2UDPA 1U5BA 2V8BA 4PLPA 2I6QA 5HRCA 2AFHB 3H11B 1BX1A 3RS4A 3I6ZA 5DH9A 1NURA 3WR5A 3JWGA 5FBWB 1Q17A 2VI5A 1H2BA 2Z57A 5ANRB 4PSAA 1I7QB 4TWZA 5CDFA 4DBZA 3PHHA 2QLFA 5DRTA 1V5WA 4Q15A 4OUDA 1L4EA 2GNAA 2REQB 4LJ7A 1OI4A 7AT1A 1JJBA 1DJPA 4KDFA 5C32A 1YE8A 2KLHA 2FJ0A 2WJIA 3DZ8A 4G5SA 3I76A 1QJCA 3D6MA 3CG4A 5AI8A 4BGVA 3ZLTA 3F0TA 1P2DA 1KEUA 1RJ9A 4PIVA 1Z0FA 2W2KB 1ZK3A 1XPJA 4Q12A 1EFDN 5FULA 1ODCA 3OEHA 3OCUA 4QYIA 4L6AA 2BGKA 1F20A 5B36A 3AR3A 3AR2A 1UC9A 2PS1A 3H75A 2XDYA 3FPLA 3L8DA 4GP6A 4OHWA 1E5DA 3LVRE 2CHUA 3FDIA 3B5IA 1MENA 5DI9A 3WBFA 5J9FA 2A9PA 2YQZA 4J1QA 5F2OA 1MC1A 8ADHA 1KTVA 5TMDA 3UHJA 3GCWA 2GXSA 2C2XA 1J8FA 2QEQA 3P0EA 4IM7A 4LOHA 4BO7A 5ITZA 4D7AA 1T9HA 1J99A 3CF2A 5EKXA 3O8OA 4EUSA 3OEWA 3DCIA 1WF3A 4P4NA 1Z0DA 4QJBA 1QKIA 1MIOA 2YH2A 3KV3O 5DVZA 2PKYX 5J5CA 1NM5A 4JJ7A 2AYXA 1W46A 1OH8A 4KPUB 1T0HB 4BQEA 4GPD1 2A5JA 3VZQA 4D96A 1OA1A 4J0FA 4C6TB 1BDHA 1WXXA 1C4OA 1U4OA 3GQVA 4K6KA 1R8XA 5JH7A 1ORIA 1X1DA 5LC1A 3VMMA 2W6JD 3INGA 2W6OA 4UAJA 1XQVA 4DPLA 1WUYA 3OTWA 4P3YA 1U9IA 3NHFA 4HQ0A 3I8OA 1C29B 1UT8A 2DBRA 2SECE 2P6UA 3DS8A 4IJKA 4PTZA 4Q6WA 3IBSA 1BWQA 4YAWA 1D6MA 3W9UA 5JECA 1Y8QB 2B7BA 1I2DA 2PMBA 3OX1A 3Q72A 5GADl 3B1JA 1A4XA 4MULA 5JS2A 2HZBA 2JDIA 3QEJA 4FC7A 1GNPA 1UXKA 2P9HA 4HEA6 1Z7YA 1L5NA 4F7DA 3G8BA 6Q21A 1SXIA 1UZAA 1Y1TA 3CV3A 5AXCA 5ENDA 4IKPA 1D8AA 3MCWA 2XVAA 3PENA 4KIFA 4F3RA 1A2OA 3EXIA 1PLJA 4MV3A 1DUIA 2X2OA 4R3NA 4TVKA 3FHOA 1AS0A 4D41A 4DSAA 2PJZA 1N0UA 6ADHA 4JC0A 3TGWA 2QNIA 2VQFB 1MKYA 3NALA 3UK0A 3VH4A 1OA0A 5EP3A 3CXRA 5I8PA 2OYCA 5H3CA 1RMYA 3ZH9B 3GFQA 3O91A 2JLZA 1GTRA 2O2JA 3WLPA 2VJMA 3SS8A 4HUQB 3CH5A 3RYIA 1BDJA 1L7QA 4RTSA 1JDNA 3GU3A 3K1AA 1CZLA 1OAOA 5L6MB 3TPFA 2JATA 5IAOA 2ZRJA 2D2XA 2OAQ1 3OJWA 4TXLA 1GZ6A 1D2MA 2NUBA 2ZKLA 3EMDA 2OGUA 1O5OA 5I9MA 3SXUA 4AUEA 3NVAA 4Q6BA 5F78A 5K4GA 1VPVA 3VO1A 3BXHA 3Q87B 4OQMA 5CDTA 4FIZA 1UWKA 1DKPA 3KDAA 4EUNA 1KFBB 5LKRA 1RLJA 2VP6A 3U3OA 3HSKA 1JU3A 1CS0A 3D3JA 4M0EA 4NWIA 2P9ZA 4WVLA 3DPUA 4UHDA 1JKIA 1DOZA 2GZMA 2OHXA 5P8WA 4F04A 1BCSA 3W1VA 2EW1A 1EPUA 2W2LD 3WGHA 3G79A 4B40A 4FX5A 1G8SA 5F3WB 3F6CA 1ZM2A 4KXVA 4I4TF 3BBLA 2X9VA 4XCVA 1FDUA 1WSWA 1L7DA 1IWPB 1IWBB 2O7VA 1X39A 1QQ7A 1UPBA 2Q0SA 3KFVA 3OZRA 3PEFA 2ZYGA 5GV8A 3JZDA 4QZVA 3HY4A 2FEWB 1MC4A 4UU1A 1YZYA 3N2YA 1TAQA 4DV6B 2DX7A 4FYXA 2HHJA 4QDJA 1R0LA 3NXKA 3MQ4A 4D80A 1JW9B 3LLSA 4MYSA 1L5OA 1J2EA 3NBMA 4NAHA 4QL3A 1O57A 5CIQA 1FP1D 3URKA 3ZK8A 1XZFA 2HM7A 3OEED 1RHQA 4E7OA 4TV8A 3V6MA 3L40A 4G0ZA 3UJ6A 3M5DA 5BV2P 1Y82A 2HU2A 1A1VA 3A7DA 1U0EA 3FMOB 2YICA 4PHGA 5GJWC 2H7XA 2A78A 3WZ2A 4LWZA 5TQ0B 3M83A 3SJCA 4ZVMA 4CIAA 4KPEC 3NHPA 4Q4CA 3EIEA 2Q4TA 2XXAB 4OHXA 2DBYA 4H3SA 4WNAB 4Q3CA 1QTIA 5CB8A 5I9LA 2HPHA 5HP4A 3DLIA 3B5EA 2VRNA 4F6RB 5FUQA 3ZDAA 1M10A 3U44B 2OZVA 4HRAA 4L9AA 4JGIA 4KE6A 2PD4A 4LOJA 4B79A 1TAHA 1Y7IA 1FFXA 2FJPA 5HFAA 2F8MA 3A32A 2BGTA 4OLHA 2HDWA 3P9SA 1M3SA 2HKIA 1D4OA 4D3XA 1QR6A 2NU9A 3V9AA 3CX4A 5LJIA 2R8OA 2UZ0A 3N8KA 2FPGB 4LY9A 1MJHA 1OFHA 1V3TA 2GNPA 4YO8A 4D8YA 2YW2A 3Q12A 2R47A 1R0KA 2EAUA 3OM8A 3M4XA 5CXSA 1YKFA 3VAZA 5A9SA 4DBLC 5CBPB 3X1JA 3O9ZA 3TRIA 4F9FA 4O2RA 3TMYA 5I7OA 2BM9A 1UBRS 2TMYA 3AG5A 4GLJA 5ALVA 4WJLA 5JASA 3OQNA 1YBVA 2D2IA 4U3JA 1Z5OA 2QVGA 3PEWA 1EXDA 1P1JA 1TW3A 1G18A 1CNEA 3N5KA 4YH1A 1MXFA 4NDAA 3FWNA 3R4VA 3HZRA 1N7JA 3H9BA 4RKWA 1ESEA 1TGVA 2HYDA 3EXFA 4ZCPA 3HB5X 1U28A 3JQFC 1ZI6A 1A5TA 4KN8A 1KRWA 2YXBA 1NF9A 1WULS 2YIVX 3SKXA 2OV8A 1FFHA 1T0UA 2BBWA 2B9VA 3HN6A 1SU6A 3WNBA 2OO5C 4QOFA 1NUUA 4OI0A 2W6CX 4KQ9A 3Q8KA 4M0FA 4DM4A 2ZSBA 3QOWA 4M6WB 1ZLYA 2H1FA 4FOSA 3S0JA 4NOLA 4BXOA 3JATB 2H5IA 3H5AA 4LXXA 3HYTA 4PCAA 1C0PA 3CNEA 4UQPA 4X8OA 1N7IA 3IHKA 4J16C 1HFEL 5IG2A 2CXPA 1HSOA 1K8XB 4RQUA 1KZHA 4WNYA 3KKZA 5HF6A 1J39A 1NW8A 1O03A 4UEKA 4NJEB 3O1IC 1SCDA 3MWDB 1CETA 4EG5A 4BZZA 2ZT7A 2CFTA 4EI2A 1ODTC 3UZUA 1ZY2A 2NPFA 4LOLA 2XGSA 1N6PA 2OSBA 3QITA 2LZ0A 3M7IA 4FCWA 4GQBA 1GY8A 1PR3A 5IZCC 1SUIA 2ZIEA 1ZA1A 4RZQA 2GESA 3ULKA 2EHJA 2R62A 2KM1A 1X7YA 5M04A 4YHBA 3IERA 4IDAA 4O6VA 1P1CA 2VK4A 1VMIA 3SPXA 4URUR 4EUHA 1C4XA 1FU7A 5JSHA 4MW7A 3ZN2A 2BHTA 4KI0A 2QUBA 1KK1A 3EOZA 3LQ4A 1G5RA 5AVWA 3K0BA 1WLYA 7REQB 2CLSA 1LBEA 1PU2A 2O1SA 1ZMRA 1AKUA 1DXHA 2G0TA 2PH7A 2WJZB 2A4KA 3EQ8A 4CN8A 4DW8A 1RZRD 3O8LA 3FJYA 3LDGA 4OMFG 4G9BA 4RZ3A 4X44A 1T43A 3RK0A 1W2GA 2NQ8A 1D3AA 4RKRA 4PPFA 3T8YA 4QOJA 4DV5B 1WKBA 2EU8A 4HXFB 4BLOA 4UOEA 4OPMA 3KLPX 4ML3A 4DVGA 5K8UA 5HS4A 1E2FA 5AESA 4X1OA 1DKOA 1WG8A 3REOA 3QUCA 3WV5A 5JTTA 3R3VA 4PLWA 3T3HA 5JJ5A 5B6PA 1NR1A 1LRJA 2XODA 3QU4A 1ZGZA 2D00A 2Y1XA 4G0XA 4HB3A 1R4MA 1J0BA 4MWOA 4O4LF 3RADC 4RIHA 1LJLA 1BYIA 4HDQB 2J7PA 4CYMA 1IB6A 4DHEA 4I5FA 3DBLA 5C5EA 4J0QA 3MLBA 3CUEF 1F0YA 1N92A 3O3NB 3AVTA 5F77A 1CUBA 1BN7A 1NNUA 1Q21A 5E1BA 5J40A 3B6ZA 4M0CA 1UC5B 5DBOA 2WA2A 5KYYB 5JZ9A 1SH7A 1N6RA 1ND6A 1TZJA 2DU8A 3T3DA 1BJKA 4EKNB 2JCVA 2PZEA 2YV3A 3UQYS 1O9GA 5A3SA 4CMCA 3OPMA 2WM2A 4HRXA 1GTMA 4OKNA 1VZ3A 1VRVA 1LX6A 4ZT2A 1T5IA 3Q1LA 5C3UA 5E9WA 5KNDA 2VP3A 1C80A 4HF7A 4IGAA 4LOIA 2VCYA 1TC1A 2PUHA 4EY3A 4IHJF 3GELA 2C5BA 1TM2A 1MC8A 1OVMA 3HFJA 4FHGA 1GZ3A 2QYOA 4XYBA 4FKMA 3DM5A 4A0HA 5C35A 5IDXA 5IH3A 4Y7DA 2VSYA 3TOCA 2OFOA 3UJCA 3G8AA 4UCWA 2D2EA 2Q4BA 1LBSA 4HDMA 4Z0NA 4F1KA 1ZXLA 1GU1A 1UKCA 1O95D 1RRKA 3G85A 3GOQA 3IAXA 3HB9A 3VX3A 4GXNA 5AM3A 5CIYA 3SQXA 2IF0A 2JAQA 2J9YB 3Q8WA 1J8MF 1IQ0A 2H4HA 3W34A 5AVRA 1YI8A 4NABA 4BNYA 4LBYA 1VIAA 5GOTA 1E2QA 2XTNA 1Y63A 3A4IA 1AQNA 1G66A 4Q9AA 4TV9F 3LQRA 4BNHA 4ZIRA 5JQGB 3GCGA 4QUHA 3I23A 2C2GA 2OENG 5H7XA 4EJ0A 1VC2A 4YQYA 2H8GA 3I2HA 4M8IA 1PI3A 3WL3A 5BYKA 1G3QA 1NJ6A 1XEXB 2BM1A 2LD4A 2ZETA 1KYIA 3A11A 3TEMA 4E32A 1SG6A 4W4TA 4WERA 4A2QA 1VJTA 3SJ7A 2CYBA 2OZPA 5H3HA 1MUUA 2A92A 2EXXA 2QLJA 3NC1C 5H3LA 1CUXA 1MIHA 1YRAA 2JD0A 2A9OA 2ACVA 2XTAA 4KUEA 1L5HA 3UC5A 1XR3A 1CQJB 3QBEA 1TKAA 3ZJYA 3RPEA 2IVFA 1TPYA 4RD2A 5L3RA 2UXCB 3P94A 4CKWA 1RADA 4MVCA 4OFBA 5LZ8A 4JVMA 1W1UA 5JAQA 3SZLA 4PLZA 4DNXA 2EG5A 1MFPA 5KQGA 5DM1A 3IVCA 3KJXA 3OX4A 2WJGA 3PNLA 1U2GC 1P4RA 2VPTA 3D64A 4DJJA 4H4CA 3FSGA 4KO4S 1E9CA 1M2EA 2JFZA 2GPBA 3RYTC 5EUMA 1AK1A 2CVPA 2P8JA 4LVNA 1PV4A 4WFKA 2H2GA 4TTJA 4C04A 1BDIA 4KLZA 4LCEA 1DIOB 3KRTA 1ZH6A 3DUFB 1R37A 3AOGA 4F56A 3C41J 2VSQA 2PMKA 3ABIA 3FLEA 1XMVA 4QAQA 5AUPB 2XUHA 3COYA 3UWSA 2O2EA 3H5LA 4CM9A 3B6EA 3ZZ1A 5C8DA 3BGDA 3MINA 2DCMA 2WWIA 4G01B 2XMPA 4Q00A 1QG4A 2Z8YA 3TLZA 2WFLB 4FTWA 5HZMA 4PNPA 5DYTA 4W8HA 5J3JA 3RSCA 1K5GA 3OBIA 4MVJG 3FHTA 4DIMA 3REGA 5DK6A 2PXCA 3AIIA 2FK7A 4FZRA 5DHQA 1Z6YA 4LJLA 1C7RA 4UCFA 3K96A 1Y8RA 4HADA 3AF6A 4JOQA 5L6LB 1UQUA 2R68A 1FRNA 4P93A 5B3JA 5BYJA 1YIOA 3IO5A 5I4CA 4WT7A 5K45A 3AUYA 1F8FA 1JQ5A 5EI5A 4YCMA 1TFUA 3TIVA 4PRZA 2I7TA 1I3CA 1GYRA 1P5RA 3DMHA 3MIZA 1QFSA 1MO4A 4V0MA 1H2AS 3IA2A 4Z4GA 4WK2B 2YMLA 1WUIS 5AKYA 2QTLA 4QVIA 1ABEA 4EJSA 5KQSA 1T15A 3NTVA 4IRUB 1FUKA 1E60A 3C5VA 3CYFA 4P92A 5H82A 4UXHA 5C1IA 5EXEA 3W05A 2X22A 1JFSA 4CKEA 4ZHQB 3P2MA 2YVUA 1HL3A 1DMRA 3BL6A 3DTTA 3ENNA 1A4IA 3O4IA 3C87A 3OIGA 2WZCA 4CKCB 1AHNA 5JH7F 1UDWA 2XVYA 2EF0A 4EBBA 1NVFA 4OVKA 4LRTB 1F48A 2F43B 4QLOA 4CDRA 2BLLA 2KX7A 3AY7A 1AKQA 3EXHB 1J07A 3HXKA 3IQHX 5EJGA 2HO4A 2UUCB 1I4DD 3IUMA 3L4SO 3DDWA 1RIFA 3T5CA 2YZ7A 2J5BA 1UR5A 4H08A 4BNGA 2W83A 2EJBA 5AKEA 4C29A 2CJFA 1K5HA 2GETA 2QAGC 5HQTA 4DXAA 3L6CA 3TLKA 3MQFA 3H2ZA 3NUQA 3QFRA 2WYWA 2ZJ6A 4Y2VA 1ZUNB 3AVQA 5DIZA 5LNK1 3OEYA 1KOGA 1P19A 1V1RA 2NTYC 3IOYA 1HQYE 5EHGA 1G98A 4LI0A 3N8DA 4N18A 1QHIA 3F5SA 3T4UA 3WLKX 4HXYA 4MO9A 4BNFA 1E5TA 4U8HA 1A2KC 2I7VA 3AJ8A 4UEQA 2A86A 3D0KA 1E1CA 5LP1A 2WHEA 5FWNA 3WTBA 1YCHA 2Q3LA 1G0NA 2WJHA 4MZDA 2JBHA 2C2ZA 1NV8A 2EX4A 2PR2A 3NHUA 1NQUA 4TXHA 1SK8A 5SZHB 1VJGA 3QKIA 3I1YA 2FE4A 3NUZA 3AGPA 2AOWA 3W4KA 3EZXA 5LD2B 1VJ1A 3HTXA 1USGA 2QB5A 1K4YA 4YMTA 1BKYA 3RO7A 3T35A 5JJIA 1FY2A 2DKFA 3M89A 1JHQA 5MHTA 1DJOA 5AVKA 4R8LA 4BATA 3KP1A 4CCYB 3DT6A 2N46A 2EYQA 4EHKA 3L6EA 2OFWA 3L1VA 4F2GA 3UY4A 2VKQA 1JR4A 5ALRA 5CITA 1BXGA 1MX5A 1HOTA 1VMAA 3P26A 2R79A 5H4GA 1E1MA 2JIZA 3K5HA 3W7AA 3AEXA 3OU2A 3KKMA 4B74A 3CR8A 4KV7A 3UCXA 2ZBRA 1RIIA 4BDSA 3B3QA 1TJNA 1N6HA 2QTHA 4UE3S 5AFSA 5BQ3A 2Z1NA 1IDOA 5DP2A 1NXWA 4RF5A 4DWJA 2XWPA 7MDHA 1N6OA 3P52A 4NDZA 4RMGA 2LKCA 4NEHB 3SDBA 3OT1B 3VOBA 4BNDA 5JZMA 3RFXA 2D7DA 3NHKA 4AK9A 5KDDA 4E08A 1IY9A 2DYKA 2OAEA 5KZMB 4QNMA 2RHTA 4H6WA 3U40A 4F6CA 1LSOA 3V00A 5BP7A 1U1EA 4TYNA 3GEGA 3OTOB 4AYXA 4F71A 2YHBA 4M1TA 4F72A 2HXSA 3CO0S 5C1PA 2VRCA 2HWWA 2Q2OA 3BD9A 4MIOA 5ER6A 1S3GA 4DWOA 4NYJR 2C9MA 3P0JA 1OLXB 4M88A 1FDTA 3JR3A 5EXPA 1F1BA 3PHBE 1NUTA 2GUWA 5G41A 4MX8A 5JNUA 3HY6A 1E6LA 1XCMA 4D3FA 4Y2TA 1RYDA 2O2YA 2ACWA 3P32A 1YZNA 4FMDB 1V3QE 3VR2A 4X64B 4CDMA 4D82A 4MS1A 1EFVB 5ELMA 1E3DA 2HWUA 2WT4A 1N8TA 1M8KA 1PJTA 1F2TA 1BKDR 3AT1A 2F62A 4M37A 4QU0A 4H59A 4IIDA 3NM5A 3VISA 4DT1B 5CH5A 4A73A 1LBIA 1AKMA 3AF0A 3I9KA 1FC0A 3G8YA 4DCOA 4ZDJA 2XT0A 3DONA 3DVSX 2YW9A 3BTUA 3KM0A 3EXG1 1ADBA 3HPQA 3PDUA 3NRBA 1WZIA 2O7QA 1UBKS 3DBVO 4IIGA 4CMGA 2BRUA 4DIFA 2KQUA 4JR0A 1I6LA 1UBCA 2W2TA 3ZHBA 2OHVA 4MS4A 5LOVF 3WLIA 1YJAA 1G3UA 2F64A 1B3RA 2XHEA 1SNYA 2WBLC 3N2IA 4LY6A 2X7XA 2XX3A 1CPYA 1Z4QA 1NGSA 4Y6LA 3UJ8A 1CUFA 3OCWA 1H4QA 2BSXA 1IHXA 3ZYZA 3X1DA 2LR0A 1ECJA 1ZGAA 4HCJA 4MVJM 3NOOA 5F5XA 1BIFA 1U8ZA 5YASA 2H85A 2HBRA 3I8SA 3AHFA 3M6IA 3DC7A 1UFOA 4E5YA 2VLBA 4MUXA 1YB6A 2ZIAA 3IUJA 1QPBA 3SQMA 2ACEA 4C1NA 3B20A 4OBBA 2PV7A 3G9UA 1LRLA 5BVHA 1JQEA 1RWBA 3R74A 4DABA 1TF5A 2EZ9A 4AC9A 1YD7A 2YZ2A 1HI9A 2ZUWA 3I42A 3ISVA 3IV6A 4H7HA 4XX0B 1K6IA 3V7FA 3VRHA 4EG3A 1GRQA 1I2MA 3A04A 1TYZA 3BJZA 2CF6A 1A1SA 2FOLA 2A6PA 4XVQA 1CXZA 3LX5A 5CEFA 1KWKA 1N77A 4K6FA 4KO1S 2ADOA 3E5HA 4J03A 4XR9A 4W5HA 4NMWA 1TU0A 1E2UA 1ZQ1A 3JVIA 3R09A 1WSDA 1DC5A 1IUPA 4B2LA 2NVUA 1V48A 4G41A 3SHWA 1QP4A 3DMGA 2ZUCA 3LECA 4LBVA 3ZCVA 2PGNA 1CLUA 4TWBA 4DA6A 4AZWA 4MEBA 3A6DA 2Q5JA 2I34A 2DERA 1OLSA 1WB5A 4LJYA 3W79A 4G5OA 3QWFA 5CCDA 1OAAA 2YWGA 4KQIA 2JIDA 5C31A 4AZ0B 1Y8ZA 2VDOB 4PSVA 2AG5A 4MKRA 2G9VA 3EZNA 4N5LA 1D5WA 1RSZA 3ADBA 1XKLA 3FWYA 1WZ2A 4CBVA 4Z99A 1YHYA 4IH9A 1U0JA 2GD0A 4J0GA 1XRMA 4QJ5A 3D81A 3NBUA 4Q7LA 4BKOA 2J3HA 3AM1A 2J3JA 5EHZA 3FYUC 2ZJOA 2J6BA 5ERXA 3IODA 2ZSIA 1W4BA 4L6CA 2HA6A 1L9XA 1KDYA 3U2QA 3HO8A 4IWYA 4ZYUA 4YJ2B 1SBZA 5LN1A 2C5AA 5L3SB 2XMCA 1FTSA 3VUFA 1QK5A 1ZU4A 2X19A 3EXHC 2H07A 4B3JA 1JHOA 2WKSA 3EEOA 3LT5A 3M4ZA 2JGRA 2C5GA 1VYVA 4NZPA 2QR5A 4MRPA 3BDIA 4MKIA 1CZUA 3P2EA 3QE2A 1R66A 2ECKA 2O3JA 3D8RA 2ET6A 4Y18A 5H70A 2QYTA 4QLBA 2GK7A 3GT3A 1YB5A 3FD8A 5IDWA 1F12A 1IVSA 2DXIA 1P4SA 3T0GA 4U8GA 1FOEB 1G8HA 3VHLB 4JI4B 5I48A 1E2BA 4ZOLA 4ZCSA 5GMOA 4XUEA 3UFXB 3QE9Y 3PQCA 4OATA 5BNWA 2OV1A 3OHPA 5IMBA 4DF3A 4M1ZA 1U6IA 3NX4A 4JC5A 1LDEA 3L7MA 4EZBA 1RQNA 1X8LA 4EIWA 6NULA 2WT8A 3LCRA 1EXWA 4R1PA 1N2CB 5GZ6A 1CRZA 1CWUA 3R7LA 4DA8A 2QLLA 4BE4A 2W37A 4BP3A 4BTVA 3MOGA 1Z6XA 1IJEA 4C4SA 3SOPA 3O8RA 4N5IX 1B73A 1FVHA 4YP6A 4CF7A 2DLCX 1I2ZA 1THMA 1YFZA 4ZO7A 2Z9BA 3AB3A 4OXXA 4PRLA 1N1MA 4OK5A 5DNUA 4MUKA 1F9AA 4GLBA 3O95A 1PS0A 4V0QA 1DX9A 4LAFA 3BSFA 4J4TA 2PBRA 5KPJA 5TS3A 2DECA 5A4IS 1OFGA 1HKHA 4B1FA 2Z5VA 3HU2A 5B7NA 4LF4B 4I1RA 3MB8A 4JLOA 2CMKA 3R9XB 3ZR4B 1E3LA 1XTQA 3A3KA 3EPLA 5HIIA 3RIYA 3ZI4A 6PFKA 1ZRSA 4XGRA 3ICQB 1HQKA 3OUTA 1KEEA 3R0ZA 4YMWA 4XARA 4QULA 1RVV1 3NNDA 4M1QA 1A8PA 1JDBC 1HLPA 1X2EA 1Z2AA 1NFRA 3K1TA 2FMHA 4XLZA 2CXUA 3MTJA 1SIWA 4M0PA 3BILA 3ZU4A 2MINB 3ONNA 1J09A 3ITDA 4ZOBA 3ZV3A 3WOHA 4I4TB 2CUKA 3KYDB 3UA3A 3D5QA 5TIIA 3EVAA 3M1AA 4S1PA 4QRDA 3DWFA 4WBSA 4UBMA 1DL5A 2DFVA 1XMJA 1ZUHA 2GAIA 1FE8A 1U11A 3KBBA 4MGZR 4A16A 4K28A 5BQXA 4JROA 2PZMA 3LF2A 4RCVA 1X80A 2PRZA 3AETA 4TSFD 3UT6A 1P1RA 1XTPA 2H4YA 1AUOA 2VHWA 2ORVA 3FBTA 3R6TA 1AHPA 3VNUA 4U63A 1QZUA 2VDKB 1SUAA 1R2QA 2HCBA 1MRSA 4TYYA 1O6BA 3PC6A 5FUXA 5JY6A 1SIBE 3FF4A 4D3YA 4F3TA 1UMDB 1UFVA 2Z6AA 1M6VB 4L08A 2J3LA 1JSLA 2JAOA 4LYHA 5AOBA 4UDNA 1Q1NA 2HCTA 1SR8A 2NV6A 2NU7B 2ZGVA 3QQ5A 3U4HA 3G88A 2ZTLA 4BRWA 4F6LA 4Y2XA 5TS2A 5K05A 2WWRA 4UJ3A 4FQ7A 2PPLA 1YQGA 4C87A 1EWKA 3G7SA 2VT2A 4M9SA 4D9NA 1FXSA 1OWPA 2W48A 3Q3VA 3C3EA 4RHCA 1GG8A 1RZVA 1LA2A 5HGJA 4EFKA 4RY9A 1JYEA 3AHIA 4RBNA 1V43A 4LN1A 2HQOA 1QG2A 3DAYA 2VQDA 3EFBA 3OZVA 5ILGA 3S2SA 4CKZA 3NP7A 4NLLA 4AX8A 5LQKA 2E6KA 2WYHA 4LWQA 1NJ2A 2ZPUA 3K0FB 4U7FA 3UK7A 5BVGB 1I4WA 3R3SA 2FN8A 1KMHA 1OQAA 3OZXA 4P4SB 2VJOA 4AFNA 4KR3A 3RHSA 3NP9A 1Q57A 2P9BA 3P2KA 3SBDA 3UAWA 4PSCA 4C88A 3CS3A 4BVAA 4IWNA 2J5XA 3NYRA 1PSWA 4XJSA 2BI8A 4QPDA 5HFJA 4OXKA 3HP1A 2BMWA 2WNIA 1T5OA 3IXLA 1JXOA 2ZVDA 1EVKA 3IAEA 1I6WA 1SUPA 4WL0A 1EUYA 1JGTA 2IV3A 1SBHA 4L8FA 1N75A 3CW9A 3QKTA 2F8SA 3IAM1 1GAJA 3H9GA 3HUTA 3N76A 2O8EB 1FCJA 1V5IA 1ZBQA 2LGJA 4X1IA 4OQZA 2UVPA 1AGPA 1KVTA 2SKEA 1JFVA 1R0RE 3WRYC 3ONWA 4HB4A 5HG0A 4CEJB 2I2FA 5AKKA 3T1YB 4X85A 3ZGLA 1JXAA 4LHVA 2BDTA 4LYGA 4N5HX 5EZYF 3ETDA 1NP6A 2H59A 4KYUA 3MUFA 3OD5A 3MXTA 4S3MA 4IQFA 4G85A 5K3FB 3FCAA 3H0KA 3SC6A 4UBLA 1EQUA 2AI2A 2Y1CA 4YNBA 3RFCA 4B75A 3HCOA 3KQKA 1FZQA 1N8SA 1UDBA 2Q9UA 3ORRA 2YRXA 4Y1EA 3LTNC 2FSFA 3L4BC 2X0KA 2Q1YA 1JSZA 2IOFK 2DQSA 2I76A 2K5UA 3JQAD 1JLLA 1RYHA 2MMCA 1CUCA 1GPH1 4II7A 4PRYA 4R83A 4XB6B 4KDEA 3TH5A 4OOEA 3BRQA 4AO6A 2I54A 4LJSA 5DOVA 3HY3A 1PLKA 4FFRA 4GC9A 3T9FA 5J2UA 5J4YA 5KYKA 4CM6A 1K9VF 2HO5A 3T5GA 1X7GA 1KJNA 2HHLA 2AUTA 2JL1A 2GFQA 3MFQA 4FZVA 2RKBA 3W5BA 1GDTA 1KI6B 4RK7A 5IXSA 4LBWA 1RHMA 2HK9A 4WXEA 4JJZA 1BE6A 1OMOA 1QB7A 3EA4A 3IDSA 4WLOA 4JFRA 3WZLA 2QUHA 5CVJA 1L7NA 5FHQA 1MN6A 4X91A 4UCXA 3AI1A 4FEGA 2WOOA 1GV0A 5HK9A 1YTLA 2JG3A 4TKUA 1RJGA 4HQNA 1F8YA 3KR0A 3RUCA 3HRIA 1V16B 5DLDA 5E0KB 4LGCA 4ARSA 3L8HA 4H6PA 2VHUA 4OL9A 4TXMA 1JB1A 1MC5A 3KQVA 4ZQFA 3W6NA 3R5KA 5C1OA 1GXSA 1GZ5A 2YMPA 2W7TA 4FX2A 4OGWA 1RXUA 4Q16A 3V8NA 3Q8LA 4NJMA 3BXZA 1FLVA 2NZXA 1KC3A 2QSYA 3AC0A 1XCLA 3OZDA 4L4XA 2BHRA 1BE1A 1QG6A 3HVIA 4GX0A 3RRNA 4AICA 4J6EA 3L7CA 4CI0B 3HU1A 4UTRA 5ADHA 5G3ZA 1RLIA 2RH9B 3VSBA 4X65B 4FYKA 3FFAA 1L4GA 3TVDA 4UNNA 4B47A 5AUQA 2O8FA 1N9KA 5GONB 1JHMA 2JIOA 4H16A 4RPKA 1IC6A 1QONA 2PS9A 1R50A 4C7XA 1X9GA 1CUHA 3EEYA 4RAOA 2P9FA 5DHAA 4LVUA 4ZRNA 5TY0A 3VKFA 4EL5A 5C1BA 2FSSA 3AEUA 4XDHA 4EYQA 1K7FB 1SOVA 1U1CA 1VG0B 1Z39A 5EWJB 3CE6A 1AQJA 3SICE 5ES3A 2G1AA 1Y7TA 2FG5A 2NSHA 2RIPA