2A4KA

3-oxoacyl-[acyl carrier protein] reductase from thermus thermophilus tt0137
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
237
Chain Sequence
GRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALPLEAWEKVLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGLGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl carrier protein] reductase
publication title 3-Oxoacyl-[acyl carrier protein] reductase from Thermus thermophilus TT0137
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 87
structure length 237
sequence length 241
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a4kA00
4FC7A 3H9QA 1YBAA 5EERA 1GY8A 3GN1A 2NQ8A 2X5OA 3OMLA 4QTZA 3NDIA 1ENYA 4NIMA 1XU9A 4BMVA 2DVMA 4CLOA 2VHZA 4LVCA 3ICPA 1H6AA 1OC2A 3KB6A 1ID1A 3EGOA 3KRTA 1DFHA 1WMAA 3BMNB 3I6IA 1UXJA 1NP3A 2YFHA 2YHIA 1YE3A 2C7GA 4DIBA 2J5RA 1SMKA 3GQVA 3KLMX 3UCEA 1AUPA 4IZIA 3SJ7A 3AWDA 3WYBA 1YDWA 3TZKA 2BI7A 2Y1DA 3T7EA 1HE2A 2DUUA 4AICA 2LDBA 1XELA 2Q1UA 5IFLA 1CWUA 4BGIA 4EGFA 2VUUA 5GZ6A 5KOIA 4G65A 4OSOA 5T67A 3UOGA 4PFJA 4A5OA 1S6YA 1BVRA 4DC0A 3WTCA 2BFMA 4XYMA 3CE6A 3WIDA 4D44A 4ZQBA 3WFJA 5JNLA 2D3TA 1Q2XA 3L77A 1E1KA 4KMSA 4FFMA 4OGWA 4BQPA 1FK8A 5F1OA 4FJ0A 1ONPA 3GN2A 5I8WA 4B3JA 4XYGA 1QP8A 4K1LA 4P8RA 1U3VA 4E21A 4MKRA 4PLFA 2B36A 3QY9A 4Q3DA 3ZNNA 4DQVA 2X5KO 4TRJA 5IZCA 2R2GA 4OL9A 3ON5A 4LCEA 3S8MA 3C7DB 3WG9A 3VVCA 5DP2A 2Q1WA 3BYZA 2EKLA 4GX1A 4WNIA 4D0RA 2PZLA 3QW2A 1GYQA 3F3SA 3DFUA 4BNYA 3GF4A 3W6ZA 3DBRB 3E5MA 4NU5A 2H5LA 1FMCA 1R37A 4PLYA 1LLUA 1PJTA 3K96A 2BLLA 4R1SA 5BNTA 1Z45A 4I9UA 1H9BA 4NHEA 4RVDA 3ZDFA 2BRUA 1B26A 2EGGA 3TFQA 5AQ1A 4HBGA 4CMIB 1I30A 3UCXA 4XQCA 2RIRA 4OXKA 4M87A 3CEAA 1ZKMA 3PHIA 5JO9A 4BO7A 2E37A 4I08A 5DNAA 3ZW9A 1TI7A 4MPDA 4EEZA 4DBZA 3C7CB 4OJNA 5KJ1A 3F1LA 4BNZA 4Q39A 3DOJA 2O3TA 3FHLA 1DJQA 3UN1A 1S7CA 2VHXA 3K73O 3L9XA 4DREA 3TL2A 1N92A 4CQMD 3PIIA 1NR7A 2Y1GA 4E4YA 5BQFA 3S2FA 5KNLA 4RVUA 2Q1TA 1EE9A 4ONEA 4EDFA 5G4KA 3ONFA 4GKVA 2EW2A 1TVEA 4Z9XA 3QWHA 3F47A 2JL1A 4CLOB 4O63O 3WXBA 4PLGA 2GLXA 5CHEA 4WLVA 1K0UA 3HB4X 1GQQA 1EZ4A 4DTIA 3AOEC 4J1NA 3IL2A 2GERA 3NTRA 4YACA 4BKPA 1H94A 1R0LA 2B5WA 2CDCA 3DR3A 3A06A 3F6YA 1LRJA 2YHIB 3V1YA 3ETGA 4I8XA 3ONDA 4L73A 1YKFA 3HNPA 2P91A 5AYVA 2EV9A 2OXIA 3V2GA 4W82A 5HWSA 3NT2A 3S2GA 1U5CA 5FWNA 5BNFA 2JCYA 3DL2A 4J0FA 3V8BA 2BFAA 4IDEA 1ADCA 4NFYA 1GCUA 3GDFA 1YB5A 4MVJA 3WGTA 3B1JA 5TX7A 4L75A 3BHIA 1Z6ZA 5C37A 2ZATA 3H65A 3GRKA 2NTVA 4E2XA 1WPQA 2Q2WA 3H9UA 2AW5A 4K9DA 2HK9A 4D46A 4PG6A 1CYDA 1ZSVA 1ENZA 3GGOA 4R41A 2Q2VA 3F9IA 4RVFA 1C0LA 1DRUA 4R01A 5A05A 4D45A 2BMAA 2HQ1A 1TT5B 3JSAA 3HWRA 2O7QA 1I0ZA 3P2YA 2IE0A 1ZMTA 4WGGA 2DBQA 2YFQA 4BNTA 3OEYA 1YS4A 1I36A 1KEPA 3JQ6A 1HKUA 2I65A 1J6UA 4I1IA 4J1QA 1NTOA 1NYTA 2Y05A 4NG5A 4KDEA 2GNAA 3TFOA 3ZI0A 5CEFA 2ZJ0A 1X1TA 2ZB8A 1HZJA 4J6FA 1M2WA 1H9AA 4W99A 3NYWA 1M76A 2UDPA 3DAGA 4JJIA 5CDUA 1IY8A 1NVTA 3H7AA 4JK3A 1IPFA 3BMOA 1NQ5A 1NAIA 1PJCA 2BFOA 1Q0LA 4I5FA 3IOYA 2P5UA 3FTNA 4GSKA 2AQKA 3WGYA 1SB8A 2GN4A 4DGSA 1GUZA 1I10A 2PD3A 5DN9A 3D5QA 3L07A 5IN5A 1E6UA 4KUGA 1ZSNA 3VZRA 2GDZA 4YDRA 3DBHB 3GNTA 1MG5A 3D7LA 4MJLA 4RCVA 2RH4A 1E3JA 5EMHA 5F1KA 4ALMA 1E7SA 3JD3A 4C7JA 4IQ0A 4FW8A 1K3TA 3L0DA 3CZRA 2CMDA 4MVJF 1YL6A 4CUKA 5JAMA 1F8FA 3GMSA 4J2OA 5THKA 3OF2A 2W2KA 3WWZA 4BGVA 1LLQA 1WP4A 2TMGA 4E2YA 1IL0A 4GMFA 2QHXA 3ASUA 4DMMA 1XHLA 2IDZA 5G4KB 5TJHA 4BIIA 3FRJA 1U8FO 1XLTA 3A14A 2VOEA 4UEJA 1LSJA 3GZNA 3JQ9C 3LVFO 3JQFA 4XGNA 1VRWA 4EW6A 2RHRA 1YB4A 4R9SA 4MKZA 4WCFB 3GG2A 5T8KA 1F8GA 1D8AA 4WCDA 4AJPA 4YA6A 1A4IA 4YRBA 2PGLA 4P38A 1LDBA 1D1TA 1JW9B 3N7UA 3P2OA 1W4ZA 4Z0PA 3AOEA 1RWBA 4OXNA 4UULA 2XOXA 2Q4BA 2VYVA 4WE3A 1VSUA 3L4SO 3FCOA 3ADOA 3OJOA 4GLLA 4R5MA 3ZNOA 2Y1OA 3ENKA 4D7AA 3IC5A 2X5JO 3FR7A 3PFFA 3DONA 5L3ZA 2W8ZA 1A4UA 4HADA 4NJOA 5JCJD 1AHHA 2NLOA 3O4RA 1N1EA 4YAIA 2E82A 3AJRA 4FDAA 1E5QA 1FDTA 4P22A 3RUDA 1VL0A 4LW8A 4J0EA 2W2LD 4Y67A 1WDKA 3INGA 2NU9A 3BHMA 3D0OA 1JKIA 2B69A 3R3JA 4MO2A 1TB4A 3AUAA 4FFNA 1N9GA 1EMDA 3GZ4A 4RF3A 5HRUA 4CMCA 1SAYA 4I5GA 4OXYA 1CETA 3GAFA 1KEVA 1VJ1A 3QLJA 3I5MA 3RUHA 1IZ9A 1HT0A 4FBGA 3FNFA 2C07A 3BMCB 2ZTLA 3BMQA 4LRSB 3BMOB 1QYVA 1R66A 3WICA 2C59A 1Q7BA 3JV7A 4NH4A 4E33A 4Z0HO 4YB8A 3PWSA 4UVDA 2OP1A 5TGDA 1EUCA 5CP8A 3BAZA 3EHEA 5CFZA 1CQIA 3R3SA 1T2CA 4WJZA 7ADHA 3NDRA 5A02A 3NGXA 1JAXA 2ZYDA 2TMDA 3DQPA 4IDFA 3VHRA 5IN4A 2I3GA 3H9EO 2FR0A 3DOCA 4CM5A 3FBTA 1C1XA 4HFMA 1XKQA 5CDYA 1PJQA 4PGFA 3D4NA 2DTXA 4IJUA 3Q9UA 1ISGA 4WEQA 4CM8A 1PX0A 3LT1A 1GZ6A 3GPIA 1E7RA 3KYCA 2AEFA 1NR1A 1ZZEA 5LC1A 5KIAA 3QVSA 4AJKA 5A9SB 5BR7A 4O6VA 5K6AC 4EUHA 3QWIA 4WUVA 4FS3A 5B4VA 3RBVA 3RBZA 4BOYA 1P33A 1B7GO 2PA3A 1DLIA 3AI3A 3WR5A 2VHYA 2P2SA 1C0PA 3FBGA 2CY0A 3SLGA 3GHYA 3WNVA 4BUCA 1HE4A 2O3RA 3C7AA 3T7CA 2YQ5A 4U6SA 2GF2A 4BB5A 5DZSA 4BO2A 2QZ9A 3TRIA 2O3QA 5JAIA 3PDUA 1BXGA 4G81A 3VH3A 3KSZO 2PK3A 1C1DA 2A35A 3SLKA 4XB1A 3W8EA 3UFXA 1KVSA 2AXQA 4RQTA 2AMFA 1H6DA 1PTJA 1NPYA 4GAEA 3UXYA 4WEOA 4CV2A 1HETA 3HHPA 2C5EA 3ZHBA 5CDGA 2NNLD 3PPIA 1L1FA 5IZ4A 1NFFA 5TT0A 4MOWA 4OYRA 4DMLA 3GFGA 2J3JA 1ZJYA 1XWFA 1WVGA 1W6UA 4IDCA 4EI2A 3MWDB 5BT9A 4E13A 4TRNA 3UH1A 1B3BA 3ROKA 4NJMA 3B20A 3ZV5A 1FDSA 2HU2A 2BH9A 3HG7A 4PLCA 3N74A 1HE5A 2EJVA 1DRWA 1AGNA 5JLAA 3GGGA 4B7UA 1NM5A 3AK4A 3OFSA 1ISMA 4GPD1 1XR3A 1I2CA 1UP6A 1Y6JA 4BHTA 4D0SA 3EMKA 4YCAA 3U5TA 4PLPA 2VT2A 3I83A 3B70A 3DZFA 1IE3A 2HRBA 4JBIA 1N9GB 4JN6B 4DYVA 2ZTMA 3P5SA 4WECA 1SC6A 3PQEA 2R00A 4AJ4A 4R1NA 2CF6A 2HJSA 4UVEA 3X2FA 2BGMA 5AXDA 5GY7A 4FJ1A 2UV8A 1GDHA 5C7LO 3IUSA 1JQBA 2PV7A 4XR4A 4CL8A 2J8ZA 3GAZA 1ZXLA 4PG4A 1E7YA 4PG5A 1KOLA 4E31A 3BMQB 4BO1A 2Y68A 3TZHA 1UH5A 1HDYA 1T2AA 4FGSA 5COAA 4CODB 3CMMA 3RBXA 4ALKA 3O03A 1QLJA 1HWYA 4JCOA 4QX6A 3RCBA 1MB4A 4NMHA 2PY6A 3AW9A 1IPEA 1P1HA 3MJTA 2QW8A 3GHHA 1EFLA 3CH6A 4NDNE 1HDRA 4CM4B 1MXFA 5JMWA 4KTTE 3HZZA 4CLXA 3VPXA 2BGKA 1KBZA 4URFA 3LC2O 2HUNA 4Q9NA 2IEDA 3E5RA 1CDOA 1JVBA 4BKRA 3IMFA 4L76A 4DXHA 4DQUA 4H7PA 1XU7A 1I5RA 3WDSA 4E6PA 3GA0A 4CM8B 5BSHA 2WTBA 4R5HA 3VAZA 3DC2A 4UVIA 4R3WA 2AQHA 3JQ8A 3L6EA 3JQDA 1PSDA 2FZEA 5HM8A 4BO4A 1ZW1A 3BTVA 3KYCB 1BG6A 2GZ2A 5L4NA 1I32A 1MXHA 1XDWA 3O38A 2X1HA 1SEVA 2BFPA 1PGNA 1QSGA 2B5VA 2YY7A 1U4SA 1AHIA 4XYEA 4CLEA 3TQHA 4IJWA 3E6AA 1K6XA 4F6LA 2F1KA 5H83A 3F5QA 4OO3A 3QIVA 1YRLA 5EQFA 5J23A 5K6AA 2OUIA 1GQYA 1H93A 4QFCA 4J9UE 1BXGB 4IINA 4EBFA 4QECA 3E48A 5CEJA 1C1DB 3ITKA 2IXBA 1JA9A 5C3MA 4L74A 5H82A 4E5KA 4IDGA 1XSEA 4KQWA 2VZ9A 4R54A 5L53A 1YBVA 2HKIA 4IMPA 4JJFA 3G79A 5KVSA 4WASA 2Y0CA 4HKTA 5ER9A 1KC1A 3LK7A 4GBJA 1Q0QA 4HFRA 4GGPA 4BVAA 4GQAA 1HDOA 2WJPA 1JVSA 2VWGA 3FNEA 4KWHA 4S1VA 2GN8A 1DLJA 4XQEA 3Q2KA 4KZPA 1E3LA 4W7HA 4CV1A 5IZCC 4RPGA 3GK3A 3AOGA 5DOVA 1O6ZA 4BNIA 4IMRA 5CEEA 1L7DA 1A71A 1WLYA 4FGWA 4YRDA 1KYQA 3JQEA 4CQMA 1RYEA 2VQ3A 2EF1A 3VDQA 2JHGA 4G2NA 3ZGYA 4W4TA 3BTUA 1MC4A 4M1QA 4S3MA 4HFNA 3INTA 5F1PA 1PL6A 3AFMA 3AUSA 1C0IA 3CIFA 1GTMA 3PJEA 2HMWA 3ZU3A 6ADHA 2AG8A 4KUEA 2A9FA 1OFGA 4PLWA 4W7IA 4A73A 3CSDA 4PZEA 3GH3A 4AG3A 4OQZA 4QUKA 1V3TA 5KJCA 1VL8A 1O94A 4ESOA 5L95A 2JFGA 1EFKA 1KVUA 1LJ8A 1X1EA 2Y1FA 3NTQA 3ROPA 1EVZA 3GPDG 4WOJA 4EZBA 2O23A 3RASA 4FOOA 1K89A 2D5CA 4XYBA 4RZHA 1PQPA 2V6BA 3DHEA 3H4VA 4GX2A 4PVDA 4Z3DA 4MIYA 3WGQA 4I9NA 3ZWNA 2DLDA 3FD8A 2QQ5A 4E5YA 1IHYA 3GOHA 2JD1A 3QQPA 3VC7A 2WWRA 1DSSG 1PR3A 1F14A 1H2BA 3DTTA 4YT2A 3OIFA 3DAFA 3JQ8B 1M67A 1KEWA 3NGLA 1HLDA 3TZQA 2IZ0A 3RFXA 4XGIA 1ZBQA 2BI8A 4IS2A 1MFPA 3C3XA 1A9ZA 3PHLA 1LX6A 5JC1A 4WCFC 1UP7A 5HS4A 4D43A 1SEPA 2EJWA 3AUTA 4E3ZA 1N8KA 4RDIA 1PGQA 3IAHA 3ZWBA 3INRA 4XD2A 4YJGA 1E3EA 9LDBA 3JD2A 3CKYA 3AM3A 5TT1A 4D3SA 1YB1A 1WAMA 3ANNA 4HP8A 2CDAA 2ZYAA 2I6TA 1F12A 2IXAA 4NBVA 4ZRMA 3NT5A 3G49A 2OL4A 3H3FA 3UVEA 4CLDA 4J4HA 3NJ8A 3KETA 4OSPA 2A4KA 4PIVA 4GMGA 1HDXA 2EGHA 3MCVA 1TEHA 1PEDA 2DPHA 4OOEA 4BB6A 4XYLA 3A1NA 3TOZA 5G0UA 4C7KA 1UUFA 3ITDA 1Q7GA 2NQTA 2C82A 3CTMA 4PVCA 3D3WA 2IRWA 2VHWA 2ZKLA 1NWCA 5JFOA 4MVJE 1DRVA 1QR6A 2WE8A 1X14A 4AJNA 3ZWCA 2B0JA 3BTOA 4XJSA 2CFCA 4CUJA 4F45A 1R6DA 2HDHA 3H6KA 2ZB4A 3KYDA 3ENNA 4ID9A 4CMGA 4UUNA 2HK8A 1D3AA 4XGKA 2Q3EA 1HTBA 1TT5A 2CSUA 4CQMB 5JAZA 4XA8A 3IKVA 2FR8A 1ZCJA 3OP4A 4J16A 2VRCD 3G17A 2GYYA 3MJ4A 3VH2A 3PIDA 1EVIA 3G3EA 8LDHA 3PXXA 4BO3A 3HDHA 3S2IA 1KVRA 1V8BA 3LLSA 3M1LA 1BRMA 5HTOA 3I9JA 1AXGA 1JWAB 4CPDA 4IJVA 1QLHA 5L4SA 2XXJA 2Q4EA 4FR5A 4PG8A 1EE2A 2VZ8A 3NEPX 3RI3A 3OJ0A 4MVJH 2QIOA 4MKXA 3ZWMA 1ISHA 5H81A 3PGXA 4R51A 4GWGA 3WYCA 1DC6A 3IIEA 4IIUA 5ITVA 5DBIA 3PWKA 4RVHA 3RWBA 1PJBA 2NUAA 4TSKA 1LC3A 1XA0A 3WGHA 1WWKA 2P4HX 3ROMA 3MJSA 2JFHA 3V2HA 1Z75A 2WDZA 2QG4A 5FI3A 4QQRA 2Y93A 3DBHA 1JKJA 1ZJZA 4ZN6A 3FWNA 1NFRA 4ND4A 4Z0TA 3ZU2A 1N5DA 3GDGA 3ADPA 4GL4A 1V3VA 5AXAA 1LSSA 4O1MA 3WFIA 3AY6A 4OKNA 1LI4A 3KSDO 2Z1MA 3K6JA 1K5HA 3ZWXA 5JCJA 3WS7A 3WGIA 2IYOA 3IUPA 1ADGA 1G6KA 2SCUA 4XQ9A 2GRAA 5ER6A 1EBFA 3JQFC 3A28A 5ENDA 3I23A 3R0IA 4NBTA 1GV0A 2BHLA 4FFRA 5TIIA 1HEUA 2IEBA 4XZ3A 4L8VA 2PZKA 5T8KC 1PWXA 4ZJUA 2W2LA 1M66A 4II3A 4LISA 4B4OA 2OFPA 2X22A 3NTOA 4ZVVA 1NHWA 4YJGB 4OMUA 3JD0A 4PRLA 3DHNA 3ETDA 3OQ6A 3MJEA 7MDHA 2DU8A 3P7MA 2HMUA 2NVUB 1GPJA 1JWBB 4U8GA 4WCFA 2AE2A 1B8VA 4NBUA 4XDYA 1ZEMA 3RFTA 4J9VA 2Y0EA 3FNHA 1IZ0A 3C1OA 1U8XX 3PYLA 4EJ0A 1D1SA 1RM5A 3D1LA 3DAPA 3ZWYA 1L7EA 3RSHA 1BHSA 3RJ5A 4FSHA 2YQ4A 2WE7A 2Z5LA 1K6JA 1GQ2A 1Y7TA 2VYND 3KBOA 1DO8A 4YQYA 3D3WB 1V9LA 1ZO8A 2WYVA 5TJ9A 5I9LA 1E0DA 1ULUA 3W1VA 4ALLA 1GD1O 2OO5A 2YYYA 4ND5A 3LSYA 3QVWA 3T4XA 2P9EA 4HFJA 1DFIA 1RM0A 3VTFA 1XQ6A 4CM7A 3DWFA 3KYDB 4D79A 3MWEB 2E4AA 3GVPA 4YJFB 5AVOA 3W4IA 1Z74A 3PJDA 3OIDA 4Z9FA 2A92A 2G5CA 2JAPA 3LT0A 1PJ2A 1OC4A 3T4EA 3G1UA 3KOUA 2W90A 4NFSA 2GR9A 5DULA 1ZIDA 5EL0A 2CUKA 5EPOA 5KVQA 1RKXA 4RZIA 3ZWAA 3QV1A 1EQUA 3VH4A 1VI2A 4RPHA 2EWMA 3MOGA 4Q3EA 4YT8A 1UAGA 5A06A 1ZVMA 3H5AA 3KHUA 4IDAA 1OOEA 3ZV4A 4R9RA 2DAPA 1HZZA 3S55A 1NQAO 1N1GA 3BMCA 4PN3A 2D4AA 2DUWA 2GASA 2VRBA 3Q1LA 1HDCA 1X0XA 1E7QA 5L45A 1I2ZA 5ICMA 3H2SA 1LEHA 1UAYA 2AG5A 5JDCC 4Y9DA 4GKBA 4BQRA 2WYWA 4CMKA 2DBZA 4JBGA 3EW7A 1ZNQO 4YRAA 3PTZA 5AXCA 3ZHYA 4WK6A 1A27A 5B37A 4X54A 3LT2A 2G76A 1B2LA 3OJFA 2PKRA 4J90A 4IPTA 3JQBA 4MINA 3KO8A 2XAAA 3K31A 5KJEA 4QFDA 4K26A 3ZV3A 1LUAA 3DZJA 5A5FA 1IB6A 4IM7A 2YJZA 3QVTA 3WB9A 3GUYA 4BKQA 1DDOA 3V1UA 3MJCA 3AI2A 1UZLA 4CM6A 2EEZA 4KQXA 4U6QA 2ZJ1A 1LBEA 2YZ7A 5G0VA 3U4CA 3IKTA 2G82A 1FXSA 4C4OA 2X86A 4DPKA 5A9SA 2O48X 5BSGA 1GCOA 4XWYA 1PL8A 5ICSA 1E7MA 1W73A 1MFZA 2RCYA 3TN7A 1E92A 1F17A 4N5LA 1YWGO 4RLHA 1Y8RA 5IDYA 1OMOA 3FR8A 3PZRA 3PHJA 1LDEA 1EVJA 2AEJA 2NVWA 4B79A 1MV8A 2E6UX 1C3VA 2I99A 4JNKA 5EN4A 1BDBA 3U0BA 3VDRA 1DB3A 4A2CA 1R4MA 2VUSA 3GEMA 2GO1A 3BXXA 2PZMA 2GGSA 1U3UA 3OBBA 1T4BA 3DZBA 1YQGA 3LQFA 3MJVA 1Q1NA 2RH8A 3W4KA 3ZN2A 4HNHA 2DTDA 4M49A 5LCXA 2D1YA 3ABIA 1GFSA 3L9WA 2Y66A 4HWKA 4RPLA 4EUEA 4FD3A 5JY1A 3IP3A 4DYDA 2R00C 2Y99A 1M6WA 1P1JA 3GG9A 1QRRA 3GY0A 1ZXBA 3R1IA 3WBFA 3E18A 1CJCA 5I9NA 1Y9AA 3TZ6A 3ULKA 1PGOA 3PJGA 3WX0A 3TDKA 5DDIP 1HXHA 4J1SA 4BV8A 2YDXA 4AJIA 3KEOA 2AQ8A 1B0AA 5A5EA 4ZQGA 3I6QA 1C14A 3JQGB 4E12A 5DOZA 4CM9D 3H3JA 3VZPA 1QKIA 2J6IA 5TS3A 1P77A 1R0SA 4WLNA 1EK5A 3L6DA 3QVXA 4CR8A 4D3DA 2VT3A 1U7HA 2ZK7A 3HDQA 3HFSA 4P4NA 2CDBA 5GZ1A 3F1KA 4MVJG 4OKIA 5KKAA 3O8QB 1ORRA 1KERA 3PFWO 2NSDA 4IDDA 1UXKA 4CM4A 4AJHA 1EVYA 1GUYA 2GSDA 4FB5A 1G0NA 1PQWA 4RGBA 3K9QO 2HCTA 1KVTA 3KZVA 5JDCA 1O0SA 1SZJG 4Y6PA 3U3XA 3VKUA 5I7VA 4IDBA 3WGOA 1T1SA 1QYDA 1YOVA 3E9QA 4MIEA 2NACA 3ROQA 3GR6A 2FN7A 4IQGA 3ZNPA 1P31A 2EERA 3HJAA 4N7RA 3GDOA 2FRDA 4J7UA 3UHAA 1B8PA 1T24A 2BGLA 2G0TA 3F4LA 4B3IA 2OMEA 1I3NA 5DCYA 3GVHA 1EBUA 4IZHA 4H15A 2DPGA 4KWIA 5C5IA 5F3RA 2WD7B 4E5PA 4JJGA 3QRWA 4YTEA 3B6ZA 2GUGA 2V6GA 3DO5A 4BO0A 2NM0A 4B8ZA 2C2YA 3GRPA 5JXWA 1Y8RB 2ZB3A 1V35A 2VWQA 1SOWA 4MVJI 4TROA 3VZSA 2ZTVA 1ZH8A 2LDXA 5DP1A 3WTBA 1E6EA 4BNLA 3U49A 3H5NA 4ALNA 2GCGA 5F21A 5JC8A 2I3AA 3LT4A 2OGUA 1R4MB 2Q45A 4R1UA 1GL3A 2Q49A 4R68A 1O9BA 3VZQA 4BMSA 1NVGA 4FC6A 2J3HA 5FFFA 3K8ZA 5JYDA 4A10A 3JYOA 3FI9A 3IQDB 3UICA 2CZCA 2VCYA 1VJTA 8ADHA 3PJFA 4NPCA 2EW8A 2DQ4A 3C1TA 3I4FA 4LSWA 4BNMA 2BELA 3AM4A 5L7YA 4Y6RA 1DIRA 3Q2IA 2NVBA 4I5DA 1I33A 2JCVA 3RD5A 3WSWA 4M54A 1GPDG 2X0RA 5K0ZA 3OQBA 4RQUA 4Q3BA 1K2WA 3S2EA 4CJXA 4UUMA 3IS3A 3GGPA 4UUPA 2VWPA 5IDXA 3ZWOA 4A26A 1R4NA 1E1MA 4DLBA 1XGKA 2IODA 3L4BC 3ST7A 1Y1PA 3NJ4A 1BXKA 4FFPA 3GEGA 1V0JA 2O7SA 4L4RA 2EXXA 3HN2A 3LZ6A 5TNXA 1NPTO 3NX4A 2A94A 4CM1A 3ANLA 3W8FA 1C0KA 4IBOA 5AOVA 2EKQA 1CEQA 2P4QA 3KM0A 1DXYA 4OIMA 1D7OA 5IXYA 4NU6A 3GUCA 4IXTA 5U4QA 4B4UA 2V7PA 1MC5A 4BO9A 4KTVE 1I3KA 4ZICA 2FPGA 3GNSA 2W98A 3G1TA 5KWEA 1VE9A 2QRLA 3O9ZA 5KVCA 1E1NA 5LDGA 2V6MA 1Y81A 4Z9YA 1JDJA 3ICCA 4BGEA 2OZPA 1YOVB 4FQ8A 3JD1A 2EKPA 1HL3A 3WBBA 4I5EA 5C7OO 3H9JA 3V5NA 2DFVA 1PS0A 4BNVA 1T1RA 2PH5A 3EY4A 1PS8A 4Y98A 3BA1A 3QP9A 1PU2A 1YJQA 2I67A 2PTGA 4DUPA 4ZGWA 2OP0A 4UVGA 4NBWA 3GMDA 4HV4A 1I2BA 2WMDA 4CUZA 2D8AA 3WSVA 2VRCA 1LDMA 4NQZA 3EYWA 1AE1A 4DPMA 3JQAD 1SO8A 4H16A 1NAHA 1LDNA 2H63A 1PGPA 4CR7A 3V1TC 1Y5RA 1DIGA 4INAA 4RF4A 2PR2A 3JYPA 3PRJA 1NPDA 3IJRA 2R6JA 4EJMA 2H9IA 5DBFA 2JFFA 2CVQA 1MUUA 4GWKA 2EP7A 5LDHA 1EUZA 2VNSA 2OHXA 3HFGA 3RROA 5JDIC 5KJ6A 1GADO 4IGFA 3FTPA 3JQCA 2X0NA 3WGGA 1O8CA 4J49A 3H5RA 5IDWA 4XIYA 1BMDA 1U1IA 4CMHA 1DHRA 2X8LA 3F46A 1HDZA 3Q3CA 5CDTA 4YAGA 2E48A 1LLCA 1OBFO 4YWJA 5JSFA 5IJZA 1HYGA 5TLSA 2QX7A 2WEKA 3ZCXA 5TC4A 1QYCA 1IOLA 3Q0EA 3RC2A 4LRTB 5IXSA 2FPPA 4UUOA 2X0IA 1TLTA 1BVUA 2NU7A 2FZWA 4GVLA 1MLDA 1Q7CA 3ORFA 3QA9A 4AJLA 4L9RA 1GUFA 1EQ2A 1R4NB 2RBEA 3F5SA 3BZUA 3OJLA 4KUHA 2PNFA 2B4TO 2IZ1A 4OH1A 4PCVA 4YAKA 5L4LA 4II2A 2NTJA 3GVIA 4IUYA 3PQFA 4E5MA 2VHVA 2OBYA 4IJKA 1E7WA 1TXGA 1GU7A 3ZWPA 5A3JA 4LMRA 4TVOA 3L4BA 5A3VA 3F4BA 3RUEA 3I1JA 5FEUA 4RVGA 5A03A 5JE8A 3PHHA 1B15A 1YL7A 2IZZA 3H8VA 1U4OA 2PKQP 1J49A 3TJRA 3BTSA 4BO6A 2JD0A 4BGUA 3RUCA 1QYWA 3LU1A 2VYNA 1P44A 1NWHA 2PH3A 1BWSA 5L40A 1QXSA 2PGJA 3UCFA 1J5PA 2O3UA 4I9HA 1OZAA 1P1RA 1X7DA 4ZU3A 3KTDA 2C20A 4YPOA 1T2DA 3EVNA 4TRRA 4NR0A 2AA3A 2FMUA 4XDZA 4UEKA 5DF1A 4NK5A 2DT5A 3PEFA 1IULA 1XYGA 1U3WA 1YONA 3AU9A 5G4LA 1YL5A 4ZQFA 4MP6A 1GR0A 3HDYA 4XIJA 1A72A 1LQTA 5IDQA 1DC5A 3NUGA 2UAGA 3CXRA 1DBVO 2PKQO 2JHFA 2VNAA 3DDNA 3WNQA 5CG2A 1P3DA 2O2SA 1DOHA 1PS9A 2NVUA 3H9GA 3IDSA 1J0XO 4GLOA 4J7CA 1VKNA 4PZDA 4YR9A 3TZCA 3PZBA 3AU8A 3KVOA 1GYRA 4D3FA 5COBA 4IIVA 4DBVO 4RVSA 1LQUA 4LVUA 1H6CA 1BW9A 4P4GA 3UGKA 3RKRA 2AEMA 1ZUD1 1PJSA 2YDYA 1I3LA 3TSCA 1R16A 3HADA 3NKLA 3OECA 4NZ9A 5JW6A 4J3FA 3I9MA 5ILGA 3ASVA 4Q3CA 5TF4A 4RLSA 4LSMA 2QRJA 2OOSA 1WNTA 3RQSA 1A5ZA 1K6IA 3ZU5A 5JBIA 3S1LA 2X9GA 1HSZA 5B4UA 5JO0A 2DFDA 5JDIA 1NXQA 3KXDA 5ENVA 4EEXA 5I7FA 1YH3A 5G0TA 3VH1A 3DZIA 3UF0A 2BD0A 4G5HA 1N2SA 1EDZA 4CMEA 2PD6A 1A7AA 1HLPA 2X58A 3PI7A 2HMTA 2NU6A 4YJFA 4YAJA 4BNFA 1RPNA 5I8ZA 1BSVA 4TKMA 4ALIA 4BNUA 1XQ1A 3TNLA 4FFOA 4D42A 4B3HA 4J1TA 2VN8A 4M55A 1SNYA 1UDBA 1Y5MA 1KY5A 4R69A 2C2XA 4BNXA 1WDMA 4PLHA 2DBRA 3NDJA 3PHGA 4DL9A 1TA4A 5B4TA 3P19A 1PZHA 3K92A 2C54A 3VOSA 1X0VA 4E2WA 2GN9A 1UZMA 1UP4A 2J3IA 3RC7A 2H1SA 1WZIA 4HXYA 4JQCA 4GGOA 1VKOA 3JQBC 3PWZA 1P1IA 5L9AA 2QYTA 3MOIA 3QSGA 2NV6A 4BO5A 1UR5A 1KETA 3ZWWA 4GH5A 2CNBA 3RJ9A 1GYPA 2B4QA 2JD2A 5F5NA 3OH8A 5IF3A 5EINA 4CMBA 1PIWA 3VPSA 5DT9A 3WIEA 1BTOA 1FDVA 1SBYA 3LYLA 4E2ZA 2ZYGA 4ND3A 4CLRA 2C0CA 5JAQA 1QMGA 1DHTA 3EAGA 3EUWA 3U4HA 1Y8QB 3PK0A 4GVXA 1JU9A 1VJ0A 4GX5A 4TMFA 1ARZA 2Y1EA 4QEDA 4W9NC 2XXBA 1Q0HA 4Y6SA 5TSDA 5JCXA 4DWVA 3I9LA 1DIAA 2Q99A 2X0JA 1B14A 2X9NA 4B8WA 4LCJA 4UAGA 5ES3A 1ISFA 1P0FA 1KC3A 3I4CA 2PD4A 1G1AA 3FSRA 3H2ZA 2O4CA 3QHAA 4LK3A 3QWFA 3DMTA 3U4IA 2EHDA 3ZHZA 4EJ6A 1E3SA 3PYXA 3WJ7A 5G0WA 4YT4A 3UW3A 1ULSA 2VOJA 5I7EA 2YW9A 1QG6A 3JTMA 4ITUA 4B7CA 4DLLA 1LC0A 3AY3A 2UUPA 4ND2A 1N7HA 1XIVA 5KKCA 1PZFA 4B4WA 2C5AA 4IXWA 4CM9A 4WKGA 2HJRA 2D2IA 5A9RA 4Z6KA 4YBZA 3A9WA 5EIOA 1I24A 1BW9B 3NAQA 4CM3A 5A1TA 2CD9A 2O50A 3OA0A 5IAAA 5T64A 1VM6A 1ONNA 4F6CA 2JJYA 5MGBA 3LF1A 2GZ1A 1LSUA 4L0QA 2X6TA 1V3UA 2PWZA 1HYHA 1YO6A 3FPLA 2DKNA 3CUKA 2C29D 2D5AA 1UXHA 3KUXA 3M2TA 4JGBA 4A7PA 3O26A 1HSOA 1ZEJA 2CF5A 2JKVA 4MP8A 1DJNA 4PRKA 4RF5A 1LNQA 1RYDA 4B7XA 2ZIZA 3D5TA 4NNJA 3RU7A 1PJLA 1Z82A 1NFQA 4KOAA 2JCXA 4XEHA 2ZCVA 5AXBA 3ZW8A 3PLRA 3GVCA 3NRCA 3VVBA 4QXMA 2X4GA 4CMAA 2GZ3A 3QWBA 3C85A 2Y67A 5ILOA 1JKFA 4OOFA 3TOXA 4R3NA 2PGDA 1H0KA 4NI5A 4UREA 1GEEA 5L51A 5T5QA 1ISIA 4L4SA 1SPXA 5JPIA 4BNJA 2I76A 1YJ8A 5CAEA 2J5KA 1EK6A 1UXIA 2O3JA 3Q6IA 4L4XA 4JX8A 1PGJA 3JYQA 3CINA 3JQGA 5GMOA 4AJOA 4CLHA 4ZHSA 1ADBA 5C7IO 2VUTA 1JN0A 1P74A 3DEYX 3E9NA 3DBVO 1H5QA 1NQTA 1U9JA 3FPCA 3HN7A 2AHRA 3OHSX 5I9MA 1X13A 2PZJA 4Q3AA 2HAEA 3OSUA 3SBOA 3WMWA 2X7HA 4J7XA 5JY6A 1VL6A 4Z3KA 3LDHA 4QT0A 3O8QA 2X9VA 3HSKA 3ANMA 3IP1A 4ZRNA 4E32A 4DC1A 1PZGA 3WQSB 3U09A 4XR9A 1NVMB 4CLRB 2YV1A 3N58A 3PQDA 1XG5A 3MZ0A 2CVOA 3LC7O 4DLAA 1EDOA 3STHA 1Y9EA 4D41A 5L7TA 2IYPA 2ZCUA 4ZA2A 2FHSA 3WOHA 3U62A 3I3OA 2P68A 2Z1NA 3OETA 1VPDA 4J4BA 1MX3A 1YVEI 3WQRA 1ENPA 1WW8A 3KYBA 1E3WA 1X7GA 2HO5A 2FP4A 1LRKA 2FSSA 5G0SA 1FDUA 4IQ8A 4BNHA 3WYEA 4W9NA 3CZMA 3DZGA 2WD7A 1PQUA 5HBRA 2Q46A 3EVTA 5BSFA 1CERA 1U3TA 4HX5A 4U7WA 3RUFA 3W6UA 3ZHXA 1A7KA 3PP8A 3JYLA 3OIGA 3DFZA 5G2OA 2JAHA 2P9GA 4OM8A 3QJ5A 3FN4A 2XF8A 2AE1A 4U0KA 1GV1A 5A4DA 3PVZA 3RAJA 1GZ3A 1R12A 2XPCA 4DIFA 3EZLA 4XKJA 2ZQZA 4BS9A 3MTJA 4J2HA 4JBHA 3OICA 4XRGA 5A04A 4BL5A 1E6WA 1J4AA 2YV2A 1A9YA 4K6FA 1ZK3A 5K9ZA 2J5QA 3JYNA 2ZQYA 2VTEA 1FDWA 3SJUA 3V2UA 4XCVA 4BO8A 2EIHA 1Z7BA 2YUTA 4RPKA 4ZQEA 5JS6A 5TRTA 4JIGA 1NHGA 5CDSA 2WM3A 2RAFA 4WLOA 4HY3A 4FJ2A 1P9LA 1T2EA 2ZB7A 4JP2A 4WLFA 2G1UA 3JQ7A 4PG7A 9LDTA 2POQX 2V6FA 4JROA 4YXFA 1I01A 3GFBA 5JYEA 4XQGA 4GSLA 5FYDA 4QO8A 1HRDA 4RDHA 3OM9A 3ZU4A 4K28A 3ZNQA 2P9CA 1LU9A 5COQA 1LXCA 5EESA 2NADA 2NWQA 3SC4A 1HE3A 3ONEA 1KS9A 3JQAA 2PLAA 3QVOA 1I8TA 4FIZA 1DAPA 3DB2A 4OHUA 1GZ4A 1M75A 4FOSA 1ML3A 4XX0A 2OBNA 3TPCA 4RL6A 4MP3A 4DVJA 3GC6A 4BV9A 3GNQA 1KY4A 3PYMA 3JD4A 3SEFA 3HUDA 4TVBA 3GT0A 5EJ2A 3ZZNA 1O89A 3FF4A 2FSVA 2UVDA 3VPGA 3VTZA 1EEHA 1AN9A 1PJ3A 3LC1O 4ZD6A 3ZWVA 5EQDA 4RORA 1DEHA 3D4OA 3R6DA 2C7VA 5GZ3A 3B1KA 1PJ4A 1WMBA 3MTGA 4AJJA 1MGOA 1ISJA 4J4TA 4CV3A 6LDHA 3U9LA 4YJHA 1ADFA 1E3WB 4F3YA 3QWAA 4MVJD 1UJMA 5CPFA 1Z73A 1NASA 4N18A 3DXFA 2I5PO 1YQXA 3Q9NA 1CQJA 4BKOA 1NNUA 1X7HA 3M2PA 2Q1SA 2E49A 1DPGA 1TT7A 3G0OA 4CL3A 4NFHA 3KSUA 4RJTA 1U28A 3GVXA 1ZSYA 2VTDA 1JTVA 2HMVA 4BNKA 1IHXA 1YBMA 2W2KB 3EC7A 3EDMA 3RFVA 1M6HA 1LLDA 4YVFA 4PLVA 4WLEA 3HDJA 4IY1A 1AXEA 4OQYA 4YAEA 3VKVA 1W0CA 4YYZA 2Q2QA 3ZV6A 2B35A 1NBOA 2GD1O 3MEQA 4BNNA 1PWZA 1KVQA 3LF2A 1ONOA 3GZNB 3RUIA 1ZK0A 3TF5A 3DBLA 3RC9A 3AI1A 3M1AA 3WLFA 1QV6A 1R0KA 2FOIA 4A0SA 3WLEA 4FN4A 4XB2A 3D64A 1P1KA 3NT4A 4K6CA 5BNIA 4FFLA 5B12A 4TRMA 1GAEO 2B37A 1CF2O 1WZEA 2FPIA 3IJPA 5A9TA 4KDFA 1LDYA 3K5PA 3JQ9A 1B8UA 1PR9A 3RVDA 4LMPA 2FR1A 1V6AA 2O3SA 3PDJA 2WD8A 4MDHA 5ADHA 3TL3A 5DCUA 2V65A 1RM4A 1VLLA 2RHCA 1WDLA 2J3KA 3JQ7B 5HA5A 3QE3A 4PLZA 4TQGA 1I3MA 4OAQA 5JMPA 1BXZA 2DC1A 1XCBA 2Q50A 2ILTA 1X15A 4CQLA 4F46A 4FCCA 5B1YA 4CR6A 1UZNA 4U0JA 4U5QA 4E5NA 1DFGA 3BHJA 3FWZA 1IUKA 5IG2A 4GX0A 1T2FA 3U4DA 1OI7A 1E77A 1YXMA 1ZK2A 4RO0A 1KEUA 3LLVA 1NX6A 5CPBA 4TKLA 2BF7A 3DZHA 2Y0DA 2H6EA 2O2YA 4EITA 3I9NA 1FF9A 3D4PA 3JQAB 3HQ4O 4YT5A 1WXDA 4N54A 1MP0A 1DIBA 2I9PA 3I9KA 2OORA 4GI2A 3OA2A 3JCZA 3L6OO 3KEQA 3EZYA 4RPJA 1HF3A 1W8DA 1HDGO 4E30A 2NU8A 4MVJM 3OQ1A 4ALJA 1B3RA 3I9OA 2W4QA 4UEOA 1JAYA 1ZFNA 1Z7EA 1PZEA 4JP3A 1H6BA 3VPHA 3AM5A 4ROSA 5I7SA 1ZK1A 1E1LA 1T26A 4BNGA 3Q11A 5KJFA 4LGVA 2G17A 4IS3A 2HMSA 2B4RO 4M8SA 4AVYA 3E8XA 1H2HA 1DIHA 3FNGA 2CVZA 4AJ2A 4W6ZA 3RIHA 1N7GA 2VYVD 3E03A 4YJHB 2ZTUA 4IGEA 3B1FA 4CV0A 4EUFA 2HSDA 1SB9A 4ND1A 4R1TA 4O5OA 3SC6A 1R15A 1D4FA 1EUDA 5ITWA 2DBVO 3ZH2A 1ZK4A 1UDAA 3CPSA 4M86A 4CMJA 4R16A 4BMNA 1C1XB 1FJHA 3RKUA 3WQQA 1NQOA 2NTNA 1SOVA 1DAOA 3COSA 2BKAA 2DTEA 4AJEA 1MA0A 3K2EA 4ILKA 1DC3A 3C8MA 1BGVA 2PFGA 3AUUA 5MDHA 3M6IA 2D0IA 2VZ0A 3EK2A 1JLLA 3SX2A 1LSOA 1VSVA 1G0OA 2GPTA 3KV3O 3NV9A 4ZQHA 4DIOA 3DMYA 3DBLB 1CRWG 2UYYA 2HK7A 3TWOA 4AL4A 4M89A 5HS6A 4HUJA 3D3EA 4WNCA 4AFNA 3C24A 2B83A 4RV9A 1MG0A 4CMEC 4RF2A 1LTHR 1UDCA 1P0CA 1IYZA 4J91A 3RUAA 4BKUA 1U2GA 2FWMX 3WJAA 5F5LA 4WLUA 3BMNA 3RC1A 2F00A 4H3VA 4YQZA 3PLNA 5KTKA 2FY8A 4QSMA 1CIVA 1E5LA 4A27A 3BIOA 2HLPA 5BSEA 3SVTA 5DCWA 3WGZA 4DRYA 2QRKA 3RU9A 5THQA 3A4VA 4CQLB 3DTYA 3SXPA 3KLPX 4JXKA 4MIOA 2EP5A 4PLTA 2Y1CA 3W4JA 4UVHA 1DC4A 1HYEA 2Z95A 3DZKA 4AJ1A 2D59A 1O5IA 2YHUA 4NJMB 3E1KA 1U5AA 4N5MA 2EG9A 1PL7A 4YJDA 1E3IA 4NK4A 1YGYA 4Q3NA 2AQIA 5T6BA 2X23A 4MVJP 3W8DA 4WOKA 2HRZA 1XEAA 3CMCO 4E0BA 3GEDA 1P1FA 4FPXA 2WYUA 4WPGA 4A03A 4BNWA 4DPLA 4NBRA 2P5YA 3UKOA 3UAGA 4YEDA 5FF9A 1LRLA 4XRRA 3HE3A 4TZTA 1RM3A 1YDEA 4Y8VA 3AFNA 5TQVA 3VPFA 2GN6A 1VC2A 5KCZA 5U9CA 4JLWA 1LDGA 2VWHA 3WWYA 1F0YA 5U1PA 3DBRA 1YQDA 2UUOA 1Y8QA 5DBGA 1RJWA 1UXGA 3AY7A 3OJEA 3DMTC 3PGJA 1P45A 4KP7A 2DM6A 1ENOA 4N5NA 1OAAA 2QZZA 1QORA 2ET6A 4PZCA 4O0LA 4XJTA 1LA2A 3OEWA 3C1AA 4P4LA 3K30A 1B16A 3WMXA 3UUWA 4CMIA 4O59O 4QO7A 1T4DA 2I66A 5T57A 2WSBA 3X2EA 1T25A 4EYEA 5L7WA 3E9MA 4B4VA 1BDMA 1O95A 3DOOA 5KVVA 1QYXA 1F06A 1QV7A 3ETEA 4J43A 3DHYA 4HNGA 4TWRA 1ZMOA 3I52A 2O4UX 3GLQA 2QYSA 5FI5A 1KIFA 4LN1A 1U7TA 4R4JA 3HB5X 1U2DA 1GEGA 2YV3A 1SCUA 3K2BA 4DQXA 4TZKA 5CG1A 3E82A 4DA9A
chains in the Genus database with same CATH superfamily
4MUJA 4A9AA 4DR5B 1RVDA 7REQB 1GY8A 1OVMA 3GN1A 1UMBA 3UXHA 1V2GA 4BQNA 2WG1A 4ZYUA 4ZGGA 1REQA 3A05A 3KXIA 4N9QA 5J59A 1EIWA 2Y3IA 1SUCA 3P9SA 5AJHA 4HAZA 4CLOA 3KFXA 1KXJA 1P7CA 1G8JA 4RTOA 4CL2A 5CRIA 4DV1B 5AK3A 4KVZA 3IE2A 5E6SB 3H75A 5E2BA 4RZSA 3AB7A 2HJHA 3JAKA 2DHDA 3ORYA 2IIQA 2YHIA 1SIBE 3M6MD 5F9MA 3DFIA 2L18A 3U4QB 4KQJA 1V8ZA 4R8RA 3GQVA 3KLMX 4FE4A 4P5EA 2EL9A 5BO5A 5FUQA 4LHVA 3MW8A 4HGRA 1WNFA 3SJ7A 1CUWA 1J8QA 4A0FA 2N1MA 3A10A 1TIPA 5LP6C 1IVYA 1JBEA 2Z30A 3VDNB 1HBJA 4EHNA 5T3YA 4AICA 4YRGA 3DAOA 1MOZA 2Z4SA 1CE8B 2XNKA 1WOYA 2FF5A 2P4SA 3HPQA 5AVVA 5I48A 4BLTA 2ZZMA 5GZ6A 1EK0A 3RJTA 2PYZA 5I47A 4G65A 4OSOA 2Y9PB 3TD2A 2QP9X 3UJ6A 5KOIA 4O4HA 4A5OA 1UK9A 3RIYA 5BUQA 3WTCA 3ZW7A 1LTQA 4OUDB 4QBIA 2OHFA 3BRSA 5IBPA 3FCYA 3WDLA 1WEKA 4DQDA 5LQUA 3CSSA 4ZQBA 1NBIA 3TZLA 1MGPA 2D3TA 1UC5B 1YVRA 1FJ2A 2YINC 4FFMA 4MW7A 4MHSA 4OGWA 4UMEA 5JIBA 4FJ0A 2NO6A 3UBTA 1TZJA 3OPQA 5J1TB 4JBNA 3OG9A 2XOKA 4XYGA 4WXEA 4K1LA 5GM1A 1KHHA 1KYXA 3FF1A 4QOGA 1W5SA 2X5KO 4TRJA 3IHKA 5IWAB 3FMGA 3IAFA 1Y9JA 3O1HB 2RAVA 3Q3VA 4YRRA 1TA9A 3PXAA 1NVVQ 3H5OA 3M6LA 4YROA 3KEFA 5K0LA 3NUZA 3SZUA 3JR3A 1QCDA 4CIBA 3QK7A 5B3JC 1GLVA 3QUCA 3DFUA 3H42B 3WL5A 4IDQA 3DBRB 3E5MA 1G8KA 4Y1RB 1P1BA 1Q0PA 1SXJC 4JT8A 3PXGA 2H1IA 1FYDA 4HAWA 4BP3A 3DULA 2Z3ZA 3CG4A 3R9WA 2CE7A 4MR8B 5CVJA 1L4HA 3GLHA 1NTRA 2QGZA 1JX6A 5BNTA 3OX2A 1Z45A 3A7EA 1WUHS 2J7PD 4IOKA 2PRSA 2ZWIA 2BRUA 3OM0A 1N75A 4L8LA 4MRPA 3WMEA 2WTNA 4DE5A 3KR0A 2VJAA 4V3BA 1OX6A 3S81A 1OAOC 2CJWB 2FJUA 3VV3A 5LU8A 2GK3A 2BJHA 4AZ0B 4CIAA 1FJXA 2GA9A 4K9RA 5KMGB 4LZPA 2RIRA 4ZOBA 2EX1A 5IC6A 8OHMA 5J2TF 1UBCA 5LA6F 2ID7A 1NUQA 4I08A 5FKJA 2JGFA 2P5SA 5BMVF 3Q7TA 3QKRB 4TYNA 2IY8A 4X3PA 4KRGA 5K8LA 2B2NA 1VSTA 5H16A 4P80A 4Q39A 1P18A 5DM0A 1L7QA 1OBCA 2DRIA 2AJDA 1S7CA 3GBSA 2FYTA 2IELA 3BIFA 4IZ6A 4DTCA 1E8DA 3E9DA 2NYAA 1N92A 2OMKA 1VLZA 2QGFA 4JB0A 3CRVA 3TX2A 3WGMA 4DV3B 4HQLA 4CEIB 1H65A 4ENQA 1VMEA 4X95A 1IN7A 2Q1TA 3BDIA 3SEQA 5ALSA 5AKYA 3JWHA 1N8TA 3LRPA 4GOJA 2HPVA 5DNEA 5DHPA 1KSGA 3F47A 4N7BA 3RWMB 1CR4A 1V16B 3MC1A 1FDOA 2P6UA 2REXB 2XT0A 4G9GA 1FX0B 5EZYA 3WXBA 5GINE 2HBRA 1PYDA 3HB4X 1CUUA 2DSTA 4FFBA 1GQQA 1EZ4A 3RHSA 1E79A 2QRQA 3BCUA 3LDUA 4J1NA 3T5GA 4BP9A 2GERA 1XDBA 2FOLA 3A3NA 3NTRA 1H94A 4YACA 2F4NA 3H8SA 4B09A 3A06A 1BFKA 3VU9B 3HA3A 3S44A 1DO0A 2R5WA 1YASA 5CK4A 1V7CA 4X1KA 3RYHA 3BXOA 3UGTA 4C4AA 1SN7A 5AYVA 2EV9A 1KK3A 2DPYA 5JJLA 1PLKA 2JCYA 3AF1A 3AEYA 3O1JC 3R9IA 4D4MA 2OYSA 4UASA 3V8BA 3JAMA 2XA9A 1ADCA 2GYWA 1ZI8A 1JS1X 3PICA 1LZLA 2DWPA 3UB3A 1YB5A 3HCPA 4MVJA 3AESA 3VYVA 3WGTA 1FLDA 4EZIA 4O4IB 3N6XA 2W6MA 2QGNA 3BPSA 5KSWB 3N7TA 4GKJB 4YMHA 1F20A 2AEEA 3MIZA 2E5LB 2A86A 2NTVA 1WPQA 2XA2A 3I5XA 3H9UA 2AW5A 1R6XA 1QOPB 1UPTA 4D46A 1Y6GA 4PG6A 3JU3A 1CYDA 4W5OA 3FHCB 4A6PA 3EA5A 3LCRA 4R41A 3WQHA 3WMFA 5SYAA 3L79A 1DRUA 1FNDA 1N2OA 4LYYA 3TQCA 2QMZA 3GRUA 1Q6YA 1X7YB 3JSAA 3K9HA 3BORA 3HDTA 4FE3A 4TS9A 2O7QA 3P2YA 1Z62A 1ZMTA 1SC1A 2NSYA 2YFQA 1N57A 4BNTA 3OEYA 2GILA 3EX7C 4OLJA 1QKJA 1HKUA 2C7BA 5JNVA 1O96B 3HFJA 1UBKS 4KDEA 3ZI0A 5DE3A 3WC4A 5JRZA 2ZB8A 3WYFA 1M2WA 5FR2A 3GRFA 4JJIA 2H11A 3DEZA 1S8AA 4UZEA 1Y48E 1IPFA 2I2XB 1VHQA 1T43A 1X42A 3IOYA 1G8GA 4AMBA 1QGZA 3EF1A 3COYA 3FTNA 4GSKA 4UTOA 5HMMA 1F9AA 2OYCA 3B6MA 4MUKA 3WGYA 5J5VA 3RC8A 4EF6A 2F9MA 3SEAA 1FMLA 2AL7A 3MPOA 4J3JA 1W5FA 1EEXB 5IN5A 1E8MA 2YBDA 3IA2A 3L6UA 4RD0A 2P7HA 4PS1A 3ER8A 2WPNA 1WLSA 2VC2B 1AZSC 3VZRA 1U1DA 3AQIA 3ZX5A 2VA9A 3IHWA 3CIOA 1O77A 5GOZA 1T8UA 2NT4A 1JJIA 4MJLA 5FIUA 1ZRSA 4V0MA 5D6OA 4RL4A 1UZAA 2AC7A 2FWRA 2HQRA 4JB8A 3NYQA 3E27A 3JD3A 4C7JA 4IQ0A 4Q4AA 1A8HA 5J40A 1EHIA 1DOAA 2Q4RA 5BWNA 2H08A 1KSHA 4JU8A 5J4VA 3H4TA 5CHYA 1QHXA 5K45A 2PV0A 1Y4UA 5THKA 2IPLA 3KNZA 4Y2VA 2G6TA 4BGVA 1AMOA 2TMGA 1OH8A 1FFHA 1IC6A 2QW0X 3OWHA 1NA5A 2PS3A 2PXHA 3SSNA 3V8VA 1IL0A 3PEVA 1E2MA 1U0HC 1HYBA 1YZHA 2ZPTX 4LHZA 4XE5A 4YJ2A 4DR4B 1XHLA 3W9YA 1T4CA 2JIMA 4KN8A 4JI0B 3FRJA 4C87A 3QLVC 1HTWA 1K8ZB 4QHYA 4UEJA 1NJSA 2JHPA 4RH1A 4B4WA 3D8NA 4JT4A 3F96A 2ZGVA 3GL9A 3GZNA 3JQ9C 2O8BB 5CTAA 2OAEA 4FYHA 4B5LA 4R9SA 4MKZA 4WCFB 1NYQA 4RFSB 1L5HA 4AQ7A 3W5SA 1K3FA 3GG2A 1D8AA 2GCNA 2DQYA 2O7VA 3E0QA 1CUHA 3HNOA 1MC1A 1DP4A 4PNHA 2YWXA 1KE2A 4AJPA 1JG3A 2IPNA 4MGZR 4NJEA 1NVBA 2PGLA 1VBFA 3DE0X 4CDGA 4YRBA 1USGA 4EKDA 3MBKA 2V3CC 3N7UA 1XXLA 1W4ZA 2NO0A 3QMWA 5GONA 4Z0PA 2C04A 4I14A 5AWFC 1RI1A 1RYYA 3WLHA 3GP5A 5DGCA 3AOEA 4PPQA 1FTQA 1L8LA 3AETA 1XMVA 4OXNA 3K6SA 4QYIA 3BQ9A 1EWYA 2H54A 3I09A 4R5MA 4GLLA 3QOYA 4G67A 4O4LA 2VUIB 2JB9A 4RHYA 5E4TA 2Y1OA 4EMBA 2XDQB 3OFJA 1SKYE 1Z39A 2A1IA 2ETXA 2M6LA 3T7AA 3ZR4B 5ELMA 1AJEA 3CX4A 4KQCA 3RJMA 1GGJA 3FR7A 2YRWA 3IPLA 3KIPA 4KODA 4R2WA 1I14A 3NCTA 4MWDA 4BEVA 1GAXA 1A4UA 5ESRA 1SUFA 3UJ8A 2E0IA 4KNVA 4KHPB 1P62B 5SZJA 2FTKE 3AJRA 4XFDA 1T5OA 4FDAA 3FCCA 4OP1A 4QOHA 4S0XA 3N8DA 1T0PA 1SQ6A 1PAUA 1Z37A 2H1VA 2ONKA 3RFTA 1O57A 3G2KA 2YXBA 1RWQA 4KX3A 4PR3A 4D9IA 1SUAA 3INGA 2NU9A 3K0HA 1NUAA 2P6MA 1TUBB 3VHLB 1HUQA 2B69A 2FFBA 4QDJA 1TB4A 2O19A 4WUTA 3O1LA 2Q5CA 4RABA 1EMDA 2PQ6A 1S8FA 5HRUA 4K2HA 4KXXA 1X39A 3D3JA 2OCBA 1EB8A 1AOXA 1QH9A 3IOEA 4L4UA 1JHXA 3K71B 1KEVA 1W2WB 4XARA 5EXPA 5IKXA 1CUEA 3WO0A 5FUYA 5LKAA 4K40A 3PUVA 3UWSA 2Z2YA 4WL0A 5EP4A 2ZTLA 3DV0A 4Q9JA 3RFFA 2WWYA 2ZSBA 3WICA 1G98A 2C59A 2VJCA 2XUOA 2EYUA 2QQFA 1JI0A 2R6FA 3CVUA 1JTFA 3UV3A 3LPCA 5BWBA 5M29A 3CQ9A 5H7XA 4RIFA 4OFBA 4IVRA 4Z0HO 4Q12A 4YB8A 1RE0A 1P5ZB 1W581 2OP1A 5EMNA 2H7YA 4KR7A 1EXNA 1EUCA 5CP8A 1DBRA 5CA1A 4JYZA 2PZBA 4JXJA 4F3CA 1WXIA 1XUOA 4WJZA 4NC9A 4YUZA 1PW7A 2POCA 4G5OA 3AVWA 3NDRA 4D9CA 1JAXA 4J94A 3R4VA 2TMDA 1Q95A 3DQPA 5JTTA 1FUIA 3EFHA 4KXQA 3OC0A 4DQLA 1XRJA 5IN4A 2DQZA 2I3GA 2VBCA 3DOCA 4XW2A 1G7RA 2AOVA 2OT3B 5JS1A 4NPAA 1XKQA 3IT0A 1PJQA 3LTEA 3UT5B 3H2YA 2ZRIA 1A7JA 3IUJA 3DO6A 4MA0A 3NEYA 2JJQA 4R3UC 1X7ZA 1VE1A 2ZG6A 4CM8A 2CFRA 5E0OA 3EB9A 1NKTA 5TE9A 1GKLA 2IV7A 4CEHA 1VYUA 1GZ6A 3GPIA 4TOIA 3G7NA 4IIXA 3QVSA 3ECAA 3E3LA 1KU0A 5D84A 1JHRA 2L82A 5A9SB 2HV8A 5B4VA 5JEDA 2FEMA 4ZDJA 4BOYA 2NZJA 4DC9A 1B7GO 1YR8A 1ZC4A 3DD1A 3TGWA 1PEYA 3WR5A 4FB4A 2P2SA 4RELA 1C0PA 3FBGA 5AHKA 1LLFA 4B3CA 2LUOA 2NSJA 2YVKA 3SLGA 9MHTA 3VC3A 3WNVA 3VR4H 4JI8B 5DIZA 4BVFA 3S1SA 4PR0A 1R9GA 3AJAA 1WD5A 2YQ5A 2FZLA 4KXYA 1J8MF 2GF2A 4MKHA 5BSKA 1KP2A 2QRVA 1IWBB 5JAIA 4MS3B 1IATA 1P7VA 4RMHA 2IEZA 1QF9A 2O8FB 3LY9A 3KSZO 3TQIA 1NBHA 1E4EA 3QYFA 3LBAA 4QXOA 3SLKA 3UFXA 1U02A 1WHTB 3BXEA 2BFNA 2QSJA 4LDQA 3BSSA 3UXYA 1SIWA 4IXMA 1DTWB 5KI6A 4ASUD 5I5EA 1Y3BE 3HRHA 1SHUX 2MYNA 1L1FA 1VBKA 4DMLA 4DCUA 1A96A 3PUKA 1R8XA 3D8RA 3DVSX 4YASA 3EOAI 2WJGA 1W6UA 5IM5A 2JIQA 1MAAA 4OTZA 4O2BF 1N6KA 5BT9A 4TRNA 1FZTA 2WUWE 3PUYA 1B3BA 1DJPA 3C8DA 1EWKA 2BH9A 4PLCA 3ZXXA 4G0NA 3N74A 1PUJA 4XWOA 4N41A 4X6LA 1KJ8A 1OBOA 5JLAA 3G59A 4B7UA 1NM5A 2AN3A 1JHVA 5DHTA 1XMPA 1Z6YA 2BH2A 1XR3A 4TV8F 3EMKA 2JBAB 2PM8A 2VT2A 1C3JA 1DXOA 3H18A 3H11A 2IH4A 1WOMA 3B70A 1IE3A 3DZFA 3NJRA 1N9GB 4BMOB 4JN6B 1RRVA 1ZGAA 3P5SA 4ZTBA 2GBGA 3PQEA 3K6RA 4R1NA 2HJSA 3X2FA 4YMWA 1RMQA 5GY7A 1IQUA 1GG9A 1GDHA 3EDRA 3RTAA 2CL0X 2Z0MA 5C7LO 3RF7A 2PV7A 1S2DA 3QE4A 2SBTA 2IU6A 5MF6A 3EDQA 4PG5A 1E7YA 1KOLA 2YVUA 3K35A 4U3JB 2A6PA 2Y68A 4H6WA 4A3SA 3FMPB 1PFQA 1Z5OA 4CODB 4I2NA 1QHNA 1IUPA 2TMYA 2P2LA 5DGIA 3CMMA 5LDDC 2QOEA 4JXXA 1QLJA 4MLPA 1CVRA 5KTNA 1OD6A 1Z4QA 4MUHA 4NOKA 4NCIA 3V97A 4BQQA 2JGNA 1CQIB 1Z4NA 2I6SA 1D6JA 1IPEA 2CVHA 1P1HA 2Q3LA 2YJ3A 4URWR 1T4MA 5H59A 4I3HA 3WISA 5BWOA 1EP1B 4KTTE 4CLXA 2CLMB 3VPXA 2ADMA 2GB4A 4UM8B 3BSYA 2O06A 2CFOA 4XWTA 4QYSA 1U2DC 4TWIA 4UHBA 4URFA 3GBVA 1K4YA 2VZEA 1KH3A 1ULTA 3NYIA 1NOJA 4Q9NA 5EWMB 1CDOA 3DEFA 4BKRA 2FCAA 4DXHA 3C3CA 1ONSA 1MABB 1XU7A 1I5RA 3IV7A 4XEUA 3JRNA 3MD0A 4B6PA 5BSHA 1AKVA 5B1EA 1G2PA 2Q6KA 4XJXA 1QIEA 2WIAA 3GIWA 4UVIA 4R3WA 2AQHA 2XBMA 2H52A 1AGYA 1IN4A 1PSDA 1Y3CE 3L6EA 4F9TA 4BO4A 2I4NA 2QKYA 1CQPA 2GZ2A 5AW6A 5T3UA 3NBKA 3UMSA 4DEYA 1F8XA 4BBJA 4AI6A 2IE8A 1ODKA 5DSZA 1D2MA 3DMGA 1QG0A 3VJKA 2B5VA 4LA4A 1YFKA 4NEHB 4HJXA 4UHKA 1MEEA 3L1UA 3PRHA 4IJWA 1KAQA 1ZH6A 4RZQA 4YCLA 1K6XA 4G0WA 4P36A 4LVNA 2F1KA 1E9RA 3DWEX 1F2UA 3QIVA 4DBLC 3AR8A 5EQFA 4LXTA 3KE9A 1CJSA 4G4JA 3UFBA 3ZGVA 4AO6A 1SBTA 4DA6A 1QGUA 3TG8A 1GQYA 1IBLB 4QECA 3E48A 4B83A 3ITKA 1BFUA 1C4KA 3P0RA 4P93A 4WINA 5A7HA 3D0KA 1KARA 5DTMA 1E2DA 3IALA 2G04A 1XSEA 3LO8A 3DCNA 2XQGA 4E5KA 5AW7A 5IU6A 4R54A 4BVEA 3A9SA 3NHWA 3GWGA 1XXHB 4QTYA 5J2UF 1LWNA 2IIBA 4IMPA 4UKDA 4Y2YA 3K8YA 5K2OA 4BX9A 1O6BA 3PJRA 4P7KA 2IKSA 1WSDA 2JFXA 4WASA 4Y2QA 4EJFA 1F6BA 1YD7A 3IBTA 4QA9A 2ZRHA 3WHPA 1SU6A 4DR1B 1OTHA 4GBJA 2AC4A 4J0IA 2WV9A 5BWLA 4ZJPA 1J2TA 4GQAA 3GLFB 3I2KA 2C7RA 3PNMA 1U9IA 4DV4B 3AFIA 4LHSA 1JVSA 2WSSA 1GAJA 2HRCA 3C5CA 3DS8A 3FNEA 1KL7A 3K0EA 2C2OA 2RGNA 2V4UA 4KZPA 1E3LA 1E9BA 4CV1A 5IZCC 3AI7A 3C6KA 1QFYA 2CNDA 2W48A 3DKVA 3GK3A 4QUGA 1TYAE 1CUFA 4EMUA 2P9FA 1Z5ZA 3RDPA 5HP4A 4JT9A 1VL5A 5IVHA 1K68A 3BX1A 2MTBA 5CEEA 3IMCA 3AJ8A 2YV4A 4N0DA 4TT3A 5F64A 3SG0A 2CHVA 3UMCA 4FLEA 3R75A 2R6ZA 3WXMA 1V8PA 2ZBQA 4L02A 4AN4A 3VDQA 3REQB 2JHGA 1PNTA 4IKEA 4C7OB 4Q3LA 3BTUA 2WTUA 2ZSFA 4DHEA 3C1UA 2HA6A 3LSTA 2CL5A 2O8CA 4TKUA 2CXPA 3LKDA 1ZIPA 3CKMA 4PLWA 2XQIA 1BMFD 3DWGA 3O94A 5T4FA 1Y80A 3FOEC 3R74A 3UB4A 3F8WA 5ALPA 4HTAA 1Y37A 2EG5A 3O3NB 3GFPA 2BGTA 1ZM9A 2C5LA 3C6BA 4ESOA 2WF7A 5L95A 1Z12A 4XPZA 4FMBB 1UJBA 2YJNA 1KVUA 1LJ8A 1X1EA 3RRMA 3NTQA 3W3AD 2F8TA 1EVZA 1ISPA 3SD7A 5KTRA 3DTNA 4BVHA 4YP9A 2VP2A 4EZBA 1PVVA 2HB6A 1K89A 1P91A 2V3WA 4GS5A 2CZQA 4ZJZA 5K0GA 4PVDA 4XH9B 4MICA 5C32A 1ZH4A 2FETA 3Q3GE 3M5CA 1YQEA 1WQ3A 4GM4A 3FWPA 5JXJA 4CF3A 3OIWA 4TM8A 1GPMA 5AT1A 4R9NA 1H2BA 3PC4A 2XCRB 1IXYA 3DTTA 1EQAA 3NAMA 5EE5B 1BJRE 1OBVA 3JQ8B 1M67A 1KA9H 3QEMA 3AHEA 5A4KA 3G5TA 2ECQA 2IZ0A 3RFXA 3IEXA 1U0TA 3QXJA 2FGJA 4XGIA 2I6GA 2R44A 1QFXA 2OVFA 2RHHA 4AX4A 1J21A 1Z2OX 3AL2A 3PE3A 3QXSA 3R5HA 5JC1A 4WCFC 3HUUA 4LNUB 1TUGA 4N82A 2ZI9A 3INYA 1SEPA 3AUTA 3HBNA 3W8NA 1FRQA 1N8KA 4XTRA 2JVJA 4F3KA 4LJYA 2X3UA 1D5CA 4XD2A 4YJGA 2CWDA 3QF4B 2C98A 4C0SA 1QH8B 3CKYA 1T8TA 3JD2A 5FPSA 2ZWOA 1WAMA 1RAFA 3LQ2A 5TT1A 4YMLA 1L0BA 3L01A 2YRXA 2IXAA 4HB0A 3NO4A 3P9ZA 4NBVA 1L5LA 3W2EA 2GBLA 4KQGA 2B6NA 3N3BC 1D04A 4CLDA 4IJMA 4OSPA 4EY4A 2A4KA 4PIVA 3PCTA 3KYJB 4GMGA 5HSGA 1E94E 3HV0A 3CNHA 2H0AA 2WYHA 3ZXSA 4GNRA 2RGEA 4RCZA 1HLFA 2PX8A 2ZYUX 1FFDA 2O7RA 2WP0A 1U5BA 4MUYA 1Q7GA 2NQTA 3IVCA 5HILA 3ZY6A 4DSAA 3FPKA 4MKIA 1XPUA 4WESB 3D3WA 1XE3A 2NP6A 1H69A 4U2KA 4MKGA 1UBOS 2EJUA 2QVBA 4EO4A 3DFKA 3C3JA 4QBFA 1C7ZA 3TNJA 5IEBA 1VSBA 1QR6A 3VR1A 2I7CA 3U19A 1TCVA 3S6JA 2WHEA 4KQMA 1P5FA 3B52X 4RWZA 3OSZA 5ENZA 4AJNA 3ZWCA 2VJMB 2B0JA 3AB3A 5BN4A 2CFCA 4TKVB 1MHTA 1YVDA 2HDHA 3LECA 3UO8B 5GVSA 2ZB4A 1X9HA 4N1AA 4N3CA 1JEYA 3MWEA 4D9MA 1TLLA 1CT9A 1KQGA 5EVJA 3H5IA 3K94A 3BGIA 3LNCA 2EGUA 2QVYX 3KL4A 1T5HX 4OIFA 1B6GA 1TT5A 4XGKA 4XI9A 3RJZA 4EKNB 5K8VA 4XA8A 4FYVA 4MRMB 2FR8A 1ZCJA 3MJ4A 4DNFA 1XVVA 2G4VA 4D98A 4X45A 1TIKA 2R11A 2Y0BA 4BO3A 1XKLA 3O9MA 2H9YA 1I7PA 4X6UA 3PEUA 5C53B 3WAKA 4G4SO 4JBYA 5A2GA 5IH7A 1QLHA 4FYIA 4EATA 2XXJA 2QJRA 1TMYA 1UMCB 3MT0A 3NEPX 3OJ0A 2XIJA 2WZDA 4H0FA 4OQPA 1RXIA 3EMDA 2R8RA 4V0RA 4IIUA 2WM2A 4YYEA 5DHRA 4TSKA 2H00A 4GGMX 2X5XA 5BYBA 5HMLA 3UBMA 5JT1A 3WGHA 2CKDA 3M4JA 1RMTA 1SHJA 3MJSA 2GVZC 2JFHA 3A9CA 4HH1A 4R6WA 5CT8A 2OV8A 2QG4A 1RBZA 4O4JB 4QQRA 1DZ3A 2XEDA 1I1HA 1TZ2A 2Y93A 5F52A 5IDVA 1KEEA 1BHQ1 1SCKA 1R0CA 3AEXA 3S4YA 2P5TB 2YZGA 4KGXA 4TX1A 3ZQKA 1Y1KE 5DWDA 3SS7X 1C29B 4BFSA 2BFDB 1LSSA 2Q3MA 3WFIA 2M1XA 4FZ5A 3WYAA 1M1ZA 5EP3A 4YCDA 4ZREA 5JCJA 1T1IA 1Z8DA 3IUPA 4Y6QA 4O4IF 4XQ9A 2GRAA 3A28A 5EIWA 4NBTA 4QXAA 1GV0A 3OOYA 3VR3D 2DR2A 4MVWA 1PR6A 2BM0A 3LFUA 1J25A 3VPDA 5C46F 2XRMA 3TRDA 2FEKA 4E5SA 4ZJUA 5JFGA 2QTFA 5CB0A 3P32A 1M66A 4II3A 4LISA 3RS0A 2WIDA 4Y0AA 2WSIA 1NHWA 1TVCA 1VLJA 3COWA 4KU4A 4RYDA 1Y3FE 3JD0A 4ZVLA 5BSTA 2GAAA 2AFHA 3AW8A 3JWGA 2RGUA 4PRLA 2XB2A 4KJZA 3SLRA 3USZA 1GPJA 1LPOA 4D3ZA 3HYNA 3WWDA 5KOHA 4NBUA 4TYPA 1RJ9B 1WB9A 1KKUA 2QPLA 4IAOA 3QPUA 2Y0EA 2M32A 4J9VA 3LS2A 3PUXA 1FS5A 2ZSAA 1Q7TA 1E1CA 2VDLB 2WHPB 3PYLA 1JKXA 2H1FA 1Z4JA 2NUBA 4F9EA 1L3CA 4DV2B 2XZLA 2BI4A 4JLNA 5T4EA 1QOQB 3RSHA 3R2JA 1P8JA 3MCTA 2AGVA 2WHYA 3RK0A 2ZAYA 3SYKA 1K6JA 1CUSA 2BV3A 1T91A 4MRAA 5BVGB 2IYEA 3ICEA 4BEJA 1Y7TA 1RP1A 2AVNA 3VO9A 1ZY2A 5DSXA 1SUEA 1SURA 3A1UA 4M1KA 1GKKA 1RYBA 2K4MA 2X14A 4ZO8A 1SIUA 1ULUA 2F7SA 3CHYA 1AZLA 4ALLA 4KR6A 2NQ2C 1WV0A 2I0FA 2VA8A 3CWZA 4TM7A 5FUBA 3FVRA 4ZOEA 2OCYC 4GYJA 3V42A 2P9EA 1L1QA 1DFIA 4KRYA 4C07A 1WZCA 1PJRA 4KLCA 1K0FA 2NTEA 3OPVA 3KYDB 2PZ8A 1CZUA 2E4AA 1QIMA 2ZRPA 4KO8A 1JIIA 2JAWA 1JQLB 5D3KA 1P6QA 2J3QA 1UPUA 3E4DA 4D5GA 2NMVA 2G5CA 1IG3A 1J70A 1OC4A 2AFIB 4HAVA 4HNSA 3AIMA 4MI1A 3T4EA 4EHFA 3G1UA 3HWSA 1SELA 2FPRA 3ENZA 3EWAA 1PT5A 1UL1X 4NFSA 4WX2B 3WLMA 5J47A 5JSYA 4BMPB 3NWBA 1VI2A 2QLNA 4EY6A 5A06A 4JI7B 4D4JA 3O8CA 3L7JA 1ATIA 3WHKA 1ZVMA 2FW8A 1RXUA 4KQKA 4IDAA 4HZUB 4LE1A 3SC2A 3OQPA 2UUCB 4MWEA 4Z8XA 3KFVA 1HZZA 1MO6A 3L8DA 1NXSA 3NH6A 1BE0A 3KTAA 2WV7A 1EX7A 3M49A 3BMCA 3THXA 2BKVA 2GASA 4P3YA 1JYEA 4DSNA 4M6WB 3H1AA 2VJDA 3FCUB 1VCIA 3DLHA 4KSYA 1UAYA 2AG5A 2WIGA 5FOQA 3ZHSA 5CLFA 2WAOA 1KO5A 2WYWA 4CMKA 5GOTA 1SVMA 1ZQ1A 5E7QA 5FNVA 3T8YA 4P3KA 3PTZA 2HD4A 5AXCA 5GTDA 2HA5A 1M7HA 4QTTB 1TGVA 5B37A 1DEAA 4EHIA 4TYYA 1TAHA 2DH6A 2PKRA 4J90A 3G8BA 3NANA 3U37A 3JRXA 5I7RA 2QTZA 2WU4A 1JKJB 3JQBA 1XTUA 3T0FA 3B3GA 3A6DA 3FMVA 4TQUS 1CUZA 1OLSA 2FZVA 3N2KB 2ANCA 2GOYA 4IEIA 1LBIA 2XAAA 3KO8A 3OESA 5KJEA 2X4IA 3WWPA 1ESEA 2ZWMA 3LYAA 4K26A 4XOUA 4JLJA 3V3TA 5IMSA 4DNQA 2YJZA 4FYMA 3WB9A 3V8MA 1FXUA 1KYVA 3DTVB 1TW3A 3CX3A 3EGCA 4UEWA 2VBFA 1PZMA 3AI2A 4OFZA 2EEZA 4TXJA 5JI3E 1G19A 3MWYW 1RWKA 4I4NA 1VG8A 1TQ4A 1U6KA 1N6LA 2L69A 1S3SA 2XD4A 5E9QA 5GJVC 1YHZA 3U4CA 4C4OA 3C4JA 2K7ZA 4YV2A 2YFYA 2VHUA 3AGQA 3UPUA 2O48X 1R8SA 5BSGA 1VHJA 4RSHA 1RSZA 2J5BA 3FPJA 2RCYA 4FTWA 5FQNA 3TN7A 1PTJC 5M7EA 1Y8RA 1VTKA 4AUMA 4EMTA 4BQEA 3WK7A 2VQFB 1NN1A 3CZ9A 5E9AA 3W7VA 1GJRA 4F56A 2JH3A 1JZQA 2AEJA 1G7TA 4B79A 2ZRFA 3W3ZB 4BB0A 2I99A 2ZRGA 2EYQA 3SBEA 4AN1A 4NZOA 1DAKA 1Z29A 4JNKA 4MS1A 1BDBA 1GARA 4ZPXA 2UZ3A 4KN6A 2QTBA 1HOXA 1NMSA 3DHVA 2LNDA 2WSMA 4A2CA 3GEMA 4UBIA 3BXXA 2QI9C 4QM7A 1FP4A 2GGSA 5TV2A 1XZQA 5AVTA 4EF4A 1Q17A 2PL3A 2P1DA 2NSLA 2SICE 3DMFA 2P77A 3KK0A 4FS8A 4HYEA 2GM5A 3L5KA 2B7BA 3N0XA 4JLSA 4DARA 5BUCA 4FYXA 1CQXA 3L0SA 2BKXA 5HJEA 1BVYF 1E9CA 4TTRA 3CGGA 4I1VA 5HOQA 3EG9B 1TAQA 3W4KA 2RH8A 1UANA 2I34A 5AVUA 3PQCA 4DLZA 4HNHA 1DKOA 2DTDA 2LV8A 1YIDA 2ZLBA 3C14C 2Q9BA 3A8TA 1J0DA 4M49A 5LCXA 3UXEA 2UXCB 2Y66A 3DTVD 4EUEA 3PDWA 2W2QA 3IP3A 4DYDA 1OTYA 1M6WA 1YKGA 3SMVA 4YRMA 3B1WA 3LPNA 3TIGA 4HWGA 1QRRA 3ND6A 1QRTA 3OAAA 3HU3A 5FPYA 4JLMA 3O75A 3QXHA 2R1VB 1HO3A 1CJMA 1Y9AA 2EZ4A 4IIJA 1Z22A 3U6BA 1KI3A 2D1TA 4UBLA 4LOKA 3B89A 3KQNA 4ZAZA 2Q3DA 3KEMA 2RIPA 2ZYWX 1R6BX 3DD5A 4FP9A 3TDKA 4BE7B 2W9XA 4OI1A 3NKFA 5G1PA 1ZW6A 2AQ8A 2N0SA 3KEOA 5A5EA 4BQSA 4FI3C 2R3SA 3BRWA 2QU7A 2OXEA 3YASA 1Z35A 1H0SA 5HTKA 3ZCQA 2FSGA 3N53A 5HUQA 3TBHA 2XVMA 4WZAA 1AKUA 3JALA 1DQZA 4B0PA 1VHTA 1IY2A 2PS0A 1JIUA 3I58A 3IUMA 3Q5EA 3QVXA 2VT3A 1ZGGA 2ZK7A 2PYDA 3HDQA 4MO9A 5D3MA 3RV4A 3S2SA 1F9EA 1L9KA 1PDOA 3OKPA 2WILA 4QUIA 3T9EA 4S2UA 1XVTA 4HWPA 4DCOA 1T8PA 5A3QA 3HMKA 3HCRA 4ITVA 4Z9BA 2BF4A 3CCCA 2QN2A 3WK4A 2AN1A 4E22A 4HDRA 1W52X 1E3QA 1UXKA 4QVGA 3HO1A 4JD5A 1W59A 1EVYA 1GUYA 4ND8A 3AXSA 4KVGA 4RVOA 1G0NA 3H5LA 3IRVA 3KTFA 1UBFA 4QGHA 3URMA 5JDCA 1SZJG 2VJQA 3LBNA 1X92A 3VKUA 5B36A 2AC2A 4RSMA 2ZYSA 4LJSA 5KX5B 2EZ8A 1T1SA 3S1AB 1BN7A 1CUVA 2NACA 2HA0A 3PPVA 3ROQA 1JG6A 2QB5A 4CKWB 2FN7A 3LA8A 4TQ9A 1TCBA 2Y1KA 4KE9A 4KO3S 3GDOA 1JGTA 2FRDA 3A6ZA 4TXHA 4X97A 5B64A 1WQ1R 3F4LA 4B3IA 2F1JA 3OLVA 3GVHA 1EBUA 3CUTA 1P2TA 4IZHA 4CG0A 4F0JA 4RVCA 4NCHA 5JXHA 2VL7A 4H15A 1H8HD 3QU5A 3ZTWA 1U0GA 2WD7B 4IKPA 4JJGA 3ESCA 4E5PA 1V4VA 3DVAA 3KB2A 3JQRA 4EB6A 4M38A 2Y4NA 1TF7A 2V6GA 2ZIGA 4C0HA 1NATA 2GJKA 3PF9A 4HVCA 1JZSA 5HUHA 4JA2A 3QTLA 1GT6A 5HG0A 5JXWA 2ZB3A 4ARIA 5EXSA 1S8NA 5IW8A 3W1EA 5KQPA 3HDGA 5CIYA 4CWAA 3P9QA 1XNRB 1U8AA 4KI7A 2WKSA 5AJTA 5DU2A 1QE0A 3H83A 4X6XA 1KSFX 2RJNA 3LQ4A 2V55B 2FFAA 3P4XA 1S3IA 3M1YA 2IU4A 2JNWA 3TSYA 4B43A 4BMYA 3WGJA 1Z6PA 1IMOA 1RW4A 2IXFA 4RIIA 4DDHA 2WQ6A 4EKYA 5JC8A 4RK7A 3LT4A 5I5GA 1B73A 4I55B 3ITEA 4KAFA 5K4AA 1GP2A 3M6XA 2ZIAA 1UKZA 4R68A 4IJ6A 4JI1B 2YXEA 4YGXB 4UUMA 4F60A 1EP2B 1O9BA 3AEQA 3KUKA 4QQ8A 2HLHA 1NVGA 2YC4C 3HGTA 3MSXA 4FC6A 1NYLA 2EHJA 3VZQA 4LFBB 4W1RA 3HSYA 1Q3HA 1IEWA 3I92A 4A10A 5AI0A 3RRXA 4EWLA 1NN3A 3IQDB 4OQDA 1GNVA 2CZCA 2JEYA 3TYXA 2VCYA 2VO1A 1XZNA 4GT1A 5BXQC 3PJFA 1EWQA 4N4AA 4NPCA 4IQFA 3G9ZA 3G02A 3ZCRA 3OF5A 2QG6A 4PAWA 3I4FA 1UWLA 3LV8A 1WB4A 1UFQA 1KZ6A 3VQTA 4UTVA 1E18A 2XMZA 3HB1A 1YQUA 2ZXUA 2V58A 4F4DA 2J9FB 2R7LA 2WIKA 2X0RA 2B6HA 3RVRA 3RS7A 2HWUA 2ZIVB 5EGNA 2ZM6B 2IZ5A 3S2EA 3BB4A 3RYFB 5DRTA 3ZD6A 5IVDA 3IV6A 1ZICA 1FW8A 2LXNA 3R3UA 5B58T 3IS3A 5ECYA 1W94A 2GCIA 2VWPA 3MTDA 2HNBA 2KBFA 4A26A 3DGFC 4HPJB 2JRLA 3C6ZA 4BUZA 4DLBA 3PQ3A 5F98A 3ERCA 1Y1PA 2A9RA 3NJ4A 1KK1A 3U0VA 4IIBA 5JSHA 5CCBA 3SHVA 3GEGA 1ABEA 1EKXA 3RSCA 1AD2A 1HL7A 4AG6A 2JLUA 3SP1A 3CVVA 4DV0B 1BMQA 2Q07A 4UU1A 1THTA 4FHCA 4GNKA 2H18A 3S2ZA 1G20A 4MI6A 1C5KA 4GYKA 5GAJA 4CM1A 2P78A 3W8FA 2BCEA 1C0KA 1T34A 2BDTA 2J6BA 4UM9D 1CEQA 3NLLA 2W00A 3THYA 3IBYA 3KT3A 5IXYA 2HMAA 3L7AA 1UOQA 3QFHA 1SD2A 1O4WA 1YAJA 3GUCA 3L7CA 4IXTA 2X40A 4FHDA 2EAUA 4RNDB 1MC5A 3WIBA 1I3KA 1IQ0A 2FPGA 3EDCA 2Q5JA 3CUSA 4E4RA 2B30A 3NP7A 5A4JA 2W8BA 2W98A 1PG2A 1VE9A 4UCQA 5CDFE 3PA6A 5CXUA 4ZYZA 2FN9A 1E1NA 1NX9A 5KVCA 2WYOA 2Z5GA 5DBHX 5LDGA 1NNSA 4D6XA 3LRTA 5EKUA 1X7WB 2FG7C 1YOVB 3Q3HA 4JQZA 4FQ8A 5AJXA 3JD1A 4PQFA 5CNJA 3SJZA 3TJZA 1BS2A 5AVJA 2ISQA 3HA2A 3SBDA 2BHSA 4KR9A 1ZJ5A 4JENA 3IX7A 2FSPA 3CCBA 1JR3E 3O4FA 4YUVA 1PS8A 2QI9F 1TFUA 1XPRA 2G9RA 1YJQA 3NTUA 2HEGA 2VP5A 3I37X 2QAIA 4CCWA 1F2TA 4X91A 4GOXA 4GZLA 4JP5A 2MINB 2KI5A 4ME6A 1X86B 4UVGA 1Q6ZA 3Q6NA 4NBWA 5EJ4A 5ALWA 3MJFA 3KVVA 5AM3A 2VJBA 1II8B 3WSVA 4OI0A 3C16C 2COEA 1WXEA 4NQZA 4OQFA 3G2OA 1SHZA 3ZY4A 1HT2E 1JALA 1SO8A 3C3WA 3L4EA 3O31A 2ZRJA 1HV8A 4H16A 5DGXA 4G89A 4G1VA 5F33A 5TMBA 1WG8A 1YZFA 3F6BX 5JAHA 2XNJA 2LKCA 2H2GA 3I64A 1AZTA 2AX4A 2WF5A 2IV3A 4ZMSA 3PRJA 1NPDA 2MMGA 3ELYA 4NECA 1F60A 2NUPA 3L1HA 4XOIA 3P26A 2X2PA 3P9RA 3T9DA 1UQTA 1T5BA 1WXFA 2CVQA 2FNAA 4F2PA 3T1HB 1NLMA 4LJ5A 3HDVA 5JDIC 3HFGA 2ERYA 2OHXA 4ZU6X 5KJ6A 3FTPA 3JQCA 4NMWA 3WFZA 4U9HS 1O8CA 1Z38A 4FI3F 4IO1A 1M5RA 1XDUA 1XAIA 1PHPA 2JLCA 4H7IA 1UDXA 1Q83A 3Q3CA 2YVAA 3JAWB 4MV4A 2FQQA 2E48A 4YAGA 1W49A 3FNIA 1OBFO 1Y4AE 3AYXB 3H05A 4ABTA 1ZRMA 4YWJA 4DCMA 4HQ0A 4C5BA 4M9ZA 3OPNA 4A6DA 1PNVA 3DOUA 4Q7QA 4C88A 3TD9A 1IOLA 2VK1A 3DT6A 2FPPA 2GKGA 5JYBA 2X0IA 3IDFA 2OK8A 4PYMA 2PL5A 1WA5A 1AM4D 1SKYB 2QTHA 5DYTA 1XPJA 2FZWA 4JFAA 5HKOA 2EBUA 4B0OA 3VO1A 2WD9A 3B82A 1TMGE 1X80B 1YZ3A 2G4LA 2FF7A 3E81A 2Z9CA 4L9RA 1Q5PA 5ESWA 1EQ2A 5FPKA 1AQ6A 1K5PA 3OJLA 4EARA 2PNFA 4MQBA 1XAHA 4OYLA 2AJBA 2IZ1A 2GF9A 3TUJC 3WYNA 1LI7A 3C4VA 3PQFA 2J4DA 3OKAA 2FQ1A 4C22A 4PSDA 5DI3A 2YVLA 1G2OA 1E7WA 5LLSA 1F6DA 1QPGA 3OZUA 2JLZA 3R3VA