2A4KA

3-oxoacyl-[acyl carrier protein] reductase from thermus thermophilus tt0137
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
237
Chain Sequence
GRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALPLEAWEKVLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGLGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-Oxoacyl-[acyl carrier protein] reductase from Thermus thermophilus TT0137
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl carrier protein] reductase
total genus 87
structure length 237
sequence length 241
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a4kA00
3GG9A 1IULA 1DIRA 1VLLA 2X9NA 4D79A 3JQAB 1JWBB 1LDNA 4B3JA 3BTUA 3VZRA 4XJSA 3U9LA 2NTVA 5TX7A 5TT0A 4J2HA 2PGDA 1LXCA 1N5DA 2O3SA 4R69A 4MVJD 3H9JA 3N58A 3K6JA 4CM6A 2X58A 2ZKLA 1YQDA 2NADA 1PWXA 5F1KA 5AYVA 2A9FA 1E6UA 1GQYA 2UV8A 3VH3A 2QYTA 2Y1OA 5A5FA 4LMPA 3D3WA 1DSSG 3AK4A 1Y5RA 2TMGA 1BDBA 2CZCA 4A03A 1PEDA 1JKIA 5BQFA 1M66A 1JU9A 2JD2A 3BMNA 1U3VA 4QSMA 1EDZA 1WPQA 2J8ZA 5DZSA 1PZFA 1FDVA 3BXXA 4ZQEA 4AJNA 3HB4X 1KY5A 3G1TA 1DO8A 1YQGA 4M86A 4R3WA 1Y7TA 1DDOA 1HDZA 2WD7A 2I5PO 2EERA 3PYLA 1HYEA 2HRZA 2DTDA 3EAGA 2O2YA 3A1NA 4G5HA 2NVUB 4Q3BA 1X15A 4XDZA 3H4VA 2WTBA 1H9BA 2B83A 3ZU3A 3H9QA 4Z9YA 3T4EA 5CFZA 1NHGA 4YRDA 3EHEA 1C1XB 2P2SA 4E32A 4TKLA 3GH3A 4XYEA 2YYYA 3FPCA 4YJGB 2CVOA 3Q1LA 4BO4A 5KJEA 5JC8A 1BXKA 3B1FA 5HBRA 4PG5A 1CIVA 3ZCXA 3ZNQA 4BNIA 4IQ8A 1JTVA 1P77A 4LISA 3VPSA 4YRAA 4J3FA 3LDHA 4URFA 4MKXA 3C3XA 3KBOA 1VKNA 4Q3EA 3TZHA 2BFOA 3WB9A 2NQ8A 1DAOA 3TRIA 1WMBA 1F12A 1YOVA 5FWNA 1HLPA 4GMGA 1U4OA 1V3UA 2O7QA 2WDZA 4JJGA 5DBGA 1Q7GA 3JQGB 3VDRA 3GGGA 1TT5A 3DXFA 5KJCA 4E6PA 5I9NA 4IDDA 2E49A 1I3LA 3OIDA 2PZMA 1JA9A 5HRUA 1P1FA 4XWYA 4BB6A 1I33A 3R3SA 1X0XA 1H2HA 2O3RA 4AJPA 4E3ZA 3BMQB 4MINA 3UCXA 1JLLA 1H2BA 3I3OA 1SAYA 2OO5A 4NBTA 3WGQA 2ZCUA 3L4SO 1M67A 2O4UX 4ZQFA 4N54A 4PG8A 1JVSA 4Q39A 4GQAA 5JO9A 2EF1A 1B2LA 1V3TA 1KVQA 4OKNA 2FR8A 3H5NA 5A4DA 3QWIA 4BKQA 3I9MA 1MUUA 4E2XA 5L4NA 1G1AA 5I9MA 4XR4A 1SB9A 3D0OA 4S3MA 2VRCD 2HJSA 3MJSA 1NQ5A 1LTHR 2EW8A 1EBUA 5KNLA 4NJMB 4BL5A 2HLPA 2QRLA 3DL2A 1RYEA 1M2WA 5JYDA 2OORA 2UDPA 2EKLA 4Y8VA 4P4LA 4EZBA 1QYXA 1Q2XA 2EP7A 2POQX 4JROA 3GNTA 4HFRA 3ZNNA 3SBOA 4A27A 3NX4A 5JLAA 2Q3EA 2WYVA 1E3JA 4D7AA 2GR9A 2YHUA 4G65A 4RCVA 4EJ6A 1QORA 4FFRA 4EJ0A 2VOJA 4PZEA 4RLHA 3V2UA 1ZK3A 5F21A 2Y1FA 1E5LA 3AOGA 1PJBA 3PYXA 3NJ8A 2C5EA 3EUWA 5ILGA 3MJEA 4R9SA 1TEHA 4FR5A 3V8BA 1B8UA 3ZNOA 1GZ3A 4CM9D 3FSRA 3BHJA 2HAEA 5H83A 3OQBA 3AWDA 2DBZA 2BLLA 3FNEA 3K92A 4FB5A 5MDHA 5MGBA 2QG4A 3FBGA 4ZD6A 3VTZA 1KEWA 1ZSVA 4DPLA 2FPPA 5EQDA 2HDHA 4I5GA 1Z74A 2G0TA 1LQUA 2PKRA 4QEDA 3K96A 1CJCA 2GF2A 3X2EA 3F4BA 1GQQA 1T1SA 2PKQO 1RM3A 2VYNA 4QFDA 3KLMX 4O59O 4PLZA 4WLUA 5A3VA 1AE1A 4OL9A 5BNFA 2I9PA 3WIEA 1KERA 1DIHA 2NM0A 1H6BA 2P5YA 2VT3A 4D43A 5JAQA 2P91A 5THQA 3VPGA 1C1DA 2AHRA 1LU9A 4WCFC 1ZSNA 2J6IA 2EWMA 2B35A 1LNQA 1LLQA 3OMLA 4LK3A 1EEHA 2YW9A 4ND3A 4U6QA 1ADCA 2B36A 1YL6A 4D45A 1IHXA 4YAIA 4C4OA 4CM9A 4WCFB 4EDFA 3KYBA 4OIMA 3WMXA 4IQ0A 3GHHA 1Q1NA 5TNXA 1ML3A 1NVGA 2PZKA 3I6IA 1WZIA 1EVIA 3TFOA 3JD1A 1PGJA 3LT1A 3H9UA 4II2A 2IRWA 4YAEA 2P4QA 3TJRA 4CV1A 1E6EA 1LQTA 4O1MA 2X22A 5LDGA 1NTOA 3E6AA 1PGPA 4NHEA 2DUWA 5ENVA 2HUNA 1UXJA 5AXBA 5JE8A 4FPXA 4LGVA 4NK4A 3D1LA 1A7AA 3OETA 3Q2KA 4NBWA 3T7CA 3DR3A 3QVXA 3I4CA 3WSWA 1Y9AA 4HFNA 1GZ4A 3ABIA 3IIEA 3ZHBA 4CQMA 2IE0A 4DYDA 1CYDA 1P31A 3GG2A 1A7KA 1FF9A 2GRAA 2VZ0A 2VZ8A 4IXTA 1ZXLA 2D0IA 1AXEA 1GUFA 5H82A 3GZNB 4FC6A 3RUEA 1VJ1A 5I9LA 2W8ZA 2E6UX 3JYLA 1DC5A 2HMUA 4RJTA 1HDGO 1DJQA 2X5KO 4NH4A 2VT2A 4QFCA 3RBVA 3RKRA 3AUTA 4ZU3A 4JP3A 4CJXA 2FOIA 1TXGA 1ADGA 3OEWA 2X7HA 5L3ZA 2HK8A 5A05A 3CSDA 5JDIC 4PVCA 4CMJA 4CM1A 2AQIA 1H94A 4J1SA 2P68A 4F6LA 1MFPA 4PLYA 4YT4A 2EKQA 4ZHSA 4ESOA 4E5PA 4DMLA 1UDBA 3BZUA 4K1LA 1ISMA 2B4RO 4YCAA 3ONDA 3QVSA 7MDHA 2QQ5A 3VZPA 3PXXA 5TS3A 2JCYA 2VHXA 4R1SA 4YJHA 5DCYA 4DPMA 5CG1A 3DZIA 2CD9A 3DHNA 2B0JA 4CUKA 2SCUA 4IMRA 3U4DA 5AQ1A 4IGEA 1LRKA 2GLXA 2I65A 1C3VA 1M6WA 4ONEA 4EUEA 4MVJE 3FNFA 1BMDA 5JBIA 4IXWA 2NACA 2NV6A 5CDGA 1ZH8A 1PGNA 4CLDA 4J16A 1ZK4A 5JC1A 4BO6A 1JWAB 1MG0A 4KDEA 3VKVA 1AUPA 3LT2A 2B5WA 4J49A 5AXDA 1KC1A 5TT1A 1Y8RB 4BVAA 3A14A 2PA3A 4D3FA 3M2PA 2JJYA 1CF2O 1T24A 5C7IO 3PJDA 3W6UA 1DBVO 4OKIA 4Q3AA 3H65A 3QV1A 1I5RA 5FEUA 4ND4A 4BNNA 4Y6RA 5C5IA 1V9LA 5ER9A 4BMVA 3ZU2A 3U5TA 1DB3A 2PNFA 1DC6A 1PQPA 3MJCA 1SBYA 1XCBA 3SX2A 5FYDA 3ZI0A 3BA1A 1WWKA 4ZN6A 4MIEA 1U28A 3AI2A 3DOJA 5ER6A 1TA4A 2BD0A 4JLWA 5L7TA 1DHRA 1XYGA 3NDJA 5DT9A 4CM5A 1GFSA 4YYZA 1DIGA 3I52A 1WMAA 3WGGA 2NU6A 3JD0A 4CUZA 1ZZEA 2A92A 3KXDA 1VE9A 3WFIA 3GEDA 1A27A 1Y8RA 3I9LA 3IC5A 3GMDA 3E5RA 4IDAA 1QP8A 4YJFB 2WMDA 3GVHA 3RUIA 3T7EA 3ENNA 4BB5A 1S7CA 1GV0A 2CFCA 3RC7A 3E03A 2H5LA 3CTMA 3JQ7B 1P1HA 2BRUA 4BO7A 3W4KA 2GCGA 4XZ3A 3GMSA 3TSCA 1LBEA 2P9CA 2BGMA 1IE3A 3A4VA 3HZZA 3JSAA 3AUUA 1LSUA 2YDYA 4HX5A 4I9UA 3MOGA 3VC7A 2X0JA 3KYCA 1DFIA 4WOJA 1R6DA 5GZ6A 2CMDA 1V6AA 3FBTA 4A10A 5ITVA 3S1LA 3ZH2A 4EEZA 4OJNA 5TLSA 5COBA 2H63A 4A26A 3NYWA 3DZBA 1IYZA 5JDCC 3PJGA 4RPLA 2UYYA 3TPCA 2RH8A 1Q0QA 4MPDA 2I3GA 4HFJA 1U2GA 3NDIA 1EQ2A 2D5AA 2FPGA 5HM8A 4NI5A 4TWRA 4I08A 1E7QA 4DL9A 4M87A 5HS4A 4L9RA 4K6FA 3E9MA 3D4NA 2I67A 4PCVA 4XDYA 1S6YA 4MVJP 1KOLA 1KVTA 3ASVA 3ZZNA 4B7CA 1JKFA 1ID1A 2IXBA 8LDHA 4B79A 1ZMOA 3JV7A 2UUOA 4EJMA 2VRBA 1BXGB 3COSA 2VYND 2XAAA 3CUKA 3PJEA 4OM8A 4RZIA 2X86A 3ANLA 2DTEA 3D7LA 4IM7A 4A0SA 3CMMA 2TMDA 3HE3A 5AOVA 4E13A 3VVCA 2ET6A 5L53A 2DFVA 1HEUA 1QYDA 4GVLA 1YB5A 5JAMA 2OP1A 3EVTA 4FJ1A 4RQTA 1D3AA 1LI4A 2VYVD 1QLHA 3A9WA 3CH6A 5EPOA 1BWSA 4J7UA 5LC1A 2V6MA 3JQFA 2Z1MA 2BI7A 3NGXA 4FFNA 4LW8A 2BHLA 5T5QA 3VDQA 3MJVA 3NTOA 1HZJA 1NXQA 5CPBA 1U5CA 3FWZA 4B4WA 4NQZA 4RVSA 2AEJA 5G4LA 3BAZA 5KJ6A 3GC6A 1DRVA 3RVDA 1BXZA 2J3IA 2Q46A 1UR5A 2G5CA 3F4LA 3DOOA 3AY6A 4TRNA 2C59A 1KEPA 1IY8A 1U9JA 3PPIA 2AEFA 1NFRA 3KTDA 1U8FO 3OJ0A 3FCOA 1H93A 5L95A 3GOHA 4R4JA 2Q49A 4BNFA 1Q0HA 3S2EA 3JQ9C 4WLEA 1GV1A 1LLDA 2JFGA 5EMHA 6LDHA 2A35A 3PWKA 1SCUA 2DM6A 4BNTA 1T4BA 3E48A 1DFHA 2OBYA 3I23A 3ZHXA 1CWUA 2C5AA 3ZW9A 1GUZA 3ITKA 1XU7A 1NX6A 3PGJA 2EJVA 3BTOA 5LCXA 1L7EA 1GU7A 3ZHYA 2OBNA 1GR0A 4UEOA 5F3RA 3WYEA 3BHMA 2Y05A 2Y93A 3DZGA 3KUXA 4YRBA 3SLGA 1N8KA 2VHWA 3GRPA 9LDBA 4YQZA 5K6AC 3LU1A 1N7GA 1T1RA 1LDBA 4BQRA 2JFHA 5EL0A 2DBVO 4Z3DA 5I8WA 4AJLA 7ADHA 5KJFA 3G79A 4MO2A 3D3EA 3ORFA 3LLVA 4J9VA 2HMSA 1FK8A 2PH5A 2YQ5A 1M75A 4WK6A 5IDQA 1BVRA 4BO9A 4TRRA 1P33A 3TZCA 4K6CA 1AGNA 3AY3A 4IJKA 3MCVA 2W2LD 4RDHA 3L77A 4NDNE 1P1KA 4H15A 4AICA 3DHEA 4BNYA 4XGNA 5DULA 1R12A 3VH4A 3JQEA 2IZZA 4BKPA 1HWYA 2ZTLA 3P5SA 3S2FA 3E82A 3OEYA 3C8MA 4BV8A 1BXGA 1HZZA 3GGOA 3PHIA 1B7GO 3GGPA 1ZO8A 2GN4A 2VTDA 4RQUA 5TQVA 4OO3A 2EKPA 1A5ZA 1T4DA 3I4FA 3HN7A 3ADOA 2G1UA 3TFQA 1HL3A 2Y0EA 5B37A 2IEDA 1ZBQA 3N7UA 1TI7A 1YS4A 9LDTA 1A4UA 1R0LA 4WECA 4KDFA 4MKZA 3K31A 1QG6A 2DVMA 3F6YA 3BHIA 1HYGA 1VM6A 4GKVA 4FJ0A 4ND2A 3GHYA 5L4SA 2AMFA 1Y5MA 4BO2A 2QRJA 1PR3A 4IPTA 1B0AA 4CMIA 1X7DA 1T2AA 2CUKA 5TF4A 2Y1CA 3TWOA 4L0QA 1RKXA 4DPKA 4EEXA 1KIFA 1O94A 4XQ9A 1B26A 1D1TA 1YJQA 2J5RA 2OFPA 3RASA 4JJIA 4NBRA 3OIGA 1P1RA 1AXGA 3NGLA 2C7GA 3KZVA 1A9ZA 4WPGA 2AW5A 3AUSA 3JQCA 1XHLA 2X9GA 4GMFA 3WQRA 3BMCA 3ONEA 3PIIA 2D59A 3ON5A 4Q3DA 2JAHA 1SB8A 4E5MA 1DC4A 3LT4A 3V1YA 2PD4A 3G0OA 3RI3A 1P3DA 2O2SA 5I7FA 1KVSA 2FHSA 3AJRA 2ZB4A 4R41A 3MJ4A 3F46A 4UULA 1RM0A 1ISIA 4J7XA 1XA0A 2F00A 3W8DA 1IHYA 1H6CA 1WP4A 5BSHA 3INGA 4IY1A 3FHLA 1QYVA 3SJUA 2VCYA 2Y0CA 5TRTA 4IIVA 3DZFA 5T57A 3VVBA 1D8AA 1W4ZA 2HK7A 4Z0TA 4IJVA 4MVJH 4CL3A 4PIVA 1PQUA 4DGSA 3HFGA 3ITDA 1B8VA 1EFKA 3E8XA 4WCFA 4Y6PA 4AJOA 4GKBA 1N1EA 2QX7A 5A3JA 1ZKMA 2AQHA 5L9AA 3TOXA 4GL4A 1NBOA 4FOSA 2AG5A 3RFVA 3WNVA 1C0IA 3VTFA 3KYCB 3NEPX 2HMWA 4BO5A 4M55A 4R01A 3INRA 4L4RA 4CMBA 2V6BA 1QV6A 1VI2A 4DLLA 1V35A 2Q2VA 1T2CA 2VYVA 4QQRA 3IKTA 2X5OA 1SNYA 3HB5X 1Z7EA 5B1YA 4CLOB 3RUFA 2JHGA 3SC6A 4WLNA 2R00C 1EK6A 1XG5A 3HUDA 3AFMA 3W8EA 5K9ZA 2GUGA 4BMSA 5IXSA 3ZNPA 3UH1A 4MVJF 3GN2A 3HADA 4BOYA 3JQBC 3BIOA 1XQ6A 3W8FA 1PIWA 4MP8A 4RDIA 3AU8A 1ADBA 3B70A 1ZJYA 3E9QA 1LX6A 3P7MA 2DPHA 2ILTA 4CM8A 4KWHA 1A71A 4FGWA 3DC2A 1HDYA 4Z0HO 3FR8A 2GZ3A 2DLDA 3VAZA 1C14A 1CDOA 4RF5A 4BKRA 2VWQA 1F06A 4KUGA 2VN8A 2QRKA 1ENOA 5ICSA 3AM3A 5BT9A 1D4FA 1HRDA 3M6IA 1YONA 1OC2A 1PS9A 4E5KA 1ISHA 4LSWA 4D46A 2FN7A 1PL8A 4J9UE 4GX5A 5IF3A 4TZKA 1U7HA 1LA2A 3LZ6A 5IXYA 1GEGA 3ZGYA 3NT4A 3P2YA 3B6ZA 4MVJA 4YEDA 1U4SA 4D3DA 3JCZA 1RJWA 4NG5A 2VHZA 4XIJA 1PTJA 5JDIA 3JQ8B 4PLWA 5TC4A 1B16A 1GDHA 4OXKA 2GASA 2FR1A 1IPEA 1HSOA 2DTXA 4U7WA 4MVJI 5L40A 3MEQA 3CZMA 4IJWA 3RJ5A 4JBHA 1QMGA 1WXDA 4RZHA 3ZWYA 5BSGA 1NVMB 3BTVA 1R4MB 3V1UA 3WWYA 4OQYA 5T8KA 4QX6A 3LF2A 5IZCA 2QYSA 2ZJ1A 2EGHA 2G17A 1HE3A 3UOGA 1P0FA 3ICPA 4O0LA 3KOUA 2Q1SA 3GFBA 3DTYA 1GYQA 1UP7A 1ULUA 3DFZA 4HFMA 4W7IA 3PP8A 4CLRA 3UXYA 1EVYA 5KVCA 3ST7A 2VWGA 3NAQA 3EDMA 1K3TA 1E77A 4HY3A 1YBVA 5IZ4A 2E48A 2PZLA 2ZB3A 1KS9A 5BNIA 2PLAA 3DZHA 4JBIA 5C7LO 1Q7CA 4ROSA 1I30A 1HYHA 1LLCA 1QR6A 3AUAA 3JQ6A 4NK5A 5G0TA 4Z3KA 4B8ZA 4CMIB 2B4QA 1Z82A 3OQ1A 4JIGA 3UKOA 2NU9A 4CM4B 2OP0A 5B4UA 4ITUA 1ZVMA 1NM5A 3SEFA 3UHAA 3C1AA 4CMEC 1ISGA 2QHXA 1ENZA 2O48X 1EMDA 2CNBA 2PZJA 3RD5A 2A4KA 3C7AA 3FNHA 3EYWA 1HDXA 4IDFA 2D4AA 4CMAA 1C0KA 1X7GA 4YT8A 1DJNA 3RC1A 5B4TA 4E31A 1MXFA 4JP2A 1GCUA 1PJSA 3GNSA 4GWGA 4FSHA 1NQTA 3VPXA 4FGSA 4YACA 1JAXA 2FZWA 5IG2A 4TROA 4NIMA 5JXWA 1Q0LA 3UCEA 3WJAA 3ONFA 4RVUA 3KYDA 1DRWA 3HJAA 4DQVA 5AXAA 3QHAA 1YH3A 3RU7A 3U4CA 3GF4A 5JYEA 1EUZA 1NWCA 3AI1A 3CE6A 3NTRA 3EW7A 2PGLA 3CMCO 2DKNA 4DIFA 5T67A 3WNQA 3U4HA 3W4IA 4B3IA 5KIAA 3RBXA 3A28A 1I0ZA 4Z6KA 5CEFA 1PS0A 3QQPA 4HBGA 2IDZA 4BGIA 3KEQA 3QLJA 1HTBA 3QWHA 2JCVA 2V7PA 4EITA 3LK7A 2ZYDA 4IZIA 3I9JA 4XYLA 1FDWA 4WCDA 2H9IA 3OA2A 3GVIA 5JDCA 2ZB7A 2BELA 4LRTB 4E0BA 2OZPA 4O5OA 4R1UA 5CG2A 2BF7A 3ETDA 5G0VA 5B12A 5T64A 1N2SA 2EEZA 1SC6A 1X13A 1GZ6A 4ALIA 2B5VA 1HLDA 3W4JA 4LN1A 2V6GA 4Q3CA 5T8KC 4A2CA 5JPIA 1UZNA 4ID9A 2YV1A 4KTTE 1TLTA 3RQSA 1DLIA 3WIDA 5HS6A 4PG4A 5C7OO 1UXKA 2JAPA 3PHJA 5A9SA 3O4RA 5L7YA 1U5AA 2O3TA 4E12A 4BNLA 1IZ0A 4F45A 1NP3A 3ZV6A 1XKQA 3MOIA 2QW8A 5DBFA 1P1JA 5L45A 3PIDA 2W2KB 3ZWWA 4ALKA 3RKUA 4GI2A 2ZATA 4MP6A 1EBFA 4OSPA 4II3A 3JQFC 1P1IA 2DU8A 3KSDO 2NNLD 2W98A 2NUAA 1PJLA 1E0DA 2YDXA 4Y9DA 5DOZA 3BMOB 2C7VA 3PFFA 4GWKA 2DAPA 3C7CB 1IUKA 4J1NA 1U8XX 4AL4A 1DEHA 1DIAA 2VHYA 1GUYA 3MWDB 1A9YA 1FDUA 4GX1A 4GAEA 1E7YA 1C1DB 3ULKA 1JVBA 4Q9NA 3GFGA 3E5MA 3HQ4O 1KVUA 4L4XA 4YT5A 2CSUA 4D3SA 1EE2A 4RV9A 4BNHA 2X5JO 1NQAO 5KKCA 4GPD1 4R16A 3IJRA 3GRKA 4DRYA 2C82A 1PSDA 1RYDA 2EG9A 5IJZA 1QYWA 1J4AA 1ENYA 1I3NA 1O6ZA 4WGGA 4B4VA 1SEPA 2P5UA 3PZRA 3WWZA 5JW6A 2W2LA 4XRRA 4IMPA 4WNCA 1X14A 4J1QA 3UICA 5CAEA 4FFOA 4BV9A 1KVRA 2GN8A 4PZCA 2HCTA 3L0DA 3WBFA 2HKIA 3F1KA 5ENDA 5K6AA 1N9GB 3O38A 4HP8A 4JN6B 1JDJA 3GT0A 4DYVA 4RPJA 5C3MA 1FDSA 3DEYX 2JD1A 1BG6A 4W9NC 3ZDFA 4QT0A 4E33A 2ZK7A 1OBFO 1P9LA 4PLFA 3V5NA 1E1MA 1HT0A 1I2ZA 1YKFA 2GZ1A 4P22A 1HKUA 4AG3A 4FFMA 3ANNA 5DP1A 3L6DA 3O8QB 4NJOA 4OH1A 3ZW8A 1ZEMA 1H5QA 3WGOA 3NT5A 4ZRNA 1FDTA 1PZGA 1ZMTA 2OXIA 4PN3A 1KETA 4XD2A 4XQGA 2E82A 1ZUD1 5A02A 1XU9A 4QO7A 1CEQA 2ZQYA 5DP2A 5DF1A 4CLXA 1BHSA 3I9OA 3PZBA 1PJCA 2VRCA 1SZJG 4OXYA 4Z9FA 4DLAA 4FN4A 2GDZA 4U5QA 3PVZA 4J4BA 1EVJA 1LRJA 4L76A 4BNUA 2OHXA 1NQOA 3FPLA 1B3RA 1LLUA 1MC4A 2Q1TA 2Q4BA 3NT2A 4UEJA 4AJ2A 1NFQA 2ZYAA 3DBLA 2AG8A 3Q0EA 2WEKA 4DWVA 4ZQBA 4K26A 3FN4A 4K9DA 3RUCA 1PR9A 3DZKA 3H9GA 4DUPA 3ZHZA 3L9WA 1PU2A 3JQDA 3FR7A 3JQ8A 1Q7BA 2Y1GA 4YAKA 2C54A 3DQPA 3PGXA 3AFNA 3S8MA 2F1KA 2X23A 4CV2A 4NZ9A 2AE2A 2E37A 3KHUA 2B4TO 5FF9A 2BI8A 4A5OA 5IN5A 5EN4A 3OH8A 4FD3A 1PGOA 1I2BA 2VOEA 3RWBA 1B14A 3KM0A 1I8TA 1GY8A 4BO3A 1GPJA 1E1NA 2P4HX 1ZSYA 5FI5A 4WUVA 1XGKA 4R68A 3UVEA 4JK3A 5KVVA 3QE3A 3QVTA 5IDXA 1O0SA 3M1LA 4HV4A 1CETA 4LMRA 5A9SB 4NU6A 3OICA 3ROPA 2D3TA 3PHLA 4CR7A 3PDJA 1MG5A 2DT5A 4RVFA 5CEEA 2Z1NA 3IKVA 1U7TA 4PVDA 4CMCA 5U9CA 4XEHA 3WGTA 1ONOA 3RUAA 2OMEA 3D64A 1K89A 3GUCA 1LDYA 4R5MA 2FMUA 1OMOA 1ULSA 1ZK1A 3U3XA 3WSVA 4BMNA 3C85A 3HDHA 3CEAA 4RGBA 3QIVA 4N5LA 1ORRA 5KJ1A 1LDGA 1E6WA 2J5KA 4IGFA 4CV0A 4WLFA 1H9AA 2G76A 3IP1A 8ADHA 1I10A 1IZ9A 4CM7A 3EZLA 1X1EA 1I3MA 4L4SA 1G0NA 3QP9A 5JMPA 3ZV4A 4XR9A 1MFZA 2LDXA 3N74A 1SO8A 1M6HA 3HN2A 3JTMA 2HJRA 1XELA 1G0OA 1NR7A 4QO8A 2BGLA 4ZA2A 3RSHA 4TMFA 5KOIA 1O9BA 4W9NA 5A06A 4YJFA 2IYPA 3PYMA 5TJHA 3LSYA 2VWHA 2R00A 2UVDA 1SOWA 2DBRA 3DAFA 1HE2A 1ZW1A 2DUUA 2RAFA 1BW9A 1VL6A 2FWMX 2H6EA 2CDBA 2OGUA 1NASA 4U8GA 3ZN2A 2VNSA 1C1XA 3TZQA 4WASA 4RVDA 2NWQA 1YGYA 3JQAA 3PI7A 3WBBA 2CDCA 1MXHA 4XJTA 3PQDA 3FTPA 4L74A 4YB8A 2JD0A 2Y67A 2NVWA 3AOEA 3U62A 4J4HA 4OAQA 1DIBA 4JXKA 4W82A 4BNJA 3KYDB 4GLLA 3WGYA 3QVWA 1MC5A 3JD3A 2XXJA 5U4QA 2BFPA 3KEOA 4RO0A 3UW3A 3W6ZA 1QXSA 5BR7A 2WM3A 4RF2A 4DVJA 4FIZA 1B8PA 1T25A 2ZB8A 4BNMA 2Q2WA 1A4IA 4M1QA 5DCWA 3PHGA 3BMCB 1ENPA 4KQWA 3ROKA 1NNUA 1ZIDA 4P38A 4RL6A 3ROMA 4CV3A 1VRWA 5ILOA 3NTQA 2C2YA 2E4AA 2D2IA 2GSDA 3S2GA 4PLVA 3ZWNA 2J3JA 4BGUA 1YQXA 4ND1A 3WTCA 4F6CA 2VUUA 4OHUA 3UFXA 1PJTA 2EV9A 4B4OA 1BVUA 4H16A 4JNKA 2ZTVA 3HSKA 1UZLA 2GO1A 3DBRA 5JNLA 3WFJA 5EINA 1BDMA 4DIOA 2CVZA 1DRUA 2WJPA 1L1FA 1X7HA 3CINA 4H7PA 2GD1O 4JBGA 1YBAA 3NKLA 1YRLA 4PZDA 3GQVA 3DDNA 1VSUA 2LDBA 4RLSA 2EXXA 2FSVA 4YPOA 3IDSA 2ZQZA 3V2HA 2WSBA 4YA6A 1WNTA 4WNIA 1UAGA 3KV3O 1Y8QB 3FRJA 4TZTA 1NFFA 1MP0A 3T4XA 3FNGA 1PL7A 2Q45A 4DQUA 2PD3A 3ETGA 4R54A 2YHIA 4KMSA 2HMVA 4TVOA 4CM3A 2WYUA 3DO5A 2EHDA 1PS8A 5CDUA 3C1OA 4I5EA 1FMCA 2NVUA 3AW9A 5KVQA 1RPNA 2HRBA 3FI9A 1I01A 2RHCA 3OM9A 4J4TA 1XIVA 4FFLA 2YV2A 3GN1A 4EGFA 1DC3A 5HTOA 3QVOA 4O6VA 4I1IA 3ZWPA 5KVSA 4Y67A 4D41A 4C7KA 4CR6A 4NBUA 3H8VA 3LYLA 1U2DA 3O26A 3TOZA 1UJMA 2J3KA 5L4LA 4EBFA 3VH1A 4NFSA 3RU9A 4CPDA 1Y6JA 2DQ4A 3U0BA 1EUCA 1KC3A 2ZYGA 4R5HA 4QUKA 4EUFA 2JKVA 3OJOA 3O9ZA 5HA5A 5CP8A 2HU2A 2YV3A 3O03A 4CM4A 1O95A 2IEBA 1NHWA 2VZ9A 1YDEA 4E5NA 3H7AA 1T2FA 5BNTA 2JFFA 2OOSA 1AN9A 2RCYA 1MX3A 4E2ZA 4ZQGA 4I5DA 3OSUA 2YJZA 1J5PA 1B3BA 4AJEA 4CMKA 3RUDA 1UP6A 1R0SA 2DPGA 1OFGA 3JQGA 4ILKA 4YR9A 4CQLB 2NTJA 3UCFA 5EIOA 1R66A 4ZJUA 2O3QA 3WICA 3RCBA 3PQEA 2Y66A 2YY7A 1HDCA 2AQKA 5EQFA 3VPFA 2W4QA 2WE7A 4PLGA 1QLJA 4XYMA 3GAFA 4GLOA 3IL2A 4INAA 4MIYA 4GSLA 3SC4A 1PZEA 3K5PA 4BQPA 1SMKA 3OJFA 2IODA 1GQ2A 1VL8A 1IL0A 1E7MA 3NJ4A 4J43A 4BNKA 3E18A 4CMGA 1N9GA 1QYCA 3PRJA 2VWPA 3K73O 3V1TC 2PH3A 3QWFA 2EJWA 5I7VA 1EQUA 1R37A 1Y1PA 1DFGA 4B3HA 3NDRA 4NNJA 1U3TA 4MJLA 1V8BA 1K2WA 2PKQP 2I66A 4GX2A 3P2OA 1E5QA 2Q1WA 4NJMA 4UUPA 5A04A 3UUWA 4TQGA 4XX0A 1PJ3A 2NLOA 3K8ZA 4U0JA 2FR0A 3FTNA 3MZ0A 4I5FA 1CQIA 2NSDA 4P4NA 3WGZA 1KEUA 1BTOA 4BHTA 5COQA 1GL3A 5G0WA 2GYYA 4FCCA 4X54A 3CXRA 3OA0A 2JL1A 1MGOA 3L6EA 3VH2A 1G6KA 1OZAA 4HUJA 3ZWOA 2EIHA 2D8AA 4UEKA 4PLTA 4AJKA 4OOFA 3H9EO 2O4CA 4L75A 1P0CA 1W6UA 4DREA 1YOVB 1GEEA 4R9RA 4E4YA 2X8LA 3R3JA 3RAJA 1ONNA 3WQSB 3JD4A 1F8FA 5EJ2A 3ROQA 4TRJA 2J5QA 2B37A 3KVOA 1ZEJA 4I9NA 4UUOA 5KTKA 1DHTA 3G17A 3WXBA 4UUNA 4Y98A 3WYBA 4B4UA 2JCXA 1YE3A 1C0LA 5IZCC 1U3UA 2D5CA 1L7DA 4IBOA 2O23A 1J0XO 1Y81A 1OOEA 3JYPA 3TNLA 2FZEA 5J23A 1BRMA 1E3SA 3K9QO 3Q6IA 3K2EA 4WKGA 3BMQA 4B8WA 4UVGA 3EVNA 3RUHA 4WJZA 1PL6A 3QWBA 2NU8A 4C7JA 3I9NA 3GK3A 1DPGA 1SPXA 4NMHA 4BNWA 4M54A 4AJHA 2PTGA 4DXHA 4OGWA 4BNZA 3GZ4A 1F0YA 3PTZA 4CMHA 1W0CA 1TT5B 2CF5A 1GD1O 2ZTMA 4CODB 1PJ2A 3DTTA 4W6ZA 5JY6A 2P9GA 4R51A 5HWSA 1DXYA 1DLJA 2WD8A 3GPIA 5TSDA 5DCUA 4J2OA 5EESA 1NPYA 4M8SA 1LC3A 3PQFA 4RVHA 3Q9NA 1F17A 1WVGA 4MOWA 1YBMA 3F5SA 5KCZA 3LF1A 4CMEA 2X9VA 2Y1EA 1IPFA 3GA0A 4ZQHA 3ZWVA 5JSFA 4U6SA 3BMOA 2I76A 2X0RA 3ZWBA 3KSZO 2XXBA 1E3EA 1SOVA 3TN7A 4GGPA 1EZ4A 4ZGWA 3LC7O 3PHHA 4PRLA 3V2GA 1ADFA 1LRLA 3PFWO 4AJJA 4FW8A 2BFMA 3DOCA 2IYOA 4MVJM 1YB1A 1I3KA 1OC4A 1Y9EA 3WS7A 1QV7A 3WGIA 1R16A 4IINA 1BW9B 4DMMA 4K28A 3QA9A 3IUPA 4XQCA 1F14A 4WEQA 2CDAA 4CLHA 1WDKA 3A06A 3DAGA 3F9IA 1EE9A 1RWBA 3GVXA 4ALMA 4D0RA 4DTIA 5IFLA 1YO6A 4BIIA 4B7XA 3DMTA 4IS3A 4ZICA 3I6QA 3L6OO 3L07A 3E9NA 3D4PA 5F1PA 1NWHA 2X6TA 2Y0DA 3EMKA 4J6FA 3R0IA 2PWZA 4YQYA 4EYEA 4XQEA 3I9KA 2O3JA 2NU7A 3OECA 4TKMA 4AVYA 4DBVO 4WLVA 1Z45A 3VOSA 3ZV3A 1XQ1A 2GGSA 5TGDA 2H1SA 4N7RA 4KP7A 1X0VA 3WX0A 4QXMA 3INTA 5G0UA 5ES3A 4EUHA 4JGBA 4F3YA 4UAGA 2IXAA 5KKAA 4J1TA 1O5IA 5F1OA 3GPDG 4J91A 1HE4A 3ZWAA 4XRGA 5K0ZA 1ISJA 3ETEA 1MA0A 5GZ3A 4RORA 1HXHA 4YDRA 3LC2O 3EY4A 4YJDA 1LSSA 2NQTA 3HHPA 4UVIA 4NFHA 1E1KA 2Q50A 1HE5A 4BNGA 4CL8A 4DBZA 4B7UA 3JQAD 4LCEA 4N5MA 3IP3A 1HF3A 3GUYA 1VPDA 4R3NA 1C0PA 2HQ1A 2CVQA 4FOOA 3CKYA 2I99A 2Q1UA 5F5LA 3SJ7A 4ALNA 4CLEA 3H2SA 3HFSA 1XDWA 3ZU5A 1DOHA 5L7WA 1UXGA 1YB4A 2GN6A 3TDKA 1WZEA 3DBHB 4W4TA 1ISFA 1IB6A 4WOKA 3L9XA 3EK2A 2GNAA 2C20A 1H6DA 1ZFNA 4FQ8A 1JQBA 5DOVA 2AEMA 3JQ9A 2BMAA 3AU9A 4NBVA 1I32A 4IDGA 4ZRMA 4E30A 1O8CA 4O63O 5BSEA 1PJQA 2PFGA 2ZIZA 3IJPA 3BMNB 4UVEA 5JCXA 3MTJA 1E7WA 4UVDA 4DC1A 1XWFA 3IAHA 4RVGA 1H0KA 3I1JA 2XF8A 3R1IA 4HWKA 4KZPA 1V0JA 3HDJA 3GDGA 3I5MA 4HXYA 4TRMA 1VKOA 2IZ0A 5I8ZA 1H6AA 4W7HA 1VC2A 1UP4A 2X1HA 3M1AA 1HDRA 4XCVA 4YJGA 2XPCA 3G49A 4CQLA 1R0KA 5DNAA 2IZ1A 4CM8B 3PLNA 4R1TA 1JN0A 2Z95A 4G81A 2UUPA 2Q99A 4FBGA 3KO8A 4PLPA 2OUIA 3OFSA 3OJLA 1BGVA 5COAA 4H3VA 2PGJA 4LVCA 5I7SA 3ZV5A 4IUYA 5JCJA 4IZHA 5B4VA 3AM4A 2FRDA 1YXMA 2RH4A 1ONPA 4QECA 3WLFA 1JAYA 4I9HA 4NPCA 1R4NB 2BFAA 3C1TA 5THKA 1RM5A 4I8XA 2WE8A 5GMOA 5JAIA 1ZJZA 2EW2A 1WDMA 2FY8A 4LSMA 4OYRA 1E3WB 1PGQA 3WMWA 3UN1A 3U09A 5A9TA 3LC1O 3DMTC 5U1PA 4FS3A 4GVXA 4XIYA 3H2ZA 4JQCA 4Z0PA 2JHFA 3KLPX 1Z7BA 1K6JA 1V3VA 4JCOA 3QRWA 3ASUA 4XA8A 2HO5A 5CPFA 3WQQA 1K6XA 1TVEA 3RFXA 3DZJA 3AI3A 1W8DA 3DBHA 4MP3A 5TJ9A 5C37A 3JQBA 1YL5A 1E7SA 5JO0A 3WGHA 5JS6A 3VZQA 1TB4A 5IDYA 1WAMA 1EDOA 1Y8QA 2R6JA 1SEVA 4FC7A 5JAZA 3ZWMA 3RBZA 1LDEA 5CDYA 3ZU4A 3OBBA 4P4GA 1GTMA 5FI3A 4Y6SA 2Q4EA 3ADPA 1WLYA 1I2CA 3AY7A 3MTGA 1HETA 1I36A 1LJ8A 1P44A 2AA3A 3G1UA 3IS3A 3JQ7A 4AFNA 4BUCA 4XYBA 3DBLB 4GBJA 2QZ9A 1N1GA 5ADHA 5CEJA 2FPIA 3KSUA 3H5AA 4J0EA 3B1KA 2Y99A 1MB4A 1NPDA 3BYZA 1W73A 3PDUA 4BNXA 1XSEA 1EVZA 1UXIA 1YDWA 2NTNA 4G2NA 3VHRA 1ZCJA 5GZ1A 1NAHA 2FSSA 1FXSA 3DBRB 3LLSA 4RF3A 1A72A 2Q2QA 4GH5A 1U1IA 4FJ2A 4DC0A 4CLOA 2R2GA 1T2EA 4RPGA 2C2XA 2GPTA 2X4GA 3E1KA 3JD2A 4DQXA 4D0SA 4PGFA 4F46A 3QJ5A 1LC0A 4LVUA 4CUJA 3VZSA 3EGOA 4DA9A 3OF2A 4NU5A 1X1TA 3QW2A 1I24A 1NYTA 3TL2A 1GAEO 3HG7A 3WDSA 3JYQA 5IAAA 2PV7A 3LQFA 3ANMA 3QSGA 3RC2A 4BS9A 4CR8A 3NRCA 3PWZA 5DN9A 2RHRA 2CF6A 2PR2A 3UF0A 4CQMB 1DAPA 3OHSX 1Z73A 3B1JA 5CDTA 1LEHA 2VUTA 2XOXA 2X0IA 4PRKA 1T2DA 4EI2A 4XB2A 2ZCVA 3F5QA 3IMFA 2YZ7A 4YBZA 5A5EA 2UAGA 3WJ7A 2J3HA 1EK5A 3GEMA 4MKRA 4WLOA 1UUFA 3HWRA 3S2IA 3X2FA 4W99A 3U49A 3IOYA 2V6FA 2I6TA 3SLKA 1WW8A 5F5NA 3RROA 2BH9A 2WWRA 4GX0A 1O89A 3TZKA 3KETA 3HDQA 5JFOA 4NFYA 3RJ9A 1M76A 3GDOA 1R15A 2X0NA 2I3AA 3MWEB 4PFJA 4CQMD 3LT0A 1J49A 3F3SA 3WG9A 1PWZA 5IN4A 3VKUA 4LRSB 1E92A 5AVOA 2BKAA 1BSVA 4KUEA 4XGKA 5T6BA 1QSGA 4Q3NA 1OAAA 2C29D 1F8GA 4IDEA 4BKOA 3HDYA 3S55A 2YUTA 1QKIA 3GEGA 1JKJA 1LUAA 4BGVA 1NR1A 2YFHA 4YAJA 2Y68A 3GLQA 3QWAA 3H6KA 3GZNA 3D5TA 4D44A 5BSFA 3P19A 2EGGA 2W2KA 1LDMA 4AJ4A 4IIUA 2Z5LA 3UGKA 3AOEC 3WR5A 4XB1A 1K5HA 3DBVO 4OMUA 3PEFA 1WDLA 4ZVVA 1MLDA 1XLTA 4D42A 1UDAA 4ALLA 1GPDG 1UAYA 4J90A 3ENKA 1NVTA 4YJHB 4BNVA 1FJHA 3D5QA 3GVCA 1GCOA 1U3WA 3ZWXA 3IUSA 4CLRB 3CPSA 2NVBA 1KEVA 4KUHA 1Z6ZA 1EFLA 1PX0A 2GZ2A 2QZZA 1KYQA 3R6DA 4OSOA 1GADO 1ZNQO 4Z9XA 1HDOA 2AQ8A 1XR3A 2W90A 3JYNA 4E21A 1XEAA 1ZK2A 4IDCA 3RIHA 3G3EA 4JX8A 4R1NA 2FP4A 4YWJA 2DC1A 2G82A 3DWFA 4DIBA 4P8RA 4A73A 3RC9A 3FD8A 1CQJA 1D7OA 4PG7A 1UXHA 1CRWG 1ZK0A 5JMWA 4A7PA 2GN9A 2YFQA 5G0SA 4JJFA 4M49A 2VUSA 1D1SA 2PK3A 2DFDA 4NR0A 4OXNA 3L4BC 4N18A 1KY4A 1IOLA 2RBEA 3WYCA 5A9RA 4UVHA 5FFFA 3KB6A 4M89A 2ZJ0A 1E7RA 4HADA 3C24A 3SVTA 3NV9A 2WYWA 3STHA 4YT2A 4BGEA 2PY6A 4BO1A 4IJUA 4IQGA 2GERA 5ICMA 2C0CA 5G4KA 4GSKA 4L73A 1LSJA 1P74A 1AHHA 3W1VA 3GDFA 3B20A 4PLCA 2O3UA 2HK9A 3PLRA 2O7SA 4E2YA 5AXCA 4XGIA 3TQHA 1YWGO 5EERA 3KRTA 3GY0A 2O50A 5DBIA 3PJFA 1VL0A 1AHIA 3CIFA 3O8QA 4AJ1A 1YL7A 3OQ6A 1E1LA 4TVBA 4KQXA 3I83A 1GYPA 1PJ4A 3Q3CA 4KWIA 5TIIA 4E5YA 4WEOA 5A1TA 1PQWA 5ITWA 3OIFA 4J0FA 3EZYA 2ZTUA 3VPHA 4DLBA 3WTBA 5CDSA 3AM5A 1T26A 1YVEI 1K0UA 5JCJD 5JY1A 2OL4A 4YAGA 3FWNA 4ND5A 1NPTO 4YVFA 3EC7A 4OOEA 1R4NA 4MDHA 5LDHA 1ZXBA 4MVJG 1E3IA 1OI7A 4LCJA 4GGOA 3UAGA 4EW6A 1EUDA 3IQDB 2CY0A 4HKTA 1YJ8A 4HNHA 5CHEA 2EP5A 4PG6A 4KOAA 4E2WA 1E3LA 3Q9UA 4FFPA 1N92A 3H3JA 2VHVA 4PLHA 4UUMA 2AXQA 2VTEA 1Z75A 4KTVE 1MV8A 1UH5A 3FF4A 2P9EA 3TL3A 2RIRA 3DHYA 4XYGA 5G4KB 5GY7A 3Q2IA 1NAIA 2YQ4A 1N7HA 3H5RA 1UDCA 2QIOA 1K6IA 3BTSA 4S1VA 4YXFA 2D1YA 1LSOA 4IDBA 4OQZA 3H3FA 6ADHA 3C7DB 3D3WB 3DAPA 4YTEA 3ZWCA 5I7EA 1R4MA 2WD7B 3M2TA 2DBQA 3NUGA 3SXPA 1KBZA 3K30A 3GVPA 3MJTA 1PZHA 1J6UA 4L8VA 1TT7A 1VJTA 1B15A 3CZRA 3U4IA 4FDAA 4RPKA 4U0KA 3GNQA 4J7CA 5G2OA 1JW9B 2BGKA 3OJEA 2VQ3A 3K2BA 1ARZA 3F47A 5DDIP 2B69A 3PK0A 3PWSA 1VJ0A 4N5NA 5KWEA 3GR6A 2YHIB 3LVFO 1QRRA 3F1LA 3GAZA 4XKJA 5A03A 4WE3A 4BO0A 1HSZA 3DFUA 3Q11A 2HSDA 1E3WA 3DONA 5H81A 3DB2A 2PD6A 3JYOA 1UZMA 4AJIA 4RPHA 4BKUA 3ICCA 3HNPA 4ALJA 3QY9A 2A94A 2VNAA 3RFTA 1VSVA 4MIOA 2C07A 4BO8A 1P45A 2V65A 3D4OA 2HMTA 1RM4A 5IDWA 1GYRA 3WOHA 3L4BA 4QTZA 4IS2A 2AE1A 4TSKA 3TZ6A 1CERA 4RF4A 3WLEA 3DMYA 3TF5A 2Y1DA 4UREA 4HNGA 3OP4A 5L51A
chains in the Genus database with same CATH superfamily
3GJSA 4CKBA 3CVUA 5GTDA 1LK0A 3DNMA 3DE1X 5A0FA 2OORC 4JOSA 5BR1A 1VLLA 1P3Y1 2AK2A 2X9NA 4TLBA 4YALA 4L5AA 4EPWA 1JWBB 1K8QA 2QTLA 2TMYA 5FQOA 5KTNA 4JB3A 4X3CA 4XJSA 1XDBA 2IHZA 2J3LA 2KLBA 4YRCA 2YCBA 5TT0A 2PGDA 2CLCX 3LLMA 3ND6A 3N75A 4MCJA 4ARZA 4F6RB 3S8YA 2ON6A 5BR8B 1NP6A 2JIZA 4I7EA 3N58A 3FRHA 3K6JA 4CM6A 2X58A 4PGAA 2IOHA 3EGVA 5GM2A 1YQDA 1LPMA 1Z62A 1EP1B 1GQYA 1TLLA 3VNVA 1M7BA 4ANFA 3U0VA 1DKLA 1RLIA 3WRXA 1J2EA 1DSSG 1TKCA 3L5KA 5JNSA 1BDBA 1UKVY 2XYRA 1N2CB 3ZBUA 2YHBA 1JKIA 1N5LA 1W25A 4ZT3A 5BQFA 4DIUA 3COVA 1Y7PA 3D3KA 1Z4IA 2JD2A 3MK31 3NETA 4BXOA 1FP7A 1CF4A 1CT9A 1EDZA 2GPSA 2J8ZA 3TLJA 2GVZC 1PZFA 5DW3A 1PJAA 4OHOA 2OM2A 2WTAA 2GAOA 4ZQEA 5C35A 3LX4A 2XD4A 1Z4NA 2CDRA 3K3PA 1Y7TA 1HDZA 2BZGA 3IAAA 4CU2A 1BS9A 3PYLA 3HY3A 2MSEB 2XRMA 4JD5A 4EMBA 4B34A 2DTDA 2OC9A 3TPZA 2QD1A 3CQ9A 4G5XA 1IZ8A 2IIQA 1X15A 2PT9A 3AW8A 2B34A 3AJ9A 3TYXA 1NXTA 2A78A 4RD2A 1ODIA 3H9QA 1WP9A 4G4SP 4QUEA 3KQLA 1D2CA 3LXXA 5LZ5A 2OENG 1UFQA 2CBXA 2ORIA 2I34A 3GH3A 4Q3LA 2YYYA 4XYEA 4YJGB 4G1UC 4ZDJA 3TAHA 3FVQA 3C5WP 2K5UA 1BXKA 3DHVA 4PCLA 4KGZA 4XD7D 5C1OA 1QFXA 3B1FA 3BC1A 3GBSA 3U39A 2AZMA 4ZAGA 2V1XA 3ZNQA 4ENWA 2BISA 2GD2A 2UVPB 4LYAA 1RZ3A 4N9QA 1U81A 1P77A 1N3BA 4YRAA 3VPSA 4URFA 3PEWA 3PX3A 3KBOA 2PUGA 4Q3EA 2B1IA 2GAAA 1MB9A 2BFOA 4I14A 4E5VA 3A3KA 3M6XA 2VXYA 4NYIQ 4GMGA 2QLMA 4FXPA 2D6FA 1DC7A 2Q3CA 2R751 4JJGA 3FB4A 3ZY3A 3VDRA 3QUBA 1KORA 1TT5A 4L9SA 2NSLA 2AC4A 4RK1A 1TMYA 4UBIA 5D2CA 5C8YB 5KJCA 2D1SA 5JQWA 4IDDA 2E49A 4KV7A 3B3FA 1HV8A 3C3BA 1GL7A 1JZQA 1X8LA 2HWKA 2J0UA 3A9SA 5HRUA 4WX2B 4BB6A 1EVLA 1I33A 1DQSA 1NOJA 2XMBA 1VG0B 4YMVA 1E58A 4AZ3B 3R40A 3HU3A 3QYAA 1OU0A 4M1MA 2XW6A 4V0LA 3RREA 2B8TA 2O54A 2NXCA 4MVYA 4BBJA 4ZEVA 2IDJA 3G59A 3I3OA 2JLWA 2O8EB 1PE0A 4YJ3F 3VNAA 4H59A 2YCLA 2XHEA 2EF1A 4IV5A 3W05A 2XVXA 4CHTA 3FTFA 2ODBA 1KVQA 2VSFA 5EIAA 3H5NA 1JR6A 5I4BA 4B3BA 4AUKA 5A4DA 3W3AD 1MUUA 1W30A 3KJQA 3L06A 1GXSB 4S1PA 4KFTA 4Y2XA 5GAJA 1G1AA 1RRKA 4O4JA 3P9NA 3DL4A 4FWBA 1D5CA 2VSNA 1QK4A 1LTHR 3N9IA 4LDRA 2FX3A 2XIQA 1KAOA 1E2QA 3JTEA 4MW2A 4RW0A 4NJMB 4DM4A 3K1JA 3OKFA 3KDPA 1QHSA 2FI1A 4L02A 5E2AA 3TZLA 4FIDA 4GDFA 4V3CA 1L5HB 3GUVA 3QTTA 5JYDA 1N2OA 1THGA 4KFUA 4BQNA 4CEHB 2JGDB 3B9PA 3OU2A 4W5OA 1RI5A 2W6IA 3LRPA 2POQX 1EXDA 4HFRA 3SBOA 1ELOA 1XZPA 3B2NA 4G0VA 1QIDA 3V8NA 2Q3EA 4LI0A 2VSYA 3F9CA 4GMDA 2H9YA 3VAAA 2GJ8A 4V1CA 2YHUA 4UNSA 1E1CB 5FA6A 3A32A 4YDHB 2ZLBA 3BH6A 1HT3A 1I5OA 3H0KA 4EJ6A 5KWIA 2PLRA 5CGQB 3D0QA 4EJ0A 1RWKA 2VOJA 3R3WA 3TKYA 4LFCB 1GRNA 1D4OA 4PBTA 4PEVA 3NJ8A 1VPEA 3EUWA 3RTAA 1YZHA 1OYVA 2XUQA 2Q4RA 4HNAB 4R9SA 3TOSA 3ZE1B 5JXIA 4AKEA 5FWYA 1NATA 2MT9A 3HXTA 1FP6A 1NBMA 3O8OA 1GZ3A 4G8CA 4ZKEA 4BZQA 1TD9A 3Q5GA 3N7TA 3VPDA 4CM9D 3BHJA 3OTWA 1ZOIA 5ALZA 3FBGA 2R1TB 2ZU0C 1NE2A 1HOXA 2ZUSA 4MQEA 4DPLA 3EZFA 2FPPA 2ATXA 3QLEA 4WJKB 5EQDA 1K7YA 2HDHA 4I9GA 5TPZA 1SVKA 1LQUA 1ZAYA 4GEKA 3O3OB 3K96A 4MI1A 2P4EA 3X2EA 1T1SA 4IOKA 4QFDA 4UOQA 2GF9A 5A3VA 1AE1A 4LHEA 2OZLA 5JATA 1ZCZA 2VJNA 2RI6A 3ZLVA 2NM0A 1MEEA 1QH9A 2V54A 1DU4A 3QXGA 4AROA 4LE1A 5DMXA 4D43A 5JAQA 3FJYA 1JG7A 5EXPA 4YCMA 1TM1E 1TKAA 3DTVA 3L3BA 1BMFD 4C9BA 2AMVA 2ZSHA 1LU9A 4COKA 5GPBA 1ZD2P 4IW3B 2EWMA 3TUIC 1R5JA 2B35A 4QDUA 4QPNA 3ETHA 2F1HA 2IGBA 2FPLA 2YW9A 3PEVA 4GO1A 5JNWA 1ADCA 1YL6A 3CB4A 3CH7A 3SJAA 2MDTA 3DG9A 5D00A 3Q8MA 4EQZA 2QP4A 4WCFB 3KLNA 1EJBA 4EDFA 1GGMA 4IUBS 1J9ZA 2A1IA 3Q7PA 4IQ0A 2MOKA 9MHTA 1P5RA 5C4IA 1Q77A 2PZKA 5AKIA 1EVIA 5CVVA 4PSVA 1JR4A 4EDHA 4RTPA 1PGJA 4N0PA 2RGBA 4FT2A 3MINA 3D6UA 3D5EA 3LWZA 4WKOA 2IU4A 2P4QA 1QZXA 3TJRA 1U65A 2CSXA 4WBNA 4FDMA 1E6EA 4U7DA 1CUBA 2JFOA 4ZWNA 3RTEA 3O4GA 2YR0A 2OGTA 2WWTA 5LDGA 1NTOA 3E6AA 1PGPA 3EN0A 5AICA 2PL9A 4IOLA 4RAOA 3L7OA 1E63A 4YDSA 5K6RA 4TL6A 5ALQA 4MRNA 5ADWA 3ML1A 3OETA 4DVGA 3F73A 2P9HA 1UBOS 4QTUB 5DHUA 2W6OA 5L6MB 4PANA 3I4CA 3DBOB 3SZ3A 2JPDA 1Y9AA 3BPSA 3OCCA 2WSSA 4HFNA 3K1YA 4CQMA 3KFXA 4R2JA 4DYDA 1IMOA 2FWAA 3PDIB 4PN7A 1I7QB 3NVDA 1A7KA 3G2IA 2NYAA 1EFRD 4CTMA 4JA0A 1G42A 1R1DA 3DEAA 4IXTA 2YN2A 4NV1A 1ZXLA 2D0IA 3SG0A 1AXEA 4IWNA 3V4VB 5AUPB 1XMQB 1GUFA 2ZRCA 1IVSA 1L2TA 1Q1AA 1VJ1A 4G01B 2W8ZA 3JYLA 3O2NA 3R0JA 3F49S 3HZOA 3CEJA 1JFFA 1LX7A 1HDGO 2RKWA 4QYTA 1WDWB 4Q1AA 4QFCA 3MMNA 4WNYA 4TWJA 1A97A 3KEMA 2YBDA 5K3FB 2ID9A 4JP3A 4B6OA 2VQSA 3L5OA 4CETA 2QD3A 5CFPA 4EYQA 3RK0A 3EGDA 4F7WA 4CIYA 4QT4A 3ZZUA 4CM1A 4ENVA 2ECOA 2FPXA 4J1SA 4HAOA 4I19A 1NJ1A 3P27A 1I94B 3AGPA 3K1AA 5AM5A 1Y7IA 1UDBA 1WHTA 2QMZA 5KDDA 3CNBA 3A04A 1ZESA 4E5PA 4U02A 2QQ5A 2AZTA 4PR0A 1C29B 1VCIA 3VX4A 1OAOC 4U9IS 1C4OA 3MTIA 2OUKA 3FDXA 4B47A 5CG1A 4P93A 1VJGA 2H29A 1CS4C 5FUWA 4EA9A 5JJLA 4JSYA 3I8SA 4CUKA 1DTSA 1ZNZA 4MX8A 5CLIA 1LRKA 2HRRA 1J1UA 1Y9DA 4Q82A 4A8PA 2GLXA 4AJ9A 1M6WA 2OGSA 5KTRA 4ONEA 4JT4A 5CVUA 5DHPA 4MVJE 1R9NA 3FNFA 4BP3A 2BBSA 3ZOZA 4DAEA 1N2GA 3U2QA 4URVR 4BLOA 1B6GA 4H08A 4RIFA 1UPUA 1VDZA 5JC1A 1JWAB 2DR0A 3VKVA 2IXTA 5K8TA 1LS1A 5F51A 2QPAA 1MABB 3C48A 3FW1A 4IZOA 5NULA 5TT1A 1Y8RB 4G0NA 1KDOA 2PA3A 3M2PA 3LCJA 3C7KA 2JJYA 1CF2O 3MRTA 4M8LA 4TVSA 5FDFA 1A8SA 1JMYA 1VLZA 1OXBB 3O9MA 1YR7A 3PJDA 4RMGA 1DBVO 4RPIA 4ZC1A 3WK5A 4PC1A 3QV1A 4NOLA 1I5RA 1V96A 2FHPA 4ND4A 5KDLA 1NJ8A 4Y6RA 4DANA 5C5IA 2IH2A 4AP9A 3MJFA 3BE6A 3GYBA 2A0YA 3MINB 4BMVA 4EELA 1UBGA 1DB3A 4AY4A 4BXOB 3MTQA 4HDKA 2OKGA 2IGTA 1N6NA 2HTFA 3MWLA 3MJCA 2J7KA 4N3NA 1SBYA 1CIPA 3FMIA 4GT1A 2ZJBA 4OQMA 3M1IA 1RPZA 3BA1A 1U8EA 2DG2A 5FFMA 3IMKA 5AUOB 3SD7A 2OBLA 1MB0A 5FRDA 1U28A 5E4JA 3E7WA 4V0OA 1EB9A 1XPOA 2Q5LA 5D3KA 2GPNA 3EZ6A 3SC2A 5E1MA 4QJBA 3DPUA 4FWTA 3NDJA 1U9YA 2PXHA 1TU0A 3K72B 5A6SA 3M8KA 2YS7A 1KF0A 2Q0SA 2L82A 5HFNA 4G1MB 1TA9A 2JRCA 5K8VA 5EGSA 5BPHA 4HH4A 2A92A 4BE7B 3G9QA 3PNVA 3GEDA 1RAIA 4FMDB 5IVPA 1W581 5D1HA 3I9LA 3VOAA 3KXLA 1N6PA 1WULS 2R25B 1LZKA 3L02A 4JJAA 3GMDA 3VFDA 3EXEB 5IANA 4XARA 2X3FA 1T0PA 4ZAXA 4ECAA 1BCSB 2CFCA 5BYBA 3UJCA 3CTMA 1OFTA 2P7IA 4EKYA 1C9MA 3W4KA 4NOKA 2G40A 4ARSA 3TSCA 1CJMA 1LBEA 3A3YA 4P92A 1D2HA 2CWWA 4LY0A 3EULA 4N0DA 3ZY6A 1Z5ZA 4DEYA 1AGRA 2CXRA 221PA 4DZTA 1XWIA 1LSUA 2R79A 3KUKA 3C15C 3TBHA 4OL0A 4AULA 5HFAA 4IDNA 4E88A 3M1YA 4R98A 1J25A 2XGGA 4FZ3A 2ZQ5A 2ONCA 3LKZA 4JL8A 4KB5A 4X7RA 5FWXA 3I0MA 4FHEA 4G9EA 2WYIA 5CFQA 2HFKA 4NU0A 3A10A 3ZCPA 3CT4A 1NC1A 3VTKA 4B9EA 4EFKA 2IX3A 1CZNA 4JELA 3AHGA 2IQ5A 3P8ZA 2AZDA 3ZH2A 4E46A 2AG0A 3BWDD 4A26A 4C06A 1JLHA 1W1WA 4HX2A 4OKSA 3A05A 4HNRA 2YWJA 4US1R 1PJRA 2QDXA 3I4LA 2OAGA 5CK4A 3NWPA 3OAAD 5GONA 5ITZA 2AX3A 2UYYA 1M6VA 2ATCA 3SVZA 4QOSA 1U2GA 1RPTA 1WKBA 2ESRA 2Z2XA 3KAPA 1SOAA 4H7DA 1EQ2A 2FPGA 4NENB 2X0EA 4YRKA 1XJQA 4TWRA 4EJFA 1P18A 2GBCA 4I08A 2CEAA 4L9RA 3E9MA 1JTFA 5H8WA 3MTDA 3Q1KA 1H1LB 3T3NA 3A2KA 4ACBA 1NUSA 5HGJA 4MVJP 3UMMA 3KKNA 5IMSA 5IJ9A 1AZLA 3E8MA 1KP3A 4M0PA 3IPXA 4NYIR 4ZVOA 1ID1A 1RI4A 4ZVMA 2WSYB 4WESB 2E4XA 2V5VA 1RJEA 1ZMOA 3WLKX 3EBLA 2WU1A 2FZVA 4N8DA 2EGUA 3COSA 3EW9A 2OV1A 4NY1A 4XM2A 1NDHA 3FX2A 3GA5A 2VAMA 4FVTA 2GBPA 1WV0A 2X86A 3D6TB 3O21A 3UHOA 2PTHA 4EZEA 1XD8A 5BNWA 4H35A 2TMDA 3ZU6A 4P4TA 5IK2D 5KOYA 3A2MA 1YNSA 2GK3A 3H2GA 1N6HA 1R8QA 2DFVA 1HEUA 1PSWA 5JAMA 1NKVA 3EVTA 2YZNA 4FJ1A 1TMKA 4RQTA 1D3AA 4IMJB 2C3PA 3ZGZA 4POAA 3FLMA 1QG4A 4YLEA 3SYNA 5BMVA 1BWSA 2QTNA 5E2IA 5KYVA 3E3MA 1KQFA 4LXUA 2BI7A 3T15A 3IP5A 1U2ZA 4GLFA 2DFPA 3RIGA 4DHEA 5A1JA 4RESA 4G5YA 3I0NA 1BCSA 2CK3A 3IPAA 1T10A 4CFZA 3FZGA 1NXQA 4P86A 5E6UB 1U5CA 3FWZA 5AHXA 2JK0A 4NQZA 4B4WA 4DN6A 4ZYXA 1APBA 4URUR 1H2ZA 3FWPA 3KUUA 4GD3Q 2NAFA 4PXAA 1AF7A 5K20A 5KJ6A 4XI9A 1WZCA 1V7ZA 3OZEA 4ZK6A 5I3CA 4DJAA 1ZL0A 2J3IA 2VAWA 1UR5A 2G5CA 3M82A 3DOOA 4HMPA 3VO9A 2C59A 1ZM4A 4UCXA 4UQOA 1F4PA 4LYGA 1NFRA 3E9YA 4KO3S 3OJ0A 4QPJC 4XEUA 4K0KB 2IYTA 3Q72A 3BWMA 4GYKA 5G1OA 5L95A 1J24A 3CWCA 2BBWA 2KYRA 3ELWA 2WA2A 3O1JC 4OG2A 4R8VA 4UPDA 3S2EA 3V3KA 4XFKA 1JFSA 1XUOA 4MUGA 1L4EA 1YIDA 1GV1A 1LLDA 2GS9A 3OX3A 4BTLA 4U2EA 2MSWA 2QZPA 2A35A 1XEXA 3ZS9A 3IQEA 4YCLA 4Z1MD 5LP1A 3EAQA 4BNTA 2EC5A 3LYAA 1JYFA 1I0LA 3GJ3A 4GIBA 1NW5A 1G2IA 2P9YA 1GUZA 4JT9A 3ITKA 2XGJA 2H85A 5JADA 1XRJA 4N48A 1M2OB 2OBNA 3TR6A 3V1NA 1ZCFA 1Q57A 2Y05A 3BHMA 2ZIGA 3LOPA 3QOWA 3ZVRA 3SLGA 1N8KA 1QOPB 2MR6A 3GRPA 1BEUB 4YQZA 5AMXA 3LU1A 4BQRA 3IAEA 3ZBPA 5MF6A 4DLSA 4JP5A 1RTKA 3G79A 3RJMA 1N32B 3D3EA 3LLVA 4ZQCB 1JE1A 1UPAA 1R27A 3VBCA 4DR3B 2HMSA 3LMKA 2IYVA 3AEQA 5CX1A 2A9JA 4KPUB 1NSYA 1VKJA 5M34A 1SG0A 2AI2A 2WIKA 3VYVA 4TRRA 1XPRA 1N0HA 2HLHA 3IHLA 3OOYA 4MI9A 4KV9A 3W3AH 3THYB 1YS2X 4G63A 4K6CA 2JEYA 1QQ5A 1ZMXA 3AY3A 3JSXA 1DKRA 3QV2A 3AJ8A 4IJKA 4QELA 5DJ5A 1C41A 3L77A 2H52A 1IBMB 1XCGB 4M9CA 2LWIA 4IIJF 1W44A 2J9FA 2XMQA 4NE2A 5DULA 3AILA 4Y1GA 4HVAA 1G4UR 2IZZA 4KMMA 3VGPA 4BKPA 5MFZA 1HWYA 3P5SA 4YQFA 4I1VA 5EUMA 3C8MA 3HJGA 1HZZA 4ZYTA 2J4CA 1ISRA 1OJ7A 3EEIA 3EMVA 4F6RA 4X00A 4M7OA 1G7SA 1AK1A 4TKUA 4DV5B 1ACMA 4TLEA 4BMDA 1TZ2A 3HN7A 2BCJQ 4AECA 1WQ1R 4R05A 3TFQA 1IONA 3NNSA 1MQ9A 2P9BA 2FR8C 3AM1A 1TQHA 1R0LA 1P5HA 4TKVA 1N2CE 1I4LD 4ERXA 4F56A 2N0SA 4WECA 1C4WA 2NNWB 4OLJA 4X62B 1H2EA 4KH1A 5EZ6B 1QG6A 1JKJB 1W5SA 5KNBH 2CLDX 5CMLA 4C7OA 5DIZA 1ADJA 1RIIA 1UPCA 3SOPA 1S89A 1RW4A 2JFXA 3GXOA 2NUAB 4DLRA 3HHEA 2NUTB 4NPAA 2WIBA 4C0SA 1KIAA 1YCHA 4C7MA 5KEIA 4YPFA 4GU5A 5K0NA 4Z4CA 2XT9A 4QG7A 3G88A 2QRJA 4BO2A 4LRYA 1YA6A 4IPTA 2VDJA 1B0AA 3C6YA 4HDCA 1NJGA 1X7DA 1G38A 1T2AA 2CUKA 3MTAA 5TF4A 4JUBA 3IKLA 3PV0A 2JGMA 4KOEC 3FDIA 1MORA 2AFHE 1MC1A 4PXYA 4HRYA 1OE0A 1B26A 1ZIXA 1YJQA 2OFPA 3RRYA 3T5TA 2WM9B 4HUTA 1FJXA 1V1MA 3W1EA 1Z63A 3EGIA 2ZYUX 1BX1A 3DF7A 4I6GA 1CQIB 1AXGA 3NGLA 4B81A 4WPGA 2ZJAA 4PO9A 3AUSA 4W5QA 1QAOA 2C88A 3BMCA 2JFVA 4IHQA 3RARA 1KYXA 4AMBA 1IN5A 4E08A 1IIRA 4M76B 3TEJA 1WHSB 1ZHHA 3G2NA 3KUDA 2C58A 1SB8A 2HV9A 1SCDA 3ON5A 3RVMA 3LT4A 4UOZA 1JDNA 1STOA 1P3DA 3G0OA 1U0BB 3LXUX 5D3MA 3D9QX 3G5TA 3PBKA 2CL5A 4R41A 1VCHA 4RMNA 3MJ4A 3AIMA 1L4BA 3N07A 4FHFA 4DCOA 1AK2A 1ZI9A 5EJMA 3OWHA 4G5RA 3HMQA 3Q3GE 1S8OA 4HQ0A 1Q44A 1WEKA 4FN5A 1HYQA 3DZCA 2F00A 3W8DA 1YZVA 4CNBA 2ZJ2A 3INGA 4LC9A 4ND6A 1JEJA 4RNDB 5FTNA 3T9AA 3SJUA 3UQZA 4WZBB 3DZFA 2RHGB 1GG8A 1JHPA 2JFQA 3LUCA 1OI4A 3LLUA 2HK7A 4G6ZA 5CVDA 2C1XA 4IJVA 1NA5A 4CL3A 3KWMA 3HFGA 3OPYA 2C8KA 5KNBA 5K8JB 5BWOA 4WCFA 4ERNA 2NT4A 5H4HA 1PUXA 3OHMA 4L57A 5L9AA 3ED5A 1K63A 3LM8A 4GL4A 4FE3A 2H0RA 4H77A 5BQPA 3SNHA 3ESYA 3VZCA 4OI0A 3ZGXA 1S2IA 3KYCB 1EI9A 4G9GA 1D4AA 3HCWA 5DNUA 3VJRA 1C8KA 4MUEA 3C5CA 1QV6A 1VI2A 4PZUA 3WYNA 4AN4A 4DLLA 1SRQA 2CUNA 2PA0A 4UZEA 5CFMA 1UT5A 5DLEA 3SICE 1CY8A 1KQPA 4AYTA 3T3OA 2JHGA 1EK6A 1NJSA 1MV5A 1XG5A 2NXNA 1T5OA 2V5UA 2WLTA 3AFMA 3IT0A 4TYQA 3W8EA 2W4MA 4TTSA 3H7IA 3HADA 2W42A 2ZRBA 3JQBC 4BOYA 1RWNA 1YR6A 1YBHA 3G68A 1BYIA 1PIWA 1CR6A 2XWJI 1GLNA 4MP8A 1ADBA 3EAFA 1XTIA 4P3PA 1OIVA 1LX6A 1ULHA 1NLMA 2ZIXB 1J7JA 1Y3AA 4TV9F 4YMSA 3TKAA 4KWHA 5A62A 1A71A 4FGWA 3DC2A 1HDYA 5BNZA 3PL5A 2G0AA 1A9RA 2GFHA 4H7FA 3OTIA 1CDOA 1GUDA 3KTAA 3QXCA 4BKRA 3BILA 2QTGA 3L8YA 4EI9A 4UW9A 3LUAA 4N5HX 2XUIA 3B85A 4GPZA 4IRUB 2NYVA 3AM3A 3IB6A 1D4FA 1HRDA 1JJ7A 4EB6B 4QHTA 4K7JA 4MGZR 1XZGA 2ZRJA 3FWYA 1PL8A 4I1SA 3PGA1 1QMPA 4J9UE 5DX0A 2FTKE 1Y6ZA 1SQ0A 1TOAA 3TXYA 1LA2A 3LZ6A 2GHIA 3NT4A 2OQIA 3DM9B 1XFDA 4MRVA 2XR1A 1U5BB 3L7MA 1E0KA 3NBAA 4P81A 2C2HA 4YEDA 3VO8A 4D3DA 1JE0A 3JCZA 4MUJA 4AB1A 5HKLA 4BZZA 1TU3A 1RT9A 2YXBA 4M8IA 4TV9A 5KVAA 3JQ8B 2RDMA 1P5ZB 4NX2A 1B16A 4QBIA 2OLEA 3IIJA 3UAZA 621PA 3AHIA 4U7WA 4MVJI 1QBKC 3FDZB 4DCJA 1MNAA 4JBHA 1N6LA 1QMGA 1B41A 2XT6A 4MA5A 2ZUFA 1RADA 1B8OA 3B7WA 1CRQA 3TKLA 2G4VA 3N70A 1L5YA 3ZJ5A 2Q9AA 4OQYA 1FNSA 2YVKA 1E3MA 5CH8A 4YRZA 2YRXA 3NDPA 4QOHA 1WXGA 3WAGA 1P0FA 5DEIA 1LV8A 1T6BY 3ICPA 4DA4A 4WXRA 1OJLA 2X2EA 1GG5A 1JR2A 3DTYA 4LKRA 1F4VA 1A9QA 3LQ2A 3LFHA 2JCGA 4CLRA 3PP8A 1D1PA 3OC0A 4DSOA 3D6MA 2WWVD 1YBFA 5KVCA 1L0BA 5C46F 1WUJS 5HPYB 4M1EA 1JDBB 1TUGA 1OYOA 4TGLA 3MERA 2EDAA 1VIVA 3W8RA 3FPBA 3PXGA 3G2HA 2RGGA 2ZXEA 3RYTC 4F93B 3AUAA 3JQ6A 4F4CA 4K1XA 2J48A 3D4BA 5T4EA 5CLJA 1JEOA 1RI2A 1NR5A 3MAGA 3OQ1A 4OI1A 1V6SA 4RZ3A 2NU9A 1UKBA 1THMA 2YZMA 3DLHA 3TW4A 2X9QA 2OD2A 4ITUA 1ZVMA 2CKMA 3FGZA 3SEFA 3ZY5A 2YINC 1P2BA 3F6BX 3NKVA 4N65A 3C6XA 3E70C 2PZJA 2A4KA 3C7AA 3PC6A 2VCHA 4IDFA 1WBDA 3WV5A 1EGAA 5AWFC 4PV7A 2ICAA 5DNEA 5B2ZA 2LZ0A 2Q8QA 2YJ3A 2ZRAA 3LVRE 3B82A 3VR5D 2WMNB 2QX6A 5DTIA 3NS7A 2Z9CA 5TMDA 1U0FA 2OPHA 3OQNA 3COJA 4FSHA 5IG2A 4YP5A 4YACA 2G5GX 1JPNA 3ETJA 2F2TA 3NHRA 4O2BA 4U7PB 5JXWA 5FB3A 4FFBA 4UHDA 2YOHA 3WJAA 3ONFA 1RXYA 2C0QA 4DQVA 1A76A 2FE4A 4L5YA 2GKGA 3NWOA 3NHKA 4O1HA 2O5CA 3BXOA 4AW9A 3SNKA 2CXSA 3D8RA 2OLKA 2ZIUB 2XKAA 5J1TB 2VDVE 4HQNA 3I5YA 3NHBA 1SVMA 1NWCA 4S24A 5KNBD 4AO7A 2BKEA 5T3UA 3G0IA 1FLNA 2WU4A 1AQLA 3AEUB 4Y0VA 5H1YA 4DIFA 3HRHA 5T67A 4KX3A 4LKOA 3KKKA 3VI4B 2R97A 5KIAA 4KREA 1M33A 3L46A 4ALNA 3BHNA 5JD5A 1W85A 4OGLA 3CF2A 4BTVA 2AYXA 2FYTA 1LTQA 4UD2A 4LG1A 3ZUGA 3MCWA 4PCAA 1FMFA 4K6MA 5AVJA 4LYJA 4RTLA 3K5IA 1N25A 3DEHA 3DOHA 2YWHA 4HEA1 2CXTA 1QHFA 4H7IA 3SFVA 5ADUS 3C1UA 3KEQA 3OZUA 3OPYB 4KAXA 1K92A 2FWNA 1JYSA 2X4IA 3AB8A 3F3MA 3H97A 4N49A 1K8YB 2FEOA 3RT7A 4I1UA 5KOHA 1DCMA 2QQEA 5F7XA 2PMCA 10MHA 3DV0B 3PDCA 3PNQA 3USES 1VMAA 2XUZA 3RRBA 4IZIA 4RS3A 5IWCA 1XP5A 2W8BB 1BDJA 4ARVA 4H4CA 4Q21A 4F1JA 4WCDA 1C3EA 1Z6QA 4IDOA 3GVIA 2R85A 2ZB7A 4TXNA 3GUHA 2BELA 1L6RA 4A16A 3P0IA 4GICA 4NMLA 2A5FA 1SY7A 1WG8A 2OZPA 4E0BA 5CG2A 4C2UA 5EZQA 2V7EA 3MRSA 3MWGA 5G0VA 2O8CA 5T64A 1N2SA 2EEZA 2I7VA 3PHCA 4UTZA 2CLIB 2PBZA 4F8JA 3V7FA 4QLAA 1ABBA 1CNEA 1OFUX 3G5AA 1ZLYA 4GOOD 1WM1A 4E51A 2ZUWA 3PNPA 1WKVA 3VMMA 4CEIB 4AKGA 3PGLA 1IY1A 4FNOA 4LN1A 2Z43A 2CZGA 1KAMA 5EPEA 1XEWX 5CDFE 5A7GA 1BROA 4X1IA 4X7PA 4BB0A 4ID9A 2YV1A 1DG9A 4KQEA 1E32A 5HS6A 5DYYA 5JQGA 3PHJA 4LMBA 2WK1A 4ZYUA 1ZH4A 3VR6A 4BNLA 4PPYA 3MUOA 1JZSA 1F6WA 2EZ4A 3O3CA 4JY7A 5AI4A 1KI3A 4F45A 1R6UA 1L8AA 4MJXA 5HF5A 1FRVA 1SVLA 2GKOA 2HA4A 4TLCA 5DBFA 4AZWA 3BSFA 4ETMA 1MQSA 2BCEA 2YC2C 3B3AA 2LE0A 4AF8A 4ALKA 4EW3A 2H1VA 4GI2A 3SEAA 2FFRA 1E2NA 2Z9BA 3MTBA 1F6DA 3TO5A 2F55A 1Z2PX 3VR0A 4KO1S 3JQFC 2J3DA 3NHUA 1A96A 2DU8A 1HORA 2NNLD 3OT1B 3O73A 3V1KA 2W98A 1RWWA 3WLNA 3CNQS 2YDXA 3NCTA 4Y9DA 1BH2A 2BTQA 4YR7A 1PLLA 2N3ZA 3PXCX 4BEBA 4LZOA 3C7CB 1NUTA 3C8HA 4IXMA 4AL4A 3CO5A 3MT0A 3ZGLA 5KC8A 3DCYA 3M5CA 1MTOA 3JASB 3FTDA 1A9YA 3MWDB 1NQVA 2AI1A 4NCHA 1E7YA 4WFQA 4MVCA 4KIUA 4B35A 2YQZA 3AV3A 3P2MA 3WB0A 3T9CA 5KTYA 4HNVA 1O6CA 2BL4A 1KH1A 2I80A 1JHXA 2WU3A 3HQ4O 3OCZA 4DILA 4YT5A 1M34B 4HQOA 4RV9A 4DGQA 3GARA 3KR9A 1X86B 1OASA 4E07A 1FBNA 2D5IA 4GPD1 4JA2A 3D0KA 1P4JA 4CIDA 4F84A 3GRKA 1U8CB 4DRYA 4OU5A 1HC7A 2IZ7A 3WO1A 5IJZA 2VH1A 5CURA 3SGLA 2E85A 3BBLA 3OBIA 2NO5A 4UATA 1ZQ1A 2GI4A 5DK6A 4YUYA 3ITNA 3UYKA 2Z6QA 2OV4A 4FFSA 4J16C 1F9AA 1P39A 4IDPA 4QYIA 1RYBA 3KR0A 4IMPA 3IVXA 4NEQA 4WNCA 4X20B 5AJTA 3YASA 4D9BA 1VE3A 2I7CA 1MX1A 3IVAA 1JIIA 1WZNA 3RYFA 3VPAA 1M1YE 1UPBA 4LSZA 2HCTA 5IBQA 3GOQA 1CVRA 1DV2A 2HKIA 3OI7A 1GGFA 2BZSA 4EGAA 4F06A 4JN6B 3RRFA 2H59A 4EEKA 3IX7A 5FBQB 3W79A 3CT6A 2WT8A 3HC7A 5C3MA 3KB8A 4ZCPA 5SZKB 3ZDFA 2EX0A 4QT0A 1CR2A 4E33A 2WHEA 2PGAA 2R8XA 3CLKA 1Y6RA 3TK1A 1SVOA 4P5DA 3T54A 5EE3A 1EFVB 1TRKA 3BULA 3CG4A 5TXGA 3FPAA 2GZ1A 2WJ6A 3DA8A 3GLFA 1IZYA 4TYPA 5C0OE 3NW9A 1NW7A 4IIJB 1SUSA 5EVJA 4YV0A 1T9CA 3MT9A 5KQMA 4OH1A 4NZMA 5C53B 4XDHA 3KXIA 3SQLA 1E98A 3GLVA 2CV2A 4MR7B 1E1YA 4OEHA 4ZRNA 4GMHA 3RVQA 4J07A 4XD2A 4L4ZA 1ORIA 1ZUD1 3O90A 4JS0A 3RC3A 5A02A 3NANA 1Z5OA 2G09A 2GZDA 2F3UA 3QX8A 2JASA 1AMOA 4FZRA 4CLXA 1PJCA 3QITA 3WP1B 4OXYA 3X3HA 4UMEA 2IY8A 4FN4A 4UU1A 3SC2B 1VMIA 2GDZA 2WHQA 1LRJA 4MRRA 5HJ7A 4BNUA 3EPPA 2Q2OA 4P84A 3GJ6A 2IPMA 1NBIA 2A5LA 1B3RA 4Q4AB 1GTG1 1MC4A 5CLQA 4MKGA 2Q4BA 4UEJA 2G6TA 2W2TA 5FWYB 1IJKA 3DBLA 1PYOA 2SECE 2XUFA 4WAUA 3T5DA 4E7PA 4JFRA 4Q1VA 2O05A 3R7WA 1NRWA 2QTHA 5EVCA 1VFNA 4EF6A 4ZYVA 4K26A 3U4QA 3RUCA 2R6R1 4QOJA 1P6QA 3H9GA 4DMGA 1L5MA 1W49A 4P6VF 5DNDA 2XA9A 4DIMA 4DUPA 3JQDA 4U4AA 1VP3A 3JQ8A 3HN6A 2DECA 1OCEA 4YAKA 5J4HA 1TUBB 3AFNA 5TEVA 4BN5A 1ZICA 1M1NB 1BE0A 2UZ1A 4EYOA 2AB0A 1JDTA 1BAPA 1JILA 1QH1A 2UYQA 3U37A 4RA6A 4F9FA 3RB8A 5TVGA 1EK0A 4AUMA 3ZJVA 2GPJA 1SJ9A 1B74A 2GHTA 1IEQA 2AFIE 3GQBA 3H8WA 3OH8A 4R9NA 5IN5A 3LUBA 2PX3A 4MH0R 4AZTA 1HNWB 5IKPA 4OP2A 3T52A 3QLUC 4BO3A 1YRQA 3ILXA 2P4HX 2XTNA 4M7WA 1I1NA 5FI5A 2FMTA 4R68A 3UVEA 3ZDBA 1Y6QA 3QKUA 2EBHX 4Q9IA 4RSHA 5CBKA 1S01A 3TLYA 1FNDA 3OIYA 1NW3A 4EB3A 1WD7A 1Y7HA 3TRHA 2XUOA 3B8HA 4HV4A 2QQGA 1T13A 3E84A 4X6XA 5A9SB 3WXMA 2AN1A 3N5CA 3PDJA 5FUVA 3RVRA 3AT1A 2Q62A 4RVFA 3HR4A 3T4PA 4A2QA 4K9PA 3W5CA 2JJMA 1AJEA 1A8HA 1BHJA 1L1EA 1M1YB 3DFFA 3IKVA 5JIBA 3DE4X 3QKSA 4BP9A 3UUGA 1FRFS 2A67A 1LDYA 3IUJA 1GKUB 2VDUE 4EHLA 1GITA 1ULSA 4UTRA 2GCEA 3WK8A 3MGKA 1TGYA 1PHPA 3D2BA 5DXFA 1PEAA 2HPZA 3CEAA 4JOBA 4RGBA 3QIVA 1S4MA 5G41A 4ZCSA 1E66A 4F2DA 1ORRA 2GJKA 4OB8A 4WTOA 3TEFA 2FETA 3K7EA 1GZSA 2J5KA 2AOUB 4IGFA 1Z35A 2OCYC 5BO5A 2N75A 3W5BA 1QIKA 1ECGA 3TTWA 3IP1A 3ZY4A 4JITA 1C8LA 4MXDA 1X1EA 4HAWA 2L17A 4HGNA 5CAEB 1YUBA 2WZQA 3GRYA 2VI5A 4XR9A 3EIXA 2I03A 3IE0A 5FWAA 1Z5GA 3GO4A 3SM9A 3UMJA 3VC3A 1NNSA 1JGTA 2L42A 2PYZA 3FF1A 3N74A 5BUSA 3WISA 4P0PB 3T1VA 3GMIA 1PEYA 2FW8A 4XDGA 1XELA 3LO8A 3QMPA 1G0OA 4I2NA 4ZA2A 4R2MA 5BOSA 1XTJA 1VL2A 1UMCB 3MB5A 5EXSA 3RSHA 5B57C 3FHCB 4MYRA 5KX5F 5LXTB 4Y6OA 1LNSA 5A06A 2H92A 2WB2A 3QF4B 2ZBFA 3FYUB 3PYMA 3RYHB 4DDUA 3LSYA 2VWHA 4FFBB 1YIOA 1NN1A 1SOWA 2DBRA 2I2BA 3TRJA 1Y1SA 1BW9A 1VL6A 2FWMX 2P0YA 2CDBA 2VDLB 3FMVA 4X85A 3WHKA 4TMZA 3LP5A 3ZN2A 2RG1A 1E5DA 2HHLA 2MHCA 2Q7XA 4FE4A 3TZQA 4WASA 2NWQA 4DKJA 3JQAA 4E15A 4Y2VA 1RKQA 3H16A 2Q6TA 4XJTA 4L74A 1MJ5A 4JQOA 2JD0A 2Y67A 4U9HS 4OXIA 2JFPA 3AOEA 4LECA 4PSKA 3U62A 5LWHA 1UT8A 3QK7A 4GLLA 4KYUA 2FRDC 2B61A 4XUDA 3JD3A 2OTCA 3W6ZA 2V7BA 3B52X 2IXDA 3N2EA 2QXUA 3WGNA 4R6WA 4RF2A 4EYSA 2W2OA 1X80A 2ID7A 1J8QA 2Q2WA 5EZSA 3OLVA 5AW5A 4EUNA 1AKVA 1BVHA 4KODA 1L4KA 3BMCB 4B76A 4P38A 1JBEA 5H9WA 2IH5A 2XMCA 3MCUA 4IHJF 3V4OA 3R7FA 5ILOA 1L1QA 1FFAA 2E4AA 3AMVA 4IJ6A 2GSDA 3R3XA 2J3JA 2HDWA 5BQXA 4HGZA 3WTCA 4F6CA 1Z39A 2VAVA 3W34A 1MOSA 2FX5A 2CVHA 1QG0A 2VXOA 4L6AA 4DIKA 5KSYA 2EDCA 4JNKA 4H16A 5I7HA 1DRKA 2JLAA 5JJIA 2GO1A 2X6QA 2ZWIA 5J5AA 5JNLA 1A8IA 4PZ9A 3M83A 4D6XA 2TYSB 4TMTA 1DRUA 2WF7A 4ZVLA 4XE5A 1L1FA 4UHJA 3F71A 4H7PA 4DKXA 4JBGA 2YJGA 4FYMA 3NXSA 5IKMA 3DDNA 4D57A 2AWNA 1M8JA 3GPLA 2LR0A 3V8QA 3D54D 2CB0A 5BQ5A 1E2BA 4YPOA 3UH0A 3NBMA 5K03A 5LP6A 1BA2A 1J8FA 2WSBA 4YA6A 4LCBA 4OP3A 3E9CA 4WNIA 5CH3A 3Q87B 1Y8QB 1TKBA 1NFFA 3B9RA 4FX5A 3P4XA 4B9AA 5CBPB 3CNHA 3T4XA 2JFWA 3BGIA 5IDVA 4PTLA 3V4FA 4XWKA 4CEIA 1Y5NA 3FNGA 2Q45A 4UE6A 2M1XA 1VMEA 1KAHA 3EXG1 2QJOA 2VBGA 1W2GA 1V8DA 3Q15C 4FQ7A 4P4SB 3LCUA 3JWIA 4R54A 3OQOA 4LQCA 5A6SB 4H1UA 3ZUPA 2WYUA 1JHRA 4BBAA 1NSTA 2QM0A 4J75A 1FMCA 3IUQA 5B3LA 5K3BA 2GXAA 1KYIA 2V9ZA 1JBQA 2RHCA 4R1PA 4D80A 1M8FA 1XQVA 4OM7A 1FFDA 2H4HA 3L05A 2C8LA 3UO8B 3EQ6A 2Q6OA 5F4BA 4KAAA 3N86A 3RRXA 5HTOA 3AZQA 3H2YA 1VP9A 2V4UA 4TN5A 1XQWA 2CJWA 4HH1A 4I1IA 3ZWPA 4PSUA 3STUA 2DF8A 4D41A 3OESA 4IGKA 3CRQA 2GXQA 1GZDA 1DAGA 3VKFA 1CS0B 2R7MA 3O26A 4O33A 5G1NA 5FUBA 2PZGA 3EASA 3VI3B 4E94A 2OC4A 3PR3A 3VZBA 3HP4A 3RU9A 3U0BA 1OXSC 3IODA 4L3OA 1G4AE 1V4BA 5BWLA