2A4KA

3-oxoacyl-[acyl carrier protein] reductase from thermus thermophilus tt0137
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
237
Chain Sequence
b'GRLSGKTILVTGAASGIGRAALDLFAREGASLVAVDREERLLAEAVAALEAEAIAVVADVSDPKAVEAVFAEALEEFGRLHGVAHFAGVAHSALPLEAWEKVLRVNLTGSFLVARKAGEVLEEGGSLVLTGSVAGLGAFGLAHYAAGKLGVVGLARTLALELARKGVRVNVLLPGLIQTPMTAGLPPWAWEQEVGASPLGRAGRPEEVAQAALFLLSEESAYITGQALYVDGGRSIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl carrier protein] reductase
publication title 3-Oxoacyl-[acyl carrier protein] reductase from Thermus thermophilus TT0137
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 87
structure length 237
sequence length 241
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2a4kA00
1NASA 2ZB3A 3G79A 1EBUA 4CQMA 4E5MA 3TQHA 1H0KA 1WPQA 1YRLA 3OJEA 4XRGA 4FFRA 1WXDA 3P19A 2VWGA 4JK3A 3I6QA 4EJ0A 2TMGA 4ZGWA 5KWEA 1A9YA 4XJSA 4HUJA 4IUYA 4OSPA 3CUKA 3LVFO 5K6AA 3F1LA 1NR7A 4DQVA 1T25A 1D1SA 4TMFA 1PZGA 4OOEA 3AM3A 5J23A 4H7PA 2Q2QA 3NGLA 3B20A 5CEFA 2J3IA 2ZKLA 3PWKA 4ZHSA 1P0FA 4J9UE 4HADA 1ADFA 3GT0A 1N1EA 2EW8A 1DIGA 1BDMA 1X0VA 2X5JO 1LRKA 1TLTA 4GH5A 4PZEA 2O3SA 3ETDA 4W7IA 2UAGA 1E7MA 3JQ9C 1DJQA 1PZHA 3ZV4A 1ISJA 2C2XA 5A1TA 4YXFA 1T4BA 4D79A 3PFFA 3IJRA 4RZHA 3KYBA 3PDUA 4LSMA 3AOEC 2GR9A 4JLWA 3PWSA 3H5RA 3OIDA 3CEAA 4PLWA 1DHRA 1PR9A 3PPIA 1XKQA 1E7YA 1R16A 2IYPA 4BNZA 2VZ9A 3DBVO 6ADHA 1GUFA 1VI2A 4CQLA 4XA8A 1YDWA 3P2OA 1PGNA 3DZJA 5CG1A 3JQGB 5DCUA 1V0JA 1JWBB 1J0XO 2CNBA 3STHA 3FPLA 1PWZA 2CVQA 4RCVA 4CM6A 5A02A 3AWDA 3QQPA 1KERA 1FJHA 4LISA 4Y8VA 4XKJA 4RQTA 3CTMA 2DU8A 4FN4A 3PI7A 1E5LA 3I6IA 4JP3A 1O6ZA 3OBBA 2WM3A 3MJEA 4YBZA 4EUEA 1UAGA 1QG6A 3G3EA 3ROKA 3KUXA 4DBVO 2C59A 4IS2A 1NXQA 4ZN6A 2OBNA 3D4OA 3NYWA 5G0VA 1EDOA 3WQSB 3ANMA 3PZRA 2NQTA 1ZIDA 4EI2A 2DBQA 4J3FA 1LSUA 1XCBA 2J3JA 4MIOA 4CMBA 5JMWA 1F06A 2O3QA 1LJ8A 1NTOA 4PG8A 2VRCA 1QLJA 4EUHA 2HLPA 3ITDA 1W6UA 3SX2A 4Z0PA 3VH2A 4J2OA 4RDIA 4JQCA 4I9NA 1ZFNA 4YJDA 1NVMB 4S3MA 2YFQA 4IGEA 5A9TA 1YXMA 4EEXA 1M76A 2P9EA 4YT4A 1ZK4A 1Z7EA 2EKPA 4BMSA 3A28A 5DZSA 1RM5A 3FR7A 4WCFC 4Z9YA 4BKUA 4DLAA 1GD1O 2GZ2A 2D1YA 4Z0TA 4B79A 4RPGA 4ZICA 4HFNA 1KEVA 3CZMA 1JW9B 2ZATA 3NTOA 3GNTA 1F8FA 2PKQO 3LQFA 1TI7A 2GDZA 2YHIB 3MWEB 3DOCA 5L4LA 1Z75A 3DAGA 1V3UA 1P31A 3KB6A 3OP4A 5COAA 1ZCJA 4KTTE 2GD1O 3AU8A 4XIYA 4XQGA 4QTZA 5THQA 2X0RA 1U8FO 2FZWA 3HADA 2J3KA 2Z1MA 5F5NA 4GKVA 1R4NA 3DONA 5TSDA 2VT3A 1BXZA 5TX7A 5ITWA 3E5MA 1DLJA 2D4AA 2YDYA 2GN6A 3Q0EA 4Q3BA 4WOKA 4KMSA 2DQ4A 2JD0A 1IULA 1PZFA 4CLDA 3VHRA 3MJSA 2B4TO 2ZTUA 3W1VA 2FPIA 4YB8A 4QT0A 1QRRA 3H9GA 1U28A 2VZ8A 5K0ZA 3FI9A 4TRRA 1HRDA 1YL6A 4E6PA 2NU7A 2FY8A 1Y7TA 3G0OA 2RCYA 5DOZA 1U2DA 4JX8A 4CJXA 3VPXA 1EFKA 3DL2A 8LDHA 3TF5A 4M86A 1DRUA 1LXCA 3RU9A 5KNLA 1DXYA 3JQFA 1RM0A 2X9VA 1X0XA 1EQ2A 1M75A 2B69A 5A3VA 2ZYGA 5TGDA 3ZNPA 1EK6A 4ZQFA 3WWYA 4DWVA 1N7GA 3DZGA 3AUTA 2HAEA 1V35A 4RO0A 2ZJ0A 3PZBA 1WW8A 1LRLA 1QYCA 5CPBA 2NVWA 1NNUA 3DEYX 2DUWA 3C7CB 4RF3A 5CDUA 4TROA 2I6TA 1HE3A 1OMOA 4JIGA 3U9LA 4A0SA 3ZWAA 4XB1A 4IGFA 5LDGA 3WS7A 4Z9XA 4JBHA 4LRSB 4NU5A 3FTNA 2G0TA 4DIFA 2UV8A 3T4XA 1EK5A 4WCDA 3OF2A 5ER9A 1GCUA 3GZNB 4FPXA 4B3IA 5IZCA 4FFMA 1ADBA 1NPDA 1WLYA 4WLFA 3U3XA 5B12A 4A5OA 4CMCA 1P1RA 2FMUA 1WAMA 5EMHA 4B4WA 4ALMA 1JAYA 1YBAA 5A3JA 3PJFA 1X14A 2ZYDA 3BZUA 3A4VA 1ORRA 4QUKA 4JBGA 3LT4A 2OFPA 3ZI0A 4RL6A 2DAPA 5T6BA 1BMDA 1EE2A 1JLLA 3I3OA 4MVJA 3KYDB 4O6VA 3H2SA 1RYEA 1R37A 5IN5A 4MP6A 5H83A 2B36A 4AJ1A 2FPGA 3GRKA 1GYPA 1KVUA 4I5FA 1MG0A 1C0LA 4FGSA 1A9ZA 2C07A 3JV7A 4B3HA 5JAMA 3SLGA 5JDIC 4BNVA 3Q2KA 4XDZA 3LC7O 2UYYA 4HFMA 3DTYA 1QYWA 1U4SA 4E30A 4BO3A 2O3JA 1HDOA 3OA0A 3JQBA 4J91A 4PLTA 2PTGA 4R5HA 3NUGA 1A4UA 3C8MA 4MVJG 1ONOA 4MINA 3OHSX 5T57A 4BV8A 1BHSA 2B37A 3HB4X 3I1JA 3OIFA 1I3MA 3LC1O 1PQPA 2P68A 1J4AA 1HDXA 1XLTA 3TZCA 1PSDA 2IXAA 4NHEA 3GHYA 1LUAA 1JN0A 2WE8A 1TT5B 5A03A 4BNHA 2HK9A 5JDCA 2ET6A 3WJ7A 3ZU4A 4CM7A 1QKIA 2Z5LA 3VZQA 5CPFA 2C29D 3FNHA 3K96A 3I4CA 3ROPA 3D0OA 3U4IA 3OSUA 4CV0A 3BAZA 4GX2A 1SPXA 1DSSG 2X0IA 1I01A 1YO6A 2PKQP 2V6BA 4R1TA 3N58A 1U1IA 2BI8A 3HUDA 4B7XA 1UDCA 4GKBA 4CV1A 4MIEA 2G76A 4OSOA 2Y68A 2EP5A 3NGXA 3EW7A 1UZMA 4YT5A 2Q99A 1E0DA 3RFTA 1EUDA 4I5DA 2QZZA 5DCYA 5T5QA 1IZ0A 2Q1UA 3PDJA 4FB5A 3TSCA 1WDLA 1HE5A 3U49A 3W6ZA 4B8ZA 1BXKA 1I32A 4DPLA 3AFMA 1IZ9A 1MUUA 1C3VA 1G1AA 1HSZA 4CM3A 3KRTA 1DIAA 5T8KA 4FOSA 4D3FA 2JAPA 3PTZA 5COQA 4AJEA 4EJMA 3ADOA 5TQVA 2YHIA 2HMTA 4CM4A 3G1TA 3H3JA 3I23A 5JY6A 5AXDA 2YY7A 4PZDA 5MDHA 2O2SA 2EG9A 3GN1A 1ZMOA 3JD0A 4EITA 2W4QA 1LI4A 3NJ4A 1ZMTA 5KJCA 5JW6A 3C1OA 3E1KA 4BNKA 4J7XA 3ON5A 3BYZA 1K6XA 3WGZA 2ZTLA 3RCBA 3H9EO 1FDSA 2I66A 1Q1NA 2IZ1A 4AJNA 1KC3A 3R6DA 4GI2A 4BKRA 4DTIA 3ZU3A 1KBZA 1SC6A 3GEDA 3ITKA 3TL2A 4JXKA 2X22A 4EYEA 2BH9A 2B4QA 3PJDA 1QLHA 3LYLA 4JJIA 3TFQA 3VZRA 3INTA 4AL4A 4R5MA 3QP9A 1PL7A 1CEQA 3DFUA 4IS3A 4ND1A 1YQXA 4RF5A 3WGTA 3ZN2A 4UUOA 2YW9A 1PGOA 1V6AA 3F47A 4LN1A 1T2EA 4IDCA 4KUHA 3KM0A 1GV0A 1KEPA 2D5CA 3MTGA 1I8TA 3MZ0A 4PZCA 1ARZA 3WBFA 4WECA 1K5HA 1NWCA 4CMKA 2NTNA 5HS6A 3ZGYA 2X86A 2PFGA 1DEHA 1HF3A 3HDJA 4BNLA 2IYOA 4O5OA 4H15A 3FHLA 4JJFA 1R4MA 4PG7A 4WPGA 4BNNA 2D3TA 1A5ZA 4XGKA 4ZRNA 2O3UA 4YTEA 3S2GA 4L8VA 3BHIA 4D3SA 4EUFA 2C5EA 2HO5A 4BV9A 1MXFA 1K3TA 4J0EA 4A03A 2FR8A 4D46A 2BGLA 4OXYA 3DZBA 4GWKA 3MJ4A 5IDXA 4CQMB 3OQBA 1Q0HA 3P2YA 1DRWA 1YH3A 1JA9A 2GUGA 3ROMA 1C14A 4ZD6A 4NMHA 1EE9A 1HE4A 1E1KA 1MC4A 4MPDA 3UOGA 4AVYA 5KCZA 2FSVA 3K2EA 4RF2A 1RWBA 3GZNA 3RVDA 4IINA 1E3SA 2B83A 3CE6A 3HDYA 3ETGA 4ALIA 2UUPA 1NFQA 3RC1A 2VOJA 3GFGA 5C5IA 4KQXA 5H82A 2FR1A 4D0SA 5EPOA 1ZVMA 2P9CA 5A5FA 3WXBA 4J1SA 2EJVA 1BVUA 2IEDA 2Z95A 4GLLA 3MWDB 2GSDA 3NRCA 3ZWYA 3KYDA 2C82A 1WZIA 3KLMX 5JMPA 3E9MA 5H81A 1N2SA 4L4SA 2EGGA 4ALNA 5TNXA 5JC8A 5TJHA 1CIVA 2FHSA 3DOJA 5KJFA 4MP8A 2QYSA 3SJ7A 2WTBA 3I83A 1NM5A 4GSKA 4ILKA 2IEBA 3VPHA 1QYVA 1GQYA 3A14A 1HSOA 2I65A 1HT0A 4MIYA 2JHGA 1O8CA 1PQUA 2AEFA 3OEYA 4HKTA 4QFDA 4R3NA 4IBOA 1LLDA 5FF9A 3PWZA 4YR9A 4MVJF 4CQLB 2RH4A 5I7VA 4J4HA 2H5LA 3K2BA 5IDYA 1EDZA 1A27A 1F0YA 3NDIA 4H3VA 4J43A 2AHRA 4IZIA 4WLEA 4C7JA 4W4TA 4NZ9A 2WD8A 4A7PA 3GVIA 2JJYA 1G0NA 2PH5A 2WWRA 3VDRA 3VVBA 1NWHA 3L4BA 1X7DA 4FOOA 1IYZA 2V6MA 2Y93A 2VHXA 3M2TA 2CMDA 4RJTA 2EW2A 4MDHA 1GQ2A 4CR8A 3C7AA 2B5WA 3KSDO 1Y9EA 4LCJA 4BNJA 3PYXA 1I36A 3GN2A 2H1SA 2RHRA 2VTEA 4BO1A 2DBRA 4HXYA 1AXGA 4CQMD 1SEPA 4LW8A 2QG4A 2CDAA 2OBYA 2YYYA 3QSGA 4OQYA 4WGGA 3NV9A 4DPMA 3MOIA 1GPJA 3RUFA 2I67A 4BQPA 5JNLA 3GGOA 1ZKMA 4AJ2A 5ER6A 2ZQYA 3WWZA 1Z74A 2R2GA 2AMFA 4CM8B 1JTVA 3JQAA 1SAYA 3MTJA 4YJHB 2Q2WA 1ZJYA 3TZ6A 3OFSA 5IXYA 4K9DA 1CERA 1R66A 1OC4A 3BMOA 1PL6A 1PJSA 4BGEA 2SCUA 2NUAA 4ITUA 4WNCA 4C7KA 1P1IA 1HYEA 4JP2A 4PLFA 4GLOA 3JD4A 2Y0EA 1M6WA 4Y6RA 1B14A 3IKTA 2H6EA 3ZWBA 1H6CA 1DC4A 1I10A 3ADPA 2VWHA 4P4GA 5L3ZA 3RIHA 4PG5A 3W8EA 5IFLA 3L4SO 3KTDA 1HDGO 1YKFA 3JSAA 1P74A 3W4KA 2HUNA 3CXRA 3I9MA 1LQTA 4HFRA 3EGOA 3HB5X 3L9WA 1YBVA 4IM7A 4FBGA 3VZSA 3K6JA 2CVZA 1XQ1A 2PD3A 1N92A 4WK6A 3VAZA 3ZZNA 1ENPA 3PEFA 3K5PA 4UVIA 4BUCA 1X7GA 4E13A 3QJ5A 1WNTA 1E3EA 4ND2A 4PGFA 3KSZO 4TQGA 5CHEA 3KZVA 3ZV5A 5JFOA 1W73A 1A71A 5JO9A 2Q4BA 2X5OA 4ALLA 3C1TA 3Q2IA 1YS4A 4L0QA 1DFHA 4W99A 1GYQA 1ENOA 4GX1A 4Q3CA 2PGLA 1B15A 1DOHA 1TA4A 2O7SA 4BO9A 4B8WA 4WE3A 5L7TA 4CLHA 2C7GA 2FP4A 3IOYA 1EVIA 1M2WA 4B4VA 1U5AA 3X2EA 1V3TA 3AUAA 3QIVA 1DFGA 4OO3A 5A4DA 1T1SA 2R00C 3BXXA 1Z82A 3CPSA 1PJQA 2PK3A 1ISFA 1ZK3A 2YQ5A 4MVJP 3OECA 5JLAA 1ZJZA 2VRCD 4WNIA 3KXDA 1PGJA 2OZPA 4BNTA 1PWXA 3LT1A 3F5SA 1PTJA 5TT0A 3ONFA 2VRBA 1SBYA 3TL3A 1QR6A 3S55A 2H63A 4F46A 2RAFA 2GCGA 3T7CA 1NQAO 1Y8RA 2GGSA 1I5RA 3A1NA 5TLSA 2QW8A 1O94A 1LC3A 3CIFA 4R1NA 4KZPA 1GZ4A 2DTEA 2VWPA 3VPFA 3DBHA 2B4RO 2O4CA 1DIHA 2PZKA 3HE3A 4DUPA 1NFRA 4DIOA 5KVVA 2GNAA 2HU2A 4BQRA 5FI3A 5EERA 4KUGA 4DMLA 1VC2A 2Y05A 2PR2A 2NV6A 4YJFA 5JYDA 2YV3A 2HDHA 3PLNA 4NFHA 4NQZA 1DFIA 1XDWA 3AOGA 3FBGA 2TMDA 3O38A 2HQ1A 2EP7A 5U9CA 1B3RA 1ZK2A 5G0UA 4PLHA 3HZZA 5KJ6A 3F5QA 4WEOA 4GMFA 2E48A 1E92A 1U4OA 2YHUA 3RI3A 5JAQA 1E7QA 1P1KA 2I9PA 4UEOA 4J0FA 3GZ4A 4XYBA 4YAGA 3L07A 2WE7A 3GVPA 1ZK1A 3R3JA 4FQ8A 1ZK0A 3QRWA 5JE8A 3E48A 4U8GA 4YEDA 3TPCA 1UAYA 1UXHA 4J9VA 2IXBA 2Y1GA 1ZXBA 1QP8A 5JAZA 5CP8A 2P9GA 2D0IA 2QYTA 4P4NA 3B6ZA 4P38A 4KDFA 1P44A 3GAZA 4E33A 1UH5A 1VSVA 1KVTA 3QV1A 4P22A 4Q3EA 3RUDA 2BLLA 2GN9A 4RPKA 1DHTA 4L76A 4U6SA 2HK7A 4M8SA 3RFXA 3RUHA 3W8FA 4TVOA 4G81A 3DBRA 3QVXA 3H9JA 4IDGA 1NAHA 4XWYA 3OEWA 4HX5A 3GDGA 4BMNA 5FI5A 1EVZA 1EUCA 1VKNA 5I8ZA 4CV2A 4CM8A 2FZEA 1LDBA 2WD7B 3RAJA 4YJHA 5DT9A 3HDHA 4J1QA 4OM8A 3ZU5A 4NG5A 3Q9NA 3AJRA 1LQUA 3GUYA 3UCEA 4KP7A 4RPLA 2DTDA 1Y6JA 4XDYA 1NAIA 1E6EA 1PEDA 4FCCA 4F3YA 2DC1A 4JN6B 3U62A 2HCTA 3PYLA 3O4RA 3WICA 3D3WB 4BOYA 6LDHA 5DDIP 3OIGA 4II2A 4QECA 3MJVA 2A94A 3MOGA 2HMVA 4XGNA 3UKOA 4O63O 3ZH2A 3AK4A 3VPSA 2X0NA 5L7WA 3D4NA 3GVHA 3BHMA 4J4TA 4MVJD 1IL0A 1VL8A 4WLOA 5AOVA 1H94A 4XYMA 2IZZA 4EGFA 2BGKA 2ZK7A 1NHWA 3UN1A 5U4QA 2J3HA 2X4GA 2D8AA 1Q0QA 1AHIA 3H5NA 3HJAA 3IDSA 4R01A 2JCXA 2XAAA 3WIDA 4CM4B 1FXSA 5K6AC 3TFOA 3F46A 1Q0LA 4Z3KA 4WLVA 2OXIA 1W4ZA 5AYVA 1DLIA 1SCUA 4R1SA 2XOXA 2O3TA 3NEPX 3VH3A 2VN8A 3IS3A 4UUPA 1HKUA 2LDBA 1GADO 5I7SA 4JCOA 5FWNA 3WQRA 1HTBA 1PJCA 1UP7A 1VLLA 3UCXA 3CSDA 4RLSA 4BB6A 2C20A 2PV7A 4CODB 3RASA 4E5PA 3FN4A 3HWRA 3F4BA 4LMPA 2ZCVA 3DWFA 5GZ6A 5BR7A 5I9MA 3GC6A 2VHYA 2AQHA 3K30A 4MVJH 1R6DA 1I2CA 1PJ3A 2Q50A 4CMEA 3HSKA 1GY8A 3R0IA 1SZJG 5C3MA 3S2IA 3JYLA 1C1DA 3QVTA 1Q7CA 5BNFA 2HMUA 2NLOA 2OORA 4TKLA 3RFVA 1XR3A 3KBOA 3V2HA 5HS4A 4AJ4A 3H6KA 4C4OA 4ND4A 4PRLA 2EJWA 1KVSA 2DFDA 2W2LA 3ASVA 1UP4A 1KOLA 1YGYA 2J5KA 3D5QA 3PIDA 4BNXA 4F6LA 4CMHA 1R4MB 3LC2O 5HRUA 1WMBA 1ZEMA 3AY7A 2VZ0A 2GLXA 3OH8A 3H9QA 5HBRA 1T2FA 3GH3A 1WWKA 3K92A 4R54A 5T67A 1GEEA 4A10A 3HQ4O 5A04A 1ISIA 5A5EA 1B0AA 2FSSA 4CUJA 1IB6A 2DBZA 3HHPA 4F6CA 3DHNA 4BO7A 1UUFA 3WSVA 2F1KA 4XX0A 2FR0A 3TN7A 5I7EA 3ZNNA 1GAEO 2A9FA 1D4FA 3JD1A 1LU9A 3H4VA 1GZ3A 1AHHA 1CQJA 1A4IA 2GN4A 3DXFA 4D45A 4DA9A 3GDOA 3GA0A 3ZU2A 5DBIA 1LEHA 2NVBA 1M67A 3NX4A 3LU1A 3OJ0A 4TRMA 5CDTA 3ABIA 3W6UA 1UXIA 4IIVA 4AFNA 1Y1PA 2I76A 3DHYA 4IJVA 2NSDA 1FMCA 1YQDA 1VRWA 3DAPA 4GSLA 4WLNA 3WGQA 3MJCA 2DVMA 4ALKA 4DVJA 4QX6A 5JO0A 1UXJA 1E1LA 3I9OA 3W4JA 3WYCA 3UFXA 2VHVA 1OOEA 1T2AA 2POQX 2W8ZA 4EJ6A 1LRJA 1H93A 4R1UA 1ISHA 1KIFA 1Z7BA 3R1IA 5IDQA 2WYWA 2W2KA 1GCOA 1WDKA 2HMSA 2VCYA 3ANNA 3FF4A 4JROA 3SBOA 4PLCA 3GPIA 4BGVA 1OBFO 1LLQA 3DZFA 1A7KA 3ETEA 4DBZA 5JCJD 3QWHA 1G6KA 3WLFA 5IDWA 2AQKA 4R9RA 4Y9DA 3D4PA 2QRLA 4JGBA 4RV9A 1ULUA 4B4OA 2DFVA 2VTDA 4PLGA 3TDKA 4I9HA 1P9LA 3VPGA 3WDSA 4CR6A 1B3BA 4PN3A 1CRWG 2DTXA 4W9NA 3LT0A 4XJTA 3EZYA 3PQEA 4HV4A 5I7FA 2Q2VA 3IJPA 4NJOA 3L0DA 2PD6A 4J49A 4NFYA 4PIVA 3IUPA 1HETA 1P0CA 1DBVO 2Q1WA 2YZ7A 1YL5A 2BF7A 4UREA 4IPTA 1EUZA 2QRKA 3TOXA 5IF3A 2AG8A 1NQ5A 4CUZA 3MEQA 2WD7A 3P5SA 1YB1A 3FNGA 1FDTA 1HLPA 4OHUA 4CMJA 4CLOB 4E4YA 2Z1NA 1EQUA 2EXXA 1GV1A 4RGBA 1ZXLA 1DO8A 4NU6A 3GGPA 4CMIA 2NTVA 1OAAA 3JQAB 5F5LA 3WQQA 5EL0A 1P33A 4FR5A 1KEUA 1N1GA 1XIVA 4RZIA 3D3WA 4EZBA 4YDRA 5I9NA 3BMOB 1CWUA 4GQAA 1BXGB 1PGPA 1RPNA 1B16A 1HLDA 4IY1A 4D3DA 4P4LA 4PG6A 5CFZA 3JD3A 1PL8A 4FC7A 5GMOA 3U4DA 3JQFC 3ZHZA 2XPCA 2EKQA 3CINA 2ZCUA 2VYVD 2JFFA 5F1PA 3AUUA 1E3WA 1D1TA 3EAGA 3IUSA 4WEQA 3W8DA 1K0UA 1GZ6A 4BO8A 1NX6A 3NTQA 3K31A 2GN8A 1GDHA 1V9LA 1VJTA 4D7AA 3U09A 4CLRA 2DBVO 5F1OA 1DIRA 3S8MA 4ROSA 3AUSA 1SOVA 1KVRA 1IUKA 1ULSA 2G1UA 2HKIA 2IRWA 4GX5A 1N9GA 4PRKA 1SEVA 3FPCA 5TF4A 3M2PA 3PHGA 2IDZA 3C3XA 5HA5A 1ZZEA 1DRVA 1OZAA 4U0JA 4UULA 3AFNA 3IP1A 4BGIA 1O0SA 5EQFA 3KEOA 4R41A 2X23A 5IZCC 1PJBA 4M55A 3QWBA 3AI3A 3WJAA 3AW9A 1PJ2A 3LF2A 2Q49A 1E77A 1R0LA 3I9LA 2Q45A 3OJOA 4EW6A 4JBIA 1H9BA 2WEKA 3RWBA 3KETA 4R51A 4J16A 5AXCA 2EWMA 3MCVA 2Q3EA 1HEUA 4FD3A 4IMPA 4B4UA 1NYTA 3ZWVA 4IDFA 9LDBA 4IQ0A 3OMLA 3PHLA 1MC5A 4B7UA 2I5PO 4GWGA 5FEUA 5DF1A 2DKNA 1ZW1A 4OOFA 3SEFA 1YQGA 3SVTA 2CDBA 1JDJA 3KLPX 1BGVA 2PZLA 1BVRA 2HRZA 1QV6A 3EHEA 4W7HA 1JKFA 3FR8A 1XQ6A 3JQBC 5BQFA 4D44A 4OYRA 4XIJA 4MKRA 4BNGA 3GG9A 2O23A 2JFHA 2VYNA 4UVGA 5G4KA 3JQ8B 3CZRA 3FD8A 5L95A 4D42A 5BSGA 4GAEA 1ONNA 4Y67A 1XU9A 1O95A 1HDRA 3TRIA 1Y8RB 2NU8A 2YV1A 3NAQA 4RVGA 1GFSA 3AI1A 3DZHA 3IQDB 3E8XA 3HFSA 9LDTA 4AJOA 4BNWA 2PD4A 1N7HA 4D43A 3NT5A 3FBTA 5DCWA 5JDCC 1ISMA 5AVOA 3T7EA 3EZLA 5CEJA 3C85A 1UXGA 2B35A 1T26A 5LDHA 1JU9A 4YPOA 2FOIA 3DBHB 3EMKA 4O59O 1KVQA 1CJCA 2UVDA 1JWAB 1GTMA 1DPGA 3ZHBA 2BFPA 3RUEA 1FF9A 4WCFB 3GQVA 3E6AA 4YJFB 1U8XX 3QW2A 4Z9FA 2GO1A 4BO2A 4AJJA 4CL8A 1CQIA 3GVXA 2G82A 4INAA 4NR0A 1ONPA 4L73A 4FDAA 5DULA 1IHXA 1WZEA 3K73O 3QHAA 4PLPA 3WX0A 4RVFA 1IY8A 2CF6A 1Y5MA 4BO5A 3BTVA 2E4AA 4J90A 1DB3A 4CM9A 3HG7A 3RC7A 2JD1A 3RC2A 3GOHA 2DPHA 1EFLA 3NJ8A 3E82A 3UGKA 2VUTA 3B1JA 2VUUA 4FGWA 5T8KC 2OUIA 1H9AA 3UF0A 2W90A 2BFOA 3KHUA 3DMTA 4R3WA 4RVSA 4DQUA 1SMKA 2A35A 2IE0A 5TT1A 3E18A 2Q1SA 4GVXA 3RJ5A 4ND5A 1PJTA 4AJIA 3HN2A 1KEWA 3AY6A 5CAEA 3VDQA 1X15A 2PNFA 4DYDA 1C1XA 4K28A 1AN9A 3GLQA 4UEJA 3WGYA 4Z0HO 4BNMA 2P5UA 2NACA 3IIEA 4ZQEA 1QYDA 5IZ4A 4NBTA 1VJ1A 1LBEA 4RORA 3D1LA 4NJMA 4RVDA 3DR3A 1JVSA 3WMWA 3DBLA 4AJKA 3U5TA 4UUNA 4AICA 1MV8A 2RIRA 3CMCO 4U6QA 3RU7A 4I5EA 4BB5A 3DBRB 4AJHA 4L4XA 2QZ9A 2VHWA 3BTOA 4RVUA 4CLOA 1P45A 4FFLA 3RUCA 3ZNQA 4LK3A 4Q9NA 3NKLA 4YAEA 1XELA 5ILGA 1PGQA 4ONEA 3TZQA 3K9QO 4MOWA 2J8ZA 1YL7A 4QFCA 5B37A 4OAQA 4UVHA 1L7EA 1ML3A 3OM9A 1I30A 3DHEA 1I33A 3SXPA 2JCYA 3WNVA 1H6AA 5BSHA 1BXGA 1HYGA 5TS3A 4NBWA 2GERA 1VKOA 1U2GA 1ZSVA 4Y98A 2WSBA 3ICPA 1T2DA 3B1FA 5IAAA 2EV9A 2OP1A 4UAGA 1NPTO 4NIMA 5JY1A 1DC5A 4GL4A 1TEHA 4RPHA 1AXEA 4R68A 1D3AA 3JQ9A 1L7DA 2AE2A 1ISGA 2D5AA 1LSSA 4TKMA 2BGMA 4J1NA 3WTBA 3AM4A 3Q9UA 5AXBA 3AOEA 1T1RA 3JD2A 3NDRA 4CMAA 1EEHA 4ID9A 4ZQBA 1XHLA 4UEKA 4KTVE 3WSWA 3Q6IA 4J6FA 3ZWCA 4YYZA 2Y0DA 1JKJA 5I8WA 5GZ1A 1ZSYA 1BW9B 3NT4A 5B1YA 1M6HA 3TZKA 4J1TA 1DAPA 3M1AA 4IJUA 1E3IA 2NVUA 4Z3DA 4CM5A 3M6IA 1IPFA 4E31A 4K26A 4FJ2A 4FFNA 1E5QA 4FFPA 1CYDA 3PGXA 5DNAA 3C24A 2BFMA 3IP3A 1JVBA 3H2ZA 1UP6A 3G1UA 3V1YA 3GK3A 1W0CA 3GNSA 4F45A 4TWRA 2VNAA 4M54A 3D64A 3U4HA 3A9WA 1C1DB 4L4RA 5TJ9A 1XSEA 4TZKA 1ZSNA 4DL9A 1UDAA 4URFA 1Z6ZA 1E1NA 4W6ZA 4NBVA 1N8KA 3UHAA 2CY0A 4I8XA 2J5QA 4PVDA 1PQWA 1HXHA 1LDYA 3L77A 5GZ3A 3JQ8A 3EYWA 1H6DA 4M49A 2CDCA 1E3JA 4QSMA 1R0SA 5CG2A 4ZU3A 2E82A 3L4BC 2E49A 2BRUA 5JPIA 1XG5A 2ZTVA 3PQFA 1SB8A 4K6FA 1C0KA 4XQEA 1MFPA 1IE3A 1QORA 3COSA 2ZB8A 1V8BA 4QO7A 3LLVA 3OQ6A 1ZEJA 4P8RA 5JYEA 5L45A 1UJMA 3QE3A 2AE1A 4TVBA 1MX3A 1H6BA 1E7SA 1F14A 3Q1LA 3UAGA 4ESOA 2B0JA 3ENKA 3EY4A 1Y8QA 1PIWA 1XWFA 4GGOA 3GGGA 3HNPA 4MKZA 4NK4A 4WCFA 2D59A 3WNQA 4G5HA 1K89A 3O8QB 5TRTA 4E5KA 5HWSA 1O5IA 1ZNQO 4FSHA 2GPTA 4YWJA 4TRJA 1FDWA 3LSYA 3DC2A 3X2FA 2YV2A 5CDGA 2G5CA 3ANLA 3BTUA 4BIIA 2CD9A 3TZHA 2AA3A 5L51A 4CUKA 4YRDA 4I9UA 4UVEA 5JCXA 4RF4A 2VOEA 1CETA 4HFJA 4IZHA 4YCAA 4XQ9A 1LLUA 3RKUA 2J6IA 5FYDA 3ZV3A 4E2WA 5HM8A 3EK2A 1MG5A 1U3VA 4Q39A 2ZB4A 4XRRA 4DGSA 1YB5A 3BIOA 4FIZA 1B2LA 1U7HA 3B70A 4QO8A 2EF1A 2ZYAA 4M89A 3BMQB 3ONEA 2ZB7A 4E2ZA 2RH8A 3KSUA 1YONA 2EERA 5F3RA 2VNSA 2W2KB 3VKUA 2Y99A 1MFZA 1OC2A 4OQZA 1YDEA 1SB9A 1ZUD1 3FCOA 3KV3O 3WIEA 4HWKA 1S7CA 4CPDA 4U5QA 3TOZA 3UUWA 1XA0A 3K8ZA 4GGPA 4OKNA 1HZJA 3Q3CA 4PLZA 2AEMA 3QA9A 3AI2A 2O48X 1B8VA 1D7OA 2GYYA 2NM0A 5COBA 5DP2A 4ALJA 2JAHA 3A06A 3GDFA 3DZIA 1HWYA 1VJ0A 2V7PA 2W2LD 1R15A 4IDAA 5KOIA 5A06A 3OICA 4ZVVA 4NDNE 3IMFA 4OGWA 4YJGB 3SJUA 4LSWA 2WDZA 4E3ZA 5KJEA 3RSHA 4YAJA 4BHTA 1AGNA 1S6YA 5JXWA 4Q3DA 2BKAA 3TNLA 2YQ4A 3B1KA 3H7AA 2LDXA 4BO6A 1CF2O 4E5YA 1T24A 1E6UA 1ENYA 4DXHA 4ND3A 1X7HA 4KDEA 4XD2A 1P1HA 2QX7A 4XYGA 4JNKA 4XYEA 3WR5A 2B5VA 1GQQA 3EC7A 4L74A 1SO8A 2OP0A 2X9NA 2AG5A 1RJWA 4K6CA 2EKLA 4CMIB 5JC1A 4BNFA 4IQGA 4PG4A 3CH6A 1DC3A 4CMGA 4E5NA 2V65A 1I3NA 1K2WA 2RHCA 3L6OO 4BVAA 2NU9A 1VM6A 4A26A 4GPD1 1I0ZA 1HDZA 4EEZA 2E37A 4HP8A 1O9BA 1C0IA 2EHDA 4R69A 3GEMA 4R9SA 5I9LA 1NVTA 1X1EA 1KY5A 1L1FA 4Q3AA 3RQSA 1Q2XA 1B8PA 1O89A 4BMVA 2CF5A 3D7LA 1E3WB 2AQ8A 3JQ7B 2X9GA 3ORFA 4U0KA 1LDNA 2Q4EA 4A27A 4YT8A 5ICSA 4IMRA 4XEHA 5C7LO 3LF1A 1ADGA 2WJPA 2XXJA 4I5GA 2WMDA 3FTPA 2X1HA 3FNEA 3M1LA 4HNHA 4U7WA 4CLRB 3RC9A 5G2OA 5ADHA 2C54A 1TXGA 1N9GB 1LA2A 1TB4A 4PLYA 4RPJA 3DOOA 4WKGA 3VVCA 1MLDA 1BW9A 3PXXA 1AUPA 4FC6A 4RQUA 2NWQA 5G0WA 5JDIA 2Y1CA 2WYVA 2VUSA 3DTTA 5BNIA 2BFAA 4HY3A 1HYHA 1KY4A 3T4EA 1C0PA 5B4UA 3PIIA 4O1MA 2VHZA 4N5LA 2AW5A 3OETA 4QEDA 4YA6A 4B7CA 2PH3A 2DT5A 2C2YA 3F6YA 4HBGA 1R12A 5KVSA 1OFGA 3JTMA 4NNJA 1NPYA 5GY7A 3TWOA 4DC0A 1T2CA 4FJ1A 3RBVA 1I2ZA 4GVLA 1K6IA 1LNQA 4KWIA 4XCVA 1I3KA 2CZCA 1T4DA 4J4BA 3RBZA 2ILTA 3RUAA 4TZTA 1U3UA 5FFFA 3O9ZA 5KVQA 2FRDA 1XGKA 5ENVA 5AQ1A 2X0JA 3C1AA 1YOVB 5L4NA 4OXNA 3NT2A 2NNLD 4EDFA 3F3SA 3ST7A 3ZHXA 3CMMA 1MB4A 5CDSA 3D5TA 1DIBA 4TRNA 1WDMA 3ROQA 3VH4A 5BT9A 1KC1A 5T64A 4ZA2A 5L40A 3BA1A 3N74A 4XGIA 2JHFA 5CEEA 5G4KB 1Z73A 5EESA 4YACA 4PFJA 2X8LA 3INRA 1QV7A 4RDHA 4YT2A 1E6WA 4TSKA 3QWAA 4E12A 1P3DA 5EJ2A 3PVZA 3H3FA 5B4VA 1I3LA 4MVJI 2RBEA 1X1TA 4ZRMA 2C7VA 2P4HX 1H2BA 1X13A 3BMCA 3L9XA 2A4KA 3L6EA 1H5QA 3O8QA 5JBIA 3C7DB 5K9ZA 3G49A 3V2UA 1MA0A 1U5CA 1NP3A 3PHJA 4OH1A 3IKVA 2YUTA 5IJZA 2Y1OA 1P1JA 2PZMA 4BGUA 3FWZA 3GF4A 5EINA 3ZCXA 4YAKA 1BDBA 1GU7A 2ZTMA 2GZ3A 2PY6A 4MVJM 3KYCB 3V1UA 4DLLA 3OA2A 1XYGA 3EVTA 5BNTA 2O50A 2JCVA 1F8GA 3E9NA 2OMEA 3ZWXA 1BWSA 5IG2A 3BMQA 1YJ8A 4J7UA 2Q46A 2YFHA 3KVOA 3F9IA 4N7RA 3ZV6A 1CDOA 1LDEA 2ZJ1A 5JS6A 1K6JA 2HK8A 1WP4A 3FSRA 1TT7A 1UDBA 3GMDA 2NADA 4R4JA 1J6UA 2NQ8A 3VOSA 5A9SB 3VH1A 5TC4A 1BRMA 3KO8A 1JAXA 3GG2A 1LC0A 1Y81A 4H16A 4IXWA 1DJNA 4D0RA 1PS8A 2NTJA 5DP1A 4IXTA 4XR4A 3S2FA 1EVYA 4HNGA 3EVNA 1C1XB 1JQBA 3QY9A 4YJGA 3QLJA 2VYND 2CUKA 1FDUA 3WGHA 2PA3A 1J5PA 3JQGA 1JKIA 1ID1A 2YDXA 5C37A 8ADHA 3ONDA 3PJGA 2BMAA 1UXKA 3WOHA 3WYBA 3QVOA 4NJMB 3KEQA 5B4TA 1U9JA 3DBLB 4KQWA 4BO4A 1EZ4A 5KKCA 3H9UA 4GBJA 3I9JA 2VQ3A 4N18A 4NPCA 3I52A 4CMEC 4WLUA 4FJ0A 2Y1FA 1DAOA 3JYPA 4L9RA 3ZWWA 2R6JA 3JYOA 4BO0A 1QSGA 4DYVA 2HJRA 4QQRA 4DQXA 3LT2A 5HTOA 1GYRA 3S1LA 3INGA 1LSOA 1GUYA 5G0TA 2FPPA 5L7YA 2CFCA 4QXMA 3DZKA 3SC4A 5KVCA 3VZPA 4D41A 4NH4A 3JQ7A 1P1FA 5KKAA 2HJSA 4ZQGA 1XEAA 3OJLA 2CSUA 4J2HA 4CM9D 5LC1A 2ZIZA 5BSEA 1PX0A 1ZO8A 2O4UX 2QQ5A 3KOUA 3WGIA 4BNYA 4LMRA 2BD0A 4E2YA 2GRAA 1RM3A 1ZBQA 1YBMA 1B8UA 1Q7BA 1GL3A 4FW8A 4M1QA 2FWMX 3FNFA 4BKQA 1WVGA 3F1KA 2JFGA 3PLRA 2DUUA 3L6DA 3N7UA 3CKYA 4YVFA 4RLHA 4M87A 4NFSA 1IHYA 2IODA 5A9RA 1PZEA 3WGOA 4KWHA 4BNIA 3I9NA 3VTZA 3VTFA 5JSFA 1YJQA 3JQ6A 3RKRA 1ZH8A 3E5RA 2NVUB 3LDHA 4W82A 4KUEA 3MJTA 1LDGA 3PYMA 2C5AA 1EBFA 2J5RA 4B3JA 1NVGA 1U7TA 2JKVA 1NBOA 3GY0A 2D2IA 1RYDA 1NQTA 2PGDA 3ZWMA 1N5DA 4E32A 1SNYA 4IIUA 5L4SA 2X5KO 3NTRA 3FRJA 1E7RA 2EIHA 1YOVA 3HFGA 2ZQZA 4XB2A 2Q1TA 1P77A 2DLDA 5JAIA 3NDJA 3JYQA 3LK7A 2BELA 3JQAD 2Y1EA 4ZQHA 7MDHA 2O3RA 5EIOA 4X54A 5KJ1A 3ZDFA 3H5AA 2OGUA 3W4IA 4GMGA 2V6GA 3U4CA 3ZHYA 5ITVA 5JCJA 1QYXA 3I4FA 4W9NC 2AEJA 4E0BA 3ULKA 4CM1A 3ZWNA 1MGOA 2X7HA 5ENDA 4BKOA 3JYNA 2H9IA 7ADHA 1RM4A 1PJ4A 3ENNA 1MXHA 3EDMA 2PWZA 4LVCA 2C0CA 3G17A 3PK0A 4PLVA 1Y5RA 1PR3A 1B7GO 2GF2A 2VWQA 4WASA 3WFIA 3IC5A 3BMNB 2PZJA 3DB2A 5TIIA 1EMDA 1EVJA 1BTOA 3PQDA 2X6TA 1NFFA 1Y8QB 1KS9A 2VT2A 2IZ0A 2I3GA 4JJGA 2PKRA 1AE1A 1WMAA 1HDYA 4L75A 1SOWA 3KYCA 1M66A 4WUVA 3WFJA 3I5MA 3QWIA 5L9AA 4BKPA 2P5YA 5DBGA 2W98A 3WLEA 2UDPA 5ILOA 3DDNA 4OXKA 4E2XA 2EEZA 3U0BA 2Y67A 3UCFA 1PS0A 4I1IA 1F17A 3GMSA 3GUCA 2JL1A 1QXSA 3ZWPA 4BS9A 1VPDA 3LLSA 3E9QA 4CL3A 3HN7A 4MP3A 5ES3A 3WG9A 3RD5A 4LGVA 1PJLA 3GR6A 3GRPA 3D3EA 4XZ3A 3V1TC 3WMXA 3LZ6A 1I24A 1UR5A 4IDBA 5A9SA 1HE2A 1B26A 2CVOA 3PJEA 1VE9A 1BSVA 3WYEA 1G0OA 2VYVA 4PVCA 5C7IO 4BL5A 2OO5A 1YVEI 3Q11A 4NBRA 4DRYA 2UUOA 1D8AA 1ENZA 3WB9A 4WJZA 4YRAA 2NU6A 1F12A 1OI7A 1Y9AA 1MP0A 4XYLA 2WYUA 2R00A 4IJKA 4AJPA 4OKIA 2HSDA 1NQOA 4LCEA 3IAHA 3H65A 4CLXA 2QIOA 4XQCA 4CLEA 3QVWA 1W8DA 3TJRA 1R0KA 5ICMA 1U3TA 4I08A 4N5MA 3UXYA 2PGJA 3OQ1A 3WBBA 2P91A 3PHHA 5L53A 5AXAA 2AXQA 2OOSA 3UVEA 3E03A 1GPDG 3FWNA 2XXBA 3JQDA 3UH1A 3EUWA 3GEGA 4N5NA 3I9KA 4OMUA 2Y66A 4Q3NA 3WGGA 5BSFA 1BG6A 1VL6A 3QWFA 1TT5A 2FN7A 2QRJA 4UVDA 4UUMA 4YRBA 4ZJUA 4YQZA 3UICA 5KTKA 5KIAA 3P7MA 2GASA 2O7QA 2V6FA 1UZLA 4N54A 5EQDA 1FDVA 2GZ1A 1HDCA 1A7AA 2DPGA 2PLAA 1A72A 1LDMA 1GR0A 4DMMA 5CDYA 1RKXA 5LCXA 3GHHA 4WOJA 1VL0A 4MKXA 4MVJE 3GAFA 2O2YA 3IL2A 1LTHR 4GX0A 5MGBA 3DO5A 2Y1DA 4CR7A 2OHXA 3JQEA 5F21A 1U3WA 3HDQA 3AY3A 3UW3A 2Y0CA 1GEGA 2I3AA 1V3VA 3DQPA 3GPDG 4Z6KA 3GVCA 4EBFA 3F4LA 1YB4A 3PRJA 1NHGA 2BI7A 4O0LA 4Y6SA 4OL9A 3SLKA 4G2NA 1I2BA 2XF8A 4DREA 1LLCA 5F1KA 5C7OO 1YE3A 2P4QA 1PS9A 1FK8A 5G4LA 3V2GA 5A05A 3V5NA 3DMYA 4S1VA 4AG3A 3BTSA 1HZZA 3RUIA 1XU7A 2OL4A 2E6UX 3PFWO 4LVUA 3RROA 4IDDA 3ZWOA 3DAFA 1H2HA 5DBFA 4A73A 2I99A 4NK5A 2P2SA 2HMWA 1TVEA 1UZNA 4A2CA 3QVSA 4XR9A 3BHJA 2JD2A 1HL3A 2AQIA 2YJZA 3VKVA 3PGJA 1DC6A 1IOLA 5EN4A 2A92A 3JQCA 4NBUA 1J49A 4K1LA 2G17A 1YWGO 4LRTB 4IQ8A 3O03A 2DM6A 3GNQA 4DLBA 4MO2A 4IJWA 1KETA 2BHLA 4E21A 2F00A 3AU9A 1R4NB 2QHXA 5THKA 1Z45A 3DMTC 3ZW8A 2EGHA 1GUZA 3V8BA 4J7CA 4CV3A 1IPEA 5DN9A 1E1MA 1VSUA 5DOVA 5G0SA 3RBXA 3WTCA 4DPKA 1DDOA 2HRBA 4IDEA 1Q7GA 5U1PA 3RJ9A 4DIBA 1PU2A 4R16A 4BNUA 2X58A 5IXSA 1KYQA 1E3LA 3ZW9A 5IN4A 1QMGA 3GFBA 4MJLA 4RVHA 3JCZA 3ASUA 4YQYA 3SC6A 4Y6PA 3O26A 4KOAA 3AM5A 4FS3A 3S2EA 1ADCA 3R3SA 3PHIA 4FFOA 4DC1A 1NR1A 3BMNA 3DFZA 3PP8A 4NI5A 4II3A 3H8VA 1E7WA 3ZNOA 4PCVA 4YAIA 4OIMA 1LX6A 4G65A 3ICCA 1LSJA 3BMCB 4OJNA 3VC7A 4AJLA 3OJFA
chains in the Genus database with same CATH superfamily
4E5MA 1EBUA 2QLMA 2DR0A 4LECA 5H3HA 1H0KA 2DH5A 2XLBA 3R6TA 4NPAA 2NVOA 4V2UA 4BLQA 4XRGA 5C52B 1LVGA 5SY9A 1IBMB 1A9YA 3WAJA 4D9BA 2F62A 2GJ9A 3M9WA 1OX5A 4TL6A 3BAFA 3DV9A 4RK4A 3WGJA 4B1FA 5BYKA 3AYXB 1T25A 2XXAB 3HBMA 2ECFA 4HAZA 3AM3A 2VDPB 4MX8A 3A10A 4N8DA 4ABYA 3NGLA 3B20A 5CEFA 5J23A 2IS2A 1L4LA 4OHOA 5H02A 4ZZ2A 4Y2GA 2QAGA 1P0FA 2PO5A 5JROA 2PX5A 2QJOA 3OPMA 1ADFA 2H18A 3GT0A 5FADA 1T0BA 4I4TA 2CW5A 1W5FA 1X0VA 4YXWA 2WMOB 4JMPA 3MB8A 2W83A 3ZGVA 2PUFA 1BCRA 1HEIA 1W5BA 4W1RA 2CNKA 2YTZA 4X20A 4FB4A 3BICA 1WBDA 3G89A 4RIEA 1DJQA 3SP1A 1HPLA 1G6Q1 1K8XB 2WG0A 4GP7A 5A1TA 2F6RA 4B3FX 1ZUNB 2VSOA 2C88A 4QG3A 3GDWA 3KYBA 3UJBA 1NF9A 3FPAA 3AOEC 3JVVA 3LBFA 2JIBA 5FPPA 2VDOB 4RTRA 4JLWA 1OKKA 4ZOLA 3AB8A 1ZR4A 4K87A 3NMUF 3CV3A 1UF9A 1V1RB 3BRQA 3PPIA 4ZC1A 1XKQA 1DX4A 1GIAA 3X1MA 4AURA 4BNZA 1CR4A 3DBVO 6ADHA 1VI2A 1E4EB 1HZZC 4C7VA 3X1WA 3A1DA 3P2OA 5CG1A 2XT6A 1JG1A 1E69A 2HJVA 1UJ4A 2CMFA 1UQTA 5A62A 2ECKA 3JY6A 1JWBB 1QIKA 3RSSA 1JDNA 3AZPA 3FPLA 1M8FA 3IXQA 4ID3A 4K6MA 2RAPA 2HIMA 2FZLA 1NONA 2W0MA 3AWDA 2G9RA 3HKBB 4UHCA 4IFBA 3L7CA 2LD4A 2FLVA 4LISA 1E4YA 2R68A 1C9YA 4QPJC 4KR6A 2C4KA 2H5JA 3CTMA 1UKZA 3EVZA 1RHJA 5FBHA 3PI7A 3SHOA 1KFEB 1E5LA 2AN5A 3THYA 2QSJA 4DV0B 3V34A 3LL7A 2OAP1 1UBHS 2WM3A 3MJEA 4HQOA 4IGIA 4XTCS 1QZUA 4EUHA 4GVPA 4EUEA 3VNVA 2GVZC 2A5LA 3UK2A 2C59A 4NTZA 5K6RA 2HH9A 2LCFA 3L3BA 1QAOA 8ATCA 4OXRA 2CJYA 2WB2A 3QBEA 3NYWA 3TIGA 4LV8B 3WC4A 4AUEA 5BWOA 3RVRA 4HDSA 1PD0A 4RELA 4Y9TA 2J48A 1IC6A 1BS9A 3AHFA 3E27A 2QXUA 2I54A 4H6XA 4MULA 1ZIDA 1EESA 4YRJA 2DBQA 4J3FA 3LO5A 1IAQA 1OB5A 3BIFA 3GJ8A 1YC2A 4ESHA 1YIDA 4FYMA 1A2OA 5HZMA 4D9EA 5T4BA 4PG8A 4EWLA 1W0JD 1VBMA 2OHHA 5IH3A 3STTA 2DUJA 4K2HA 1CQZA 5ARCA 2B9VA 2WSSA 4L5YA 5IJXA 2DFTA 1UBGA 1XJQA 3PIRA 1CY2A 4X93A 3GMTA 5CXSA 4EPWA 1P2DA 1YZQA 5BQPA 4PS1A 7REQB 4UQLA 2NZYA 4U7DA 4RDIA 2IS6A 2HJHA 4GKKB 3IALA 2JGDA 4GI1A 1A9TA 1CJSA 2PXAA 2YFQA 4RGVA 3CS3A 3K9GA 4FMCF 3WK6A 2VBGA 3O21A 2PYZA 1RM5A 1M1NB 4I1VA 1B73A 4ER5A 1IVNA 3DPSA 4BVJA 2PUTA 2YJ6A 1FNSA 4I50A 4KU4A 3RRMA 2X8JB 1KEVA 4KV9A 2V8OA 3DWGA 3NOXA 1TUBB 1FYWA 5K45A 3FMGA 3P9PA 4UATA 4ZIRB 3IESA 3LQFA 4F1JA 8OHMA 1TI7A 4AK9A 3OZIA 3DAGA 3N2GA 3GIWA 4IOMA 4H7JA 3PDIA 1P31A 4B7ZA 1FLAA 1GFWA 1L8QA 4U00A 3ELWA 1VYVA 3FYSA 1R9GA 3R4CA 4GOJA 2GD1O 3RREA 4AQ7A 4CDMA 1Q2UA 1GQRA 2QU8A 4GXRA 4NNOA 1ECPA 4KK3A 3JASB 3PQ3A 1PKEA 1EFPA 3BE5A 5K09A 3A6DA 1KP9A 2CL0X 2RJNA 5TSDA 5ITZA 3PRHA 4AZWA 1BXZA 4NYIR 3EF1A 4JJ4A 4ND6A 5JSZB 4ZVLA 2V7WA 2D4AA 1J99A 2YDYA 3C5WP 3EZ6A 1RHMA 1ZITA 3JZMA 3KEFA 3OZUA 1WUIS 4AUNA 2FU5C 4KMSA 2JGKA 2DQ4A 2QYOA 5K6TA 4BEVA 4ZHQA 4PC7A 1TM3E 2JD0A 1PZFA 3NLLA 4WV3A 4A9AA 2B4TO 3EZNA 3GLSA 1YR7A 3SI7A 2UYHA 2XWQA 1QIJA 5JZSA 1BE8A 2XKAA 3CLSD 4UU7A 5ALMA 1DL5A 5K0ZA 1MEEA 3E5HA 3FI9A 4ZAGA 3ZX5A 4EHDA 3ZYCA 2C7OA 4WESA 1WY5A 5DSZA 3QE9Y 3M4XA 4ENTA 3NYIA 2BZ1A 3G0OA 2WUGA 5CA1A 3K0FA 2YVLA 3S1AA 5IABA 1U2DA 2HU8A 1ZN9A 3O9VA 4JX8A 1KE2A 3CF4A 2BOVA 3DA8A 3K1JA 4WKNA 1DRUA 4LY0A 1K98A 4GP6A 3SJZA 1RM0A 4RCZA 1VPWA 2X9VA 2PUDA 2JRLA 1XFAA 2XGGA 3COJA 4G5RA 2QTLA 2ZYGA 3Q87B 5TGDA 3TCNA 2E9SA 5KYVA 2OPBA 4B5LA 3DZGA 3L40A 2HAEA 2F4NA 1ZMXA 2C42A 2C8KA 3BB3A 3TLXA 3Q7TA 4MRRA 4WXPA 3UKDA 3VVLA 1CD5A 4N41A 1N0UA 5CPBA 1TTHA 3EPPA 5EXSA 5A3QA 1SM4A 3O3NB 1Y3IA 5EUQB 2VDVE 3CZ4A 4TROA 3QJGA 2Q5HA 2QTWB 3AVQA 1E8MA 3K20A 4QGBA 4RD2A 3U7RA 5FTLA 2GHRA 3L43A 4Y2XA 3DULA 3ZD7A 3AHIA 3VI3B 4RY0A 5LR6A 2FZKA 4ZGBA 2VJDA 1CBUA 3IQEA 4KQKA 4FPXA 3DV2A 4Q7JB 3K2QA 4PX5A 4B3IA 3GU3A 3FIUA 1WLYA 3TR0A 1Z4IA 1WEHA 4K6HA 1P1RA 1WAMA 2HW8A 5C46F 5JG7A 1JAYA 1YBAA 4PC2A 3PJFA 4FWIB 1RWMA 2PZGA 3BZUA 3A4VA 3DC7A 1KHTA 3FCAA 4BDTA 4EY8A 3LQ4A 1L5MA 3RAGA 3S44A 5LB4A 4ARVA 2Z8XA 2FKNA 5T6BA 4OLFA 1CJBA 3B85A 4OQQA 3OKFA 4QIHA 1WTAA 3A7DA 2A59A 4TWIA 3UOAB 1W34A 4DBLE 621PA 2ZPUA 2A9PA 1JLMA 4O6VA 1DQRA 3A6KA 2PH1A 1LPMA 4D25A 1YCDA 2Q4TA 1YRAA 1QGAA 2WJZB 1K9VF 2FPGA 3EDQA 2NAPA 1KVUA 4G3XA 1MG0A 4I5FA 3NTUA 1GRRA 1RQ2A 2HRDA 4K9QA 3RVPA 1EHCA 1TTPB 1L5RA 1W94A 3I6MA 2N47A 4C0JA 5BPFA 3PR2B 4G8BA 4F92B 1VCIA 3A1VA 4HDMB 2GHIA 4HFMA 4WVFA 1V5WA 1QYWA 4JOSA 5B3JC 4UBMA 1PJRA 3EAQA 4OGGA 3TMKA 3Q8KA 1ZAYA 1XDDA 2O3JA 3TQSA 2O7RA 4IX1A 1E64A 1EFCA 3DWEX 1JILA 3TW0A 1W36C 1SG0A 1E94E 1MO4A 3TM5A 4MVJG 4G97A 4OBWA 4MINA 5MFPA 1BKYA 4FDLA 4NV0A 1V48A 3DDSA 3QEOA 4N3BA 4BV8A 2NUPA 1P73A 3O8BA 5H16A 4DCGA 3ISTA 3LC1O 3NWBA 1VHTA 1QQ7A 3QQ5A 4H4EA 2X77A 1BD3A 4TX1A 1L5KA 4DA6A 1D6SA 1HDXA 5EA2A 1SRRA 3K0EA 4NHEA 3E81A 4MUNA 3QLUC 3TUIC 1LUAA 4WFKA 4GLBA 2IXGA 3BE4A 5FOXA 5A03A 1R9JA 1KY3A 1SXQA 1TK2A 2M1XA 3R3WA 4GPZA 4JP5A 2ST1A 2A86A 2EVWX 3BBLA 3AP1A 3D3NA 2C29D 1LV8A 2WHRA 5BXQC 5AOCA 3I4CA 1FSZA 3RYIA 3EC2A 3G8CA 1QGED 3H4TA 2KE5A 3I05A 4OP3A 2JFOA 4YLGA 2B2CA 5JCPA 1YDHA 3M4YA 4BRSA 1NF8A 4UARA 3HWSA 5HBGA 4BLVA 5DN6A 4LGCA 1DGQA 1GNSA 2GS9A 4M9SA 4QTTB 5D51S 1UDWA 2BI8A 3HSYA 4HPJB 4IHJB 1UDCA 1W0KD 4W5JA 5GP1A 2OCAA 2P4UA 5DI3A 3I1YA 1HC7A 1CJMA 3JATA 1X7WB 1A04A 3CRW1 1E2QA 4K0RA 4OHMA 1BRTA 2FFAA 4NE2A 5K0LA 1OXXK 1EDDA 3NGXA 5AKIA 2ZSDA 1UZMA 3EW7A 4YT5A 2AG0A 5DM2A 3E22B 3UA4A 4GNRA 1IZ0A 2GH1A 1NGSA 3TSCA 5TF0A 3CUWA 1HY3A 1YHYA 3QBDA 3SNKA 1U7UA 3U49A 1JIXA 4C88A 3P96A 2XCTB 5EJFA 1FSFA 4IW3B 1AKNA 1N5KA 1G1AA 1N2IA 2IY9A 5J4KA 3HMKA 1PE0A 1OD6A 3RFUA 4K9MA 2JAPA 3PTZA 4IAOA 1SJ9A 3ADOA 1FJ2A 1NATA 4KK4A 3G1TA 4FKMA 2HTEA 1Z4KA 3TI9A 4RJKA 2JA2A 3K9LA 3UV7A 3ZDQA 3KTAB 3EDRA 3SAJA 1Z4NA 3DVAB 3R7FA 1P3Y1 3SS9X 2C9DA 2KI5A 1C3OB 4YBRA 5JW6A 3OCYA 3B52X 2PBLA 1W4LA 4NEGA 1XCJA 1M6YA 2ONZA 4NC9A 4LQCA 5GTDA 2Q0HA 2PUVA 1K6XA 1UK6A 4X1IA 1X9HA 3BH7A 3H9EO 2X2PA 2DETA 4TOIA 4B45A 5BWNA 4AJNA 1E0SA 1KC3A 3VX4A 2YRFA 1OYWA 4FCWA 4GI2A 3UBTA 3ZU3A 1KBZA 1SC6A 3WGVA 3AKYA 5IWAB 2I0FA 1YF3A 1QKJA 3E9DA 2HIHA 4MQFB 1QLHA 2IF0A 1GA6A 1ZC4A 3INTA 5LNK1 4AL4A 3UJNA 1S4MA 1CEQA 4Y1FA 2ZVJA 3RJZA 3WGTA 5DT2A 3F47A 1V6AA 5IANA 4U6NA 3GZJA 4DM4A 3KM0A 1GV0A 1TK9A 3MZ0A 3GLHA 4PZCA 4WECA 4CMKA 1NWCA 3A11A 3BCUA 5HS6A 1ZWKA 5IM4F 1YACA 1RKQA 4KXXA 4YRTA 2K2QB 2OD7A 4CU5A 2PFGA 5JJIA 5EE9A 3IBTA 1HF3A 1OY1A 3NNNA 1XE3A 4TL7A 4O5OA 2QD1A 3FHLA 5GIOE 3PXGA 4JJFA 1E2EA 1OROA 3TD2A 1I4LD 1R4MA 4QPNA 1DQYA 3F5DA 3D2AA 4JD5A 4EVQA 3B9BA 2I22A 3LGSA 3VJKA 1YQ9A 4MRPA 4WPGA 4LUCA 3SHWA 4BNNA 2A1TS 1SHLA 8GPBA 1U6IA 3L1IA 3W9UA 1LI5A 3BHIA 4L8VA 3QKTA 4AMUA 2Y4NA 4JOQA 1QKKA 1VLVA 4ZVNA 1KJJA 4BV9A 2HA5A 4KPGA 3W3AH 2BGLA 5CIYA 3T3OA 2M6KA 2WD9A 1ZGAA 1KJYA 1FRQA 1ZYUA 2V97A 3S5UA 2VL7A 1JG6A 3OQBA 3P2YA 1DRWA 3CF0A 3TNFA 1JECA 4BZPA 2GUGA 4PPNA 1OIXA 2HZBA 4B2PA 4ZD6A 3N3AC 1MPTA 4B6JA 4AVYA 1MC4A 4B4KA 2VAVA 5CLGA 721PA 4QLAA 2Q1XA 3IEIA 4MJXA 4BQSA 5KTTA 1SA0B 2FSVA 2G77B 2OBBA 1RWBA 2XRYA 2CXRA 2ZOSA 3K2EA 3MBOA 1UZAA 4MV6A 4NAVA 1DZ3A 1CR2A 4LJRA 3IYLW 3GFRA 3CE6A 1R8SA 1ZUIA 3SC3A 3HDYA 4AZ3B 2XMSA 3GFGA 1HE1C 1XRQA 5H82A 3WMGA 5KYWB 2A4MA 2CHUA 4MUMA 1PEYA 4M4SA 3UV6A 6YASA 1SUFA 2YCBA 1BVUA 1YDMA 3I37X 4QLOA 5HVNA 4KN5A 1YB2A 4GLLA 2HLDA 4M98A 3ZQ4A 5AW8A 3ZWYA 2B6HA 1L5NA 5LMZA 3E9CA 5JMPA 3MQ2A 3W5UA 3E9MA 5DE3A 2HWKA 2CK3A 2YMLA 4PTZA 2EGGA 2QU7A 5TJHA 1CIVA 3SMQA 5K0BA 3SJ7A 1POXA 4GSKA 2YX1A 2IEBA 4KWEA 2FEKA 1GQYA 3A14A 1HSOA 1TF7A 1L9XA 3RASA 3FVRA 3RS4A 3W9YA 4MGIR 4OJMX 4PFKA 1C4KA 2MINA 1XKXA 1I9GA 1KBOA 4IBOA 5BMVB 5TPZA 2CEKA 4WNAB 3WE7A 4UDOA 1CP3A 3C3PA 2QD4A 3RG8A 4PQGA 1JZSA 1F0YA 2JHAA 1JBEA 2QLJA 3CLHA 4H3VA 4IZIA 4OJKA 1KO4A 4NZ9A 3C6BA 4IMIB 2IUSA 5B58T 4ILEA 3V32A 3DPIA 1J25A 2JJYA 1U1GA 3V00A 3K70C 5FQNA 2RHOA 3CWZA 3VDRA 3VVBA 3L4BA 2IZOA 3R9XB 4DDTA 2Y93A 1OF1A 3MT8A 5EWLA 2VHXA 1BVYF 3U7QA 2X5NA 4K86A 5C5DA 5FUYA 1P8AA 3PYXA 3ZE7A 2OGWA 4BTVA 2V3VA 2GCIA 1W44A 2QVBA 3PGLA 1UJ5A 1GHTA 2YBEA 4QUIA 1ESCA 4BO1A 3ZY4A 1L4KA 2VF8A 1AXGA 4HXYA 1P9NA 1Q5PA 2GARA 3IMGA 4HBZA 4BVHA 4DPMA 1PHRA 3MOIA 4CHGA 2JIOA 2PX4A 3VOAA 1CLEA 3W6NA 2AOXA 4ER0A 2HNKA 3WLTA 2JEYA 5D3KA 5JNLA 5BN1A 4EARA 1V7ZA 1FDRA 2W2VA 3AEQA 3DZCA 5ER6A 5GGXA 1BFUA 3IDOA 4UTPA 3SKVA 5LLTA 5FBWB 1JTVA 1QHHB 5CTJA 1M1UA 2IYFA 4XSHA 3M5WA 3TZ6A 5IXYA 4I55B 3PUZA 3BILA 4K9DA 3TK1A 2H2IA 4QJ3A 1CERA 4KE7A 4CXMA 2H0RA 2UXDB 4IH4A 2D7JA 3BMOA 2IYZA 1PJSA 2JGLA 4QWMA 3GJZA 3UMVA 4BGEA 1QFXA 2SCUA 4NV3A 1AUXA 4KGXA 4M9QA 4TWBA 5E6SA 2XRMA 2IFTA 4DIDA 4ITUA 1UOQA 1P1IA 2ZANA 1L4BA 4RLQA 4W8HA 1V1MB 4O25A 2H48A 3ROEA 3VRHA 1SHUX 4HGZA 2BHNA 1TKBA 4HRVA 5D87A 4MHOA 1JXAA 3Q3EA 3VGPA 3IKTA 2H6EA 1Z0UA 2FRXA 1RZVA 2VWHA 2WAYA 4PG5A 1FZQA 5K03A 1HDGO 1JHVA 1OKKD 1TO6A 1TQ4A 2OXFA 4UUQA 2A67A 2HQBA 3JSAA 4QYSA 3W4KA 4X92A 1X42A 2NYRA 3MAGA 3TVTA 5JRJA 3CW8X 1KI8A 3CXRA 3QXJA 4HT3B 4TV9A 3KSBC 4A8PA 4MQEA 2H85A 1UXOA 3R5KA 4RTNA 4MYSA 2YRWA 1AQJA 5JSHA 3FTFA 4R8MA 1JRLA 1R6VA 3AF0A 4RK7A 4MWBA 3IIJA 4MZXA 3TLYA 1XZEA 4JV5B 3PTAA 1GT6A 1YI0A 3K5PA 1OXVA 3CPHA 4UVIA 1X7GA 4BUCA 2QMZA 2Q9CA 3QJ5A 4O4LB 4TL8A 4ENUA 2GRUA 2VQSA 5FUBA 5SZKB 1JPVA 3K09A 4UU1A 1Q91A 2EJBA 4ZWNA 5CHEA 3RUPA 2FA9A 1QP4A 1XNRB 3Q7EA 1SCNE 3DOFA 1T9BA 3REOA 1J56A 2PV0A 2Q4BA 2H2HA 4ALLA 4TTTS 4ZREA 1DFHA 1Q19A 4W99A 4DVGA 3JRWA 5IUJC 2NP7A 1D2HA 1C30A 2QTMA 4KQCA 3MK31 3KALA 5JRZA 1Y6FA 2PGLA 5DIFA 4RVOA 5BYBA 3GLTA 2Z30A 1RBQA 3EOAI 4QULA 3E7PA 1LJLA 3Q3GE 5L7TA 5CT5A 4UC0A 3H0EA 2QRVB 4CLHA 1EVIA 2ACEA 2JVKA 2ZIGA 3EH2A 3TECE 5F98A 1NNLA 2IYQA 4LGMA 5B1SA 4B3TB 5ALJA 2YWDA 2ZS7A 3V3TA 3DKPA 5DRTA 3QIVA 1AT1A 1NBHA 5AFSA 1OXUA 1DFGA 3FGPA 3W3ZB 1N5JA 4CCYB 1T1SA 4F8EA 1R8QA 1ACJA 2R00C 3E3NA 4BE4A 4G1MB 3W8NA 3BXXA 4C04A 4GMXA 5IBRA 1RZ3A 1XI2A 2JVJA 3E1SA 4KZKA 1QIDA 3L7LA 3C3CA 2IV7A 3LAWA 4JWKA 5KYUB 5LYJA 1ISFA 3JS5A 3NWPA 4P31A 4U3JA 4JI8B 2VVTA 3KXDA 1PGJA 4KRYA 4MKIA 1F0KA 1QC5A 1E3TA 1PWXA 2XIJA 2WSSD 3LT1A 4HDRA 2W70A 4BNTA 1T13A 3DOUA 1YUMA 3M5DA 5TMBA 1H22A 1Z33A 4HWPA 2ORED 4IIDA 5D5PA 4X91A 1G21E 1J2YA 3P26A 1QLWA 4B3MB 1N6NA 5K7SA 4MKFA 4XLZA 3PR1A 1U0EA 2AJ8A 3T7CA 2Q5JA 1Y8RA 5IVIA 4UTRA 2I6XA 4RMGA 3T15A 3A1NA 3KXIA 3BD9A 3O8OA 1FNNA 2SKEA 3TW4A 1ZOIA 5LMNB 3RVNA 4BMZA 4EW2A 1C7ZA 2ATVA 2GFHA 2QZSA 3A36A 1N32B 1O94A 1QOZA 4EO4A 5A0VA 3CUVA 1GJRA 4Y2YA 1XMQB 2WIAA 1GZ4A 1LFDB 1FUIA 3ELDA 3ZY6A 4C0WA 3WA7A 5F2KA 1SY7A 3IVXA 4TL9A 1J20A 4Y0AA 1XZKA 1T1EA 2WIGA 4OJYA 4TSFD 3FOFC 3T94A 3JWGA 4AS2A 1KQOA 4CIBA 1IVSA 3P9ZA 2YVUA 3QVKA 5JBNA 3OQNA 2BSQA 4OL0A 2GNAA 1ZXXA 3N0RA 5FI3A 5EERA 3ZW7A 5HFAA 1Z63A 3HZHA 5LQJA 2PR2A 2NV6A 5CDFE 2BC9A 2JVIA 2MSEB 3K1AA 4BFCA 4IDHA 1H5UA 5EIWA 5LVAA 1FFAA 3AOGA 1XDWA 3MWDA 3QYPA 5U9CA 1QGUA 2FOXA 1KI9A 4R84A 3F5QA 4WEOA 3OZRA 4GMFA 1U4OA 3TTTA 2H07A 5HQ3B 4C2UA 1Q50A 2HUPA 2A0XA 2XMZA 2AZMA 1P1KA 4BFSA 2J3DA 4H7DA 2GBLA 1JEEA 4IDQA 5KQPA 1EFAA 2PJRA 5DMHA 3L07A 3UOWA 2NV0A 4L8YA 2NZ2A 4GZ6A 1HYBA 2BGRA 1G4UR 3E48A 4UU8A 2VP0A 4D5GA 1UK9A 5LZ7A 3SZMA 1K3FA 1R88A 3FCYA 4GPBA 2Y1GA 2OAGA 1QWSA 4KYVA 3KJZA 2Z57A 3RF6A 2QYTA 1N2JA 3B6ZA 1M5RA 4I4CA 4ZV9A 1Y1TA 1HEYA 1UH5A 3AM1A 2J31A 3C6MA 4KFUA 4B17A 4PYRA 2YASA 2GX6A 3LHSA 5CYFA 4QBKA 2JGJA 3T12A 1EK2A 3Q41A 1T0UA 1W5TA 3OU2A 3IULA 4KQ2A 1FBTA 4FGUA 4YP9A 3ZJVA 1KI6B 1MDBA 4L76A 2VTBA 3G2LA 4M8SA 4MV3A 4Q1BA 5K0TA 5ALNA 3RUHA 1PNOA 1FXWA 4JEUA 2J46A 4C4XA 4CT4B 3MFQA 3H9JA 2PIAA 2WSYB 1K97A 1KAQA 1WDTA 2G8NA 4HX5A 4ZI7A 3GDGA 4LC9A 2XVAA 1Y7PA 1OHHA 3TPFA 1EUCA 3F49S 3NOVA 4CM8A 1U63A 1M7BA 1OLUA 5CX1A 6CHYA 4YJHA 3VDMA 3HDHA 4J1QA 4MWTA 4M22A 4EA8A 4LRQA 2O8FB 2GF0A 2Q8PA 4YK7A 5HGXA 3GUYA 5L3VA 1XMIA 1EB9A 4NESA 3UCEA 3GMIA 3HVHA 1Y6JA 2GM4A 3H3XA 5E6UB 3ZGZA 3VR1A 5FWXA 5CLIA 3QFSA 4DBLC 3NIGB 4EDHA 2HLHA 1OXSC 4HN4B 1E2LA 2HCTA 4JLBA 5FV4A 3UK1A 1QYIA 3D3WB 1MJFA 3BK1A 3OIGA 2JBWA 2G9QA 4II2A 4QECA 4DLZA 4IHJF 1AZTA 1TJ3A 2Q21A 2OTCA 2HMVA 2Z83A 2Q6TA 3UKOA 3G85A 2R25B 4O63O 5ERGB 1MR3F 2DPYA 3PX3A 2GBGA 5IYZB 2R86A 2HYIC 1WL8A 3COWA 5CBPA 3BKXA 1ZISA 2FXVA 5T41A 1EPUA 3QGMA 1W4RA 3QH4A 3TSOA 1ZWLA 2E21A 1PHPA 5BQOA 1VL8A 4WLOA 3NHAA 4BUZA 4PNHA 4CHTA 4MLCA 1H94A 2D2VA 1V5EA 4MTLA 4P3YA 4EGFA 4ZDIA 2BGKA 2ZK7A 2H4JA 2H11A 2AMJA 3KR1A 5JZOA 2BCEA 2CV2A 1AHIA 2BY4A 3HY4A 3IDSA 3OE4A 2OECA 1JI0A 5B5SA 4Y0VA 3F46A 3HUEA 3A4TA 2OXIA 3ER8A 1W4ZA 1PSZA 1G5IA 4EH1A 4R1SA 1H0SA 2XOXA 3WK5A 8AT1A 3MMZA 3GUZA 2XHZA 4BFXA 3MMPA 2AWOA 3T0FA 2VN8A 1SCDA 1H0HA 3IS3A 4QAJA 5CXXA 4B2LA 4C4SA 4JVSB 3HCAA 4JCOA 5BN5B 2GMWA 4GRAA 3WQRA 2QX6A 3ETNA 2P9BA 3IXMA 4HAYA 5HJ2A 1UP7A 1UMCA 3F5FA 4DM3A 3CSDA 5J3JA 1RBZA 4BB6A 2PKXA 3GWGA 2PV7A 4MJ7A 4QA9A 2X6RA 2CDNA 3VZBA 4MYHA 3F4BA 5AVKA 5GZ6A 5KOJA 1E2KA 1S8AA 1I7SB 1DQPA 3O3MB 5AVJA 2FK7A 2Z04A 2AQHA 3P0EA 1O97D 4P53A 3PE4A 1LS1A 2Q50A 4CMEA 3HSKA 1IHUA 4M46A 1SZJG 5C3MA 3JYLA 2PA0A 1DI0A 2QG9A 1XTRA 3M6WA 5H4HA 1PV2A 2CB9A 3HEMA 3V2HA 4JUCA 1S3IA 4D9MA 5HS4A 3UM9A 3H6GA 4NECA 3LG2A 5DN6D 5TXGA 1Y5IA 4DCPA 3QU2A 3WK8A 3ORHA 3ZZTA 3BORA 4C6RA 2EJWA 5C4MA 3PENA 2QUIA 2DFDA 2W2LA 3ASVA 2HBRA 5TARA 2J5KA 1HE8B 1I5OA 3D5QA 3TUJC 4JUFA 1MN6A 1WOMA 3R41A 5IS2A 2Q7XA 2YHSA 4ZCLA 5HRUA 1ZEMA 4Y7DA 3IO3A 2XB4A 2LW7A 4G0XA 3OH8A 4EF4A 5HBRA 5B7GA 4GECA 1GKLA 4KKXB 3SEZA 1P80A 1T2FA 5T67A 1QHEA 5A5VA 4IYRA 4BBZA 2WICA 2SHKA 4A10A 4BUJA 4JSYA 4CEIB 2P41A 4N3NA 1XK7A 4FIDA 2OC9A 2ZUBA 4PANA 5IH7A 5B1HA 3TS1A 5A5EA 5FHRA 2MJLA 5DSXA 1EEXB 1CUYA 1XZGA 2HRQA 2JFVA 4EVSA 5BOSA 3FG9A 3OOYA 3UWOA 1UUFA 2F1KA 2FR0A 2DFKB 4R98A 1JSRA 3ZNNA 1PF7E 4PZLA 4PCAA 1E4VA 1D4FA 4OHBA 3J81k 1LU9A 1N3YA 1QF7A 2AMYA 3EISA 1YS1X 3VHLB 3DXFA 4Q5IA 4D45A 4P3OA 4EI7A 5FTJA 4TKVA 5EIXA 1LEHA 5ALKA 2RGEA 4TRMA 3W6UA 4F1KA 1WMDA 3VDNB 1V2GA 1UBTS 2H1IA 1CUSA 3P2JA 3R6WA 4G25A 5GJCA 2NSDA 4MVWA 5B6JA 6AT1A 1YQDA 1FYXA 1CQIB 2OHOA 1Y33E 4GM0A 1G8HA 1L8XA 2ZR0A 2V1UA 3MJCA 2DVMA 2CLSA 1O0BA 3DGEC 4KYUA 2VQFB 4OP2A 3W4JA 4JX9A 1ZI9A 2AUMA 3CLRC 3KWMA 4HB3A 3AGPA 4K3UA 4QTUB 4U7TB 5JCOA 4R7GA 3STUA 1Z7BA 2WYWA 5FH9A 3KJQA 1CUAA 1CQXA 2VHEA 5DNUA 2VCYA 3G6WA 2C95A 3IMCA 4DEYA 2EF0A 4JROA 2PN1A 5FORA 2F1IA 3P4YA 5AOBA 1ECLA 2P0YA 1NY6A 4K9OA 3DZFA 2ID4A 3ETEA 3HCBA 4DBZA 2XDYA 4L6AA 3QWHA 4ZYWA 3ZX4A 1OBCA 3AF2A 2FFHA 1EYZA 1ZU5A 2VO1A 4Y9DA 3RVJA 3G5AA 4FUQA 2QRLA 4JGBA 3EGDB 4RV9A 4HZGA 4Z7OB 4G5GA 1ZLXA 5DVZA 2KJQA 4RIIA 5K01A 1RVDA 3P0IA 4ZCPA 1GNVA 1T5SA 4PLGA 4RFSA 5BMVF 1TFRA 4BKMA 1P9LA 2YWRA 3VPGA 1I7LA 1QIHA 4H9GA 1X7YA 5CVVA 5HF9A 4ZYYA 4W9NA 5EHXA 3TSYA 3LVQE 1AK9A 1IQ0A 4EGJA 3LQRA 4TVKA 3G2MA 2Q2VA 2WWTA 2WM8A 2WB4A 4KMRA 5C8VA 1JSLA 2O0MA 3T1QA 1AS0A 1YZNA 4NFYA 4PIVA 3IUPA 4MDFA 3OY2A 1MAAA 1QJCA 3JVIA 4E3WA 5B1DA 3FI0A 4JC0A 2YC2C 2AYZA 5FJIA 3QKSB 5WRFA 2BF7A 1T43A 2FXIA 1II0A 2FGKA 4UNPA 2JFBA 4S0ZA 5I9SA 2R5FA 1EUZA 1UPUA 3T9CA 3TOXA 1JQ3A 2V6IA 1NQ5A 4O3FA 1W2HA 1NVAA 3U1VA 3SIRA 4G0UA 3UT0A 1YB1A 2YNMA 3C8UA 1CJVC 1MORA 4CLOB 4URZR 2Z1NA 3D6MA 5BNWA 3EPHA 1EQUA 2HT6A 3W9SA 3PX7A 2JGIA 4NU6A 1G3RA 3GGPA 2WVAA 3ACDA 4CMIA 1G8JA 3U37A 2NTVA 1AO0A 2QTBA 4B3XA 1TYCA 3O93A 4B80A 1U28C 4FE7A 5F5LA 4TXLA 4EFLA 2W4MA 2OY0A 2QVCA 4G01B 3MMSA 4D4MA 1XIVA 1H23A 4RZIA 1NMXA 2ZETA 1H2EA 1S2IA 2JIRA 5I9NA 1CWUA 1FTQA 1Q0ZA 4GQAA 1A9OA 1WCIA 4OQ4A 4DJEC 1PGPA 4FYXA 5KQSA 5H7XA 3COZA 4P4LA 2B2NA 4RS4A 5JANA 2NUAB 4I55F 1X9GA 4MB2A 2BKLA 5GMOA 1N6OA 1MQSA 3NV7A 3VU0A 2HLDD 3DEFA 4Q4AA 4TN1A 3VBCA 3LYHA 2XPCA 2EKQA 3KX2A 2Y71A 2RK3A 2EAUA 1KYXA 3Q98A 4KXYA 4D74A 4RFLA 2CK3D 4UDXX 3Q3HA 5BP7A 5CITA 4WEQA 1S3FA 5IBPA 5I6DA 5KPDA 3HO1A 2A57A 1IEXA 2XQIA 3U6BA 3AR6A 1NX6A 2HCFA 1ZN2A 4EQZA 3UWDA 1V9LA 5AJXA 2AJDA 2JAOA 2L82A 3WRYA 2VDNB 4ROSA 3AUSA 1CS0A 3D8HA 1KVRA 3P9KA 5TPZD 2PKYX 4X7BA 1KFKB 1O1YA 1SUWA 1SEVA 1V7CA 4U39A 4WJKB 5ALQA 5BT8A 1C29B 1Z25A 3GLKA 4OBBA 2O1SA 4CCWA 2VKTA 1OZAA 2JH3A 3BWVA 2H8KA 4Y2UA 5ICEA 3IP1A 5LJLA 2YS6A 4D8YA 2CB0A 2CL5A 4Z9BA 5EQFA 1INLA 2P78A 2QNRA 5CVUA 4AKSA 4X1KA 3UJHA 2PYDA 1PJBA 1CY0A 1OU0A 3PX2A 1XXHB 4N65A 3AW9A 3RU3A 4BCDA 4TTSA 5ESWA 1EUQA 1PWHA 3FLMA 1K8YB 1REQA 3CNHA 1E77A 1TYZA 1Y8AA 4LE1A 1AUOA 4EW6A 1OQAA 1HQYE 1YZHA 4JBIA 4LHSA 2JH8A 1Z18A 2WEKA 5HMLA 3DJYA 2CV1A 4MVCA 3FCSB 5BQ3A 1ZJ5A 2XB8A 2H2WA 2C3YA 2OHJA 1JHUA 1YU6A 1Z07A 4G9GA 521PA 1RWXA 3P4UA 3UB3A 3U44B 3N86A 4FD3A 4H1TA 4AF6A 3OT1A 5K0FA 2FP4B 2G40A 4P2BA 4KIGA 3D59A 1OPXA 4DUGA 2I5PO 4GWGA 4D02A 3Q88A 3ESZA 4HRYA 1ZW1A 1Q57A 1L7RA 1YQGA 2DPLA 1IM2A 2OM2A 1ORHA 2CDBA 3WP1B 3W5DA 3OP1A 4EB3A 5DLYA 3TX6A 2GOYA 2PZLA 5AJUA 3CT6A 3NJRA 1NNI1 2X2EA 3EHEA 3I6BA 1TFUA 5AR1A 3NBAA 3IVAA 3SBDA 1J1IA 2Z43A 2A0YA 3FR8A 4Q93A 5BQFA 3SE0A 4D44A 4OYRA 4W5RA 4C4PA 3GG9A 3C6QA 3PKIA 1PJZA 4UVGA 2TMYA 4US1R 2ECPA 4RHCA 4LA4A 3EF3A 2UUCB 5L95A 1GZDA 5JXJA 5LKAA 2FFQA 3LH5A 3L7DA 2ONJA 4CW7A 4XWGA 1Q0PA 2I62A 5EZYB 3OUUA 1O95A 4H0NA 4AN0A 4MGHA 3A3OA 2NU8A 2I7VA 4R8RA 4RVGA 4UJ5A 2HU7A 2ZE5A 3DEHA 1SVWA 3Q72A 1Z29A 3WJ2A 3HJRA 1Q1AA 1N0VC 2WG1A 2IOQA 2N3ZA 1YRWA 3CSUA 3PGKA 3L7IA 3Q7IA 2IXEA 4ZVKA 5CEJA 2P9ZA 5DGHA 1JGTA 4A6PA 1RNLA 3G8YA 4HRXA 4LYFA 4O2BA 1QH0A 3L7YA 3U39A 2FOIA 3VU9B 2HDNB 3JPYA 3T99A 5JFTA 3EOZA 1UMDB 3K5HA 1ZR2A 2H4YA 1ZJ4A 3ZHBA 2BFPA 3RUEA 1YR6A 3KUDA 4C6HA 3N2KA 1FF9A 3R7WB 4WCFB 3E6AA 3HCPA 3A8TA 3T3IA 2BM9A 2W6IA 1U8XX 3VPDA 4BO2A 4CL8A 3QFTA 1UMBA 2ZJ5A 3FJ1A 4INAA 4NR0A 2HJWA 4IJ6A 2VF4X 3ZDXB 4IIHA 2VAWA 2FK8A 4I9FA 4H7HA 2WHEA 2DLNA 2JGNA 1BX3A 2VH1A 3GJ7A 3K73O 1ORWA 3CRNA 2DMRA 3NIWA 3QHAA 4FX2A 5AOAA 3TLCA 3WZLA 2OE2A 4CTOA 3K9FC 1EX9A 1CY8A 2XMRA 1AD2A 1UBCA 3GAMA 3KKMA 5CFLA 3DNFA 3KAKA 4BO5A 4UBNA 2E4AA 5J2UB 3RIYA 3GFSA 3KZXA 2FPWA 3RNLA 3BGDA 3ZZMA 4BZWA 3NH9A 4Y1EA 2GCOB 2O1EA 5A6SB 3GOHA 2VYCA 1HBJA 2DPHA 4IUBS 1Y4SA 3E82A 2ZITA 2CMKA 4HG2A 4NG4A 5DO9A 1GLNA 2VUTA 5A3SA 2PZAA 1GPH1 1MHPA 3UF0A 2FUEA 1DEOA 3DMTA 1OI3A 4PW0A 1WV1A 1SMKA 1WW3A 5ELMA 4DQUA 3BSSA 1HR0B 2XUHA 1Z4PX 2GFIA 4RTJA 3R8FA 1PJTA 2RHJA 4AJIA 1VCMA 2XYVA 3HN2A 1K68A 4BQOA 4MW9A 4QJBA 3VDQA 2COKA 4LI0A 4CL0A 1OREA 4RJ2A 4MA0A 3W5BA 4FDTA 2H5IA 3QF4A 2NACA 4AYTA 5KYNA 5GONB 2ETVA 3DE7X 1ZD9A 5TV2A 2Q0SA 1XHFA 3AKDA 3HB9A 5KX5B 3CT4A 1LBEA 5D7BA 1P7YA 2QPLA 4RVDA 3FFXA 2IHBA 2P9YA 2WWIA 4N6GA 3DBLA 4QL3A 3WMWA 3K9NA 3R3HA 4V0NA 1K5PA 4WK4B 2RIRA 1NP6A 3B53X 3RU7A 3MELA 4BB5A 2D2EA 1N6LA 1NVBA 4AJHA 4WBNA 4RVUA 1W4BA 3BTOA 4QXRA 1O94D 1XZMA 3QVJA 1E9CA 1N0HA 4OHFA 5AI5A 2JHPA 1IUNA 4ZXPA 4EK9A 2QT0A 3ZNQA 4DR7B 3NKLA 3N53A 3TQHA 4F3CA 3HZRA 5T4FA 2VK4A 3K9QO 4QATA 2CLMB 2X3FA 1XHEA 3CVWA 1RTKA 1YL7A 4QFCA 3E2PA 1UWVA 1V95A 1L7EA 4OAQA 5B37A 2QMQA 4ZDKA 2ZB2A 3DHEA 2R6R1 3OCCA 4IIXA 2X7JA 3P2MA 5H59A 4UE6A 4PY2A 4IIEA 2M98A 2UZ4A 2JCYA 2HA2A 3WNVA 1H6AA 3EE6A 2DH6A 3PD7A 4F5ZA 3ZVNA 5CIQA 5TS3A 3AESB 4HXGA 4FGKA 4FFVA 5JEEA 4OU4A 2QJFA 2BUCA 1MKYA 1NY5A 3ZHSA 3S8YA 3GT7A 5JADA 2JI6A 4L22A 4I0WB 2C4HA 2PUGA 1A8QA 2ZJ2A 3B1FA 4QBHA 3T8YA 1RAEA 4UAGA 5AI9A 5DTIA 2E4WA 2WA1A 1FFYA 1J7JA 5F64A 5B53A 4NIMA 3RANA 5JY1A 1NDHA 2WM2A 1TEHA 2LPMA 5EWJB 1HLFA 1O96A 4DCJA 2FR8C 1J2JA 1YA4A 2Y27A 2YVKA 3G2OA 3H99A 3VO8A 3WLOA 4JI2B 3AQIA 5AI0A 4P0QB 2XZOA 2R1VA 5IYZF 4MV0A 4D9FA 3MILA 2VIIA 5LB2A 3EGCA 3R8CA 3TBHA 2BGMA 1CUUA 4IWYA 1U7DA 4X1YA 2PKCA 4TTIA 4EG8A 1GNTA 2RHDA 3AOEA 3JD2A 2JW5A 1DAGA 1G20A 1XMJA 2ZJ6A 3NDRA 4WW0A 1R8XA 4ZQBA 4C89A 1X8KA 4FFDA 3NO4A 1DMRA 3VJLA 4DNQA 2ALJA 3KB1A 4J6FA 2JAUA 4E6EA 1LCIA 4ZJPA 4TYNA 4KE6A 5LIPA 1JKJA 5I8WA 5GZ1A 1ZSYA 3ME5A 4KVGA 3P0FA 4C3VA 1V7PC 1TMGE