2A4OA

Dual modes of modification of hepatitis a virus 3c protease by a serine derived beta-lactone: selective crytstallization and high resolution structure of the his102 adduct
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable protein P3C
publication title Dual Modes of Modification of Hepatitis A Virus 3C Protease by a Serine-derived beta-Lactone: Selective Crystallization and Formation of a Functional Catalytic Triad in the Active Site
pubmed doi rcsb
source organism Human hepatitis a virus hu/northern africa/mbb/1978
molecule tags Hydrolase
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a4oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a4oA02
2AS9A 3BTEE 1SMFE 1XUHA 1F0RA 1AB9B 5PTPA 1O3PB 1PQ7A 3BN9A 3KHVA 1V2JT 4A92A 1OYTH 4UDWH 2Z7FE 2BMGB 3SUFA 3BEFB 1TALA 1CU1A 1GVLA 1CBWB 2WYGA 4BNRA 1ESAA 2OBQA 5CHAC 1JMOH 1AO5A 1EQ9A 3A86A 4THNH 2BVSH 1TA2A 1NS3A 1Z1IA 3VEQB 2B9LA 1HAXB 5DP6A 1UCYK 2GT8A 3A7XA 1BMLA 1JRTA 2Q6DA 2Z9LA 3T26A 4CR9A 1CGHA 1JIMA 2GP9B 1SB1H 1L0ZA 3T5FH 1FPHH 1GBMA 1L4DA 3ZZ6A 4HFPB 2P8OB 2XWAA 5L2YH 1BTPA 1UK4A 3SQHE 1K21H 2BD9A 3GCNA 2A5KA 4MPXA 2XBYA 2O9QA 3UTUH 3NUMA 3P6ZB 4FXGH 2A7HA 1SLXB 2P95A 2AMPA 2J34A 4NWKA 1O36A 2O8WA 2GD4B 4FUIA 4Y8ZA 5DP5A 1T31A 3FFGA 3NCLA 1BBRK 1GVZA 3HATH 3UPEA 1HAOH 1Q2WA 1SGIB 1HIAA 1HAHH 2ZTYA 1M9UA 4CRGA 3A87A 2OBOA 1GPZA 1A61H 3D62A 1OXGA 4AYVB 3SU6A 1O39A 2A31A 3K2UA 1UVTH 2B8OH 1BHXF 1UHBB 2ZPSA 5E2PA 1IQLA 1W3CA 5HM9A 1H9LB 1BTZA 2VIPA 3T62A 4BAQB 1YBWA 2ZECA 1BRAA 1S83A 2KAIA 2BDIA 1T8LA 1K1MA 1W7GH 2ZPRA 3DFJA 3LGVA 2A4RA 2H5CA 4YT7H 3P17H 1EPTC 2ZU1A 2Z9KA 1IQEA 3RXUA 2QGRA 1SQAA 4R0IA 1GL0E 1TQ0B 4INHA 3UQVA 1KSNA 4BAKB 5GWZA 1C9TA 2CF8H 1C4V2 1AZ8A 1DUAA 1GJ7B 1BMNH 1H4WA 5JBBS 4YOGA 1TRNA 1J17T 5FCKA 2XCFA 3ZZ7A 1LPKB 1P3EA 3IG6B 2VIDA 1WU1A 2RA3A 2PUXB 3A8CA 2PW8H 3OX7U 1K2I1 2FLBH 2FTLE 2GZ7A 2W3KA 5A0CA 1GJ5H 1DWDH 2Y5FA 1C1OA 1QTFA 4J2YB 1OP0A 5DJ7A 4JCNA 3H7TA 2D2DA 1GBBA 3M5MA 5FPSA 4LZ4B 4X1RU 1WV7H 3FVFB 2TGDA 1HCGA 4GLYA 4B1TA 1GDNA 1O3DA 3PWCA 1P2JA 1X7AC 3HK3B 3SJ9A 2FWWA 1S85A 1PQ8A 3FP6E 3RXOA 1O2MA 1O3HA 1SBWA 2FX6A 1UTNA 2FOAA 2BD8A 4WMEA 1PPGE 3R3GB 2F9OA 3H5CB 4NGAH 1NN6A 1H9HE 1C1NA 4MG3A 1O2RA 2D8WA 2NU1E 1HUTH 1A0JA 1ZGVA 8ESTE 1C2EA 1MAXA 1A5HA 2HPQH 3TH3H 1LCYA 4CRCA 1S82A 3B23B 5FBIA 1TIOA 1HPGA 1NFXA 1NU7B 3VFEA 1PPZA 1SGPE 3FAOA 4KKDA 3GY6A 1P2MA 1D3QB 2ZHWH 4OS5A 1BTXA 2H9EH 4WVPE 1OWIA 4ZROA 1YLCA 1HJAC 2PUQH 4MLFB 2BM2A 1BA8B 1T8OA 1EB2A 5G4BA 1DOJA 2XNIA 3A82A 3ZZ9A 5GPIB 5L2ZH 1Y5UT 1Z71A 1C2DA 1IQMA 5C1UA 1A46H 1AFQB 1HGTH 2ZKSA 1SOTA 3GY3A 1Z8JB 5LPRA 1UCYH 1SGEE 3FANA 1MTVA 5JBAS 4NCYA 4AB8A 6CHAB 3DT0H 4E06H 4Q80A 1GBIA 3M7UA 3UQOA 4NFEA 1ELGA 1FLEE 1C2IA 1QBOA 2XTTB 2BLWA 1P9UA 2ZQ2A 1HXFH 1AMHA 1HXEH 1V2UT 5F8ZA 3NK8A 1K28D 1O2KA 2WPKS 3A8AA 3PWBA 1YPKH 4HTCH 1HAGE 1Z7KA 3E8LA 1F0UA 1C1QA 2DUCA 3MU5A 1L1GA 3QZQA 1LKAA 3RXCA 1BBRH 1GL1A 4Y10E 3TH4H 4K3JA 1GI9B 3MH4A 1TBQH 2BQ7B 5DPAA 1UTLM 1GBAA 4CHAC 1QR3E 3EDXB 1O3IA 1MU6B 1BCUH 2G55A 1QFKH 3UR9A 2VWNA 1SHYA 2PKAB 2ZHQH 1G3BA 3BEUA 3Q00A 2AGGX 1V2QT 2VIWA 1C5MD 4U01A 1V2LT 2P3FH 5JBCS 1SFIA 4FUDA 1SGCA 5EPYA 3GCOA 4LXBH 1QL8A 4FU9A 1U6QA 2AGEX 1ESBA 4ABDA 3SHAH 1HNEE 4UONA 4H6TA 3AAUA 2BY8X 2R2MB 1V2VT 1F0TA 4BTUB 2ZGXH 1C1WH 3RXEA 5EQSA 3LT3A 1BMMH 3RXTA 1DLKB 1HAVB 2FMJA 3QGJA 3NZIA 2EI7A 4NZLA 4AGJA 4I7YH 3GY5A 3ZVEA 1FY3A 2RA0A 2VIOA 4XSKU 5HXFA 2BTCE 1W0ZU 1C5TA 5EXLA 3VB4A 4KP0A 1AKSB 2GCHG 2FLRH 4JZ1A 3A7WA 1C4Y2 1HAYB 2NU2E 5E2OA 3A89A 4YOJA 1SI5H 3SI3H 3MO9A 2LPRA 3K6YA 2BOHB 3E0NB 5DKMA 4K1TA 3BV9B 4RKOB 1V2NT 4Y71A 1NO9H 4A5TS 4NG9H 1RJXB 2P16A 3SU3A 2RDLA 2A2QH 3S9AA 4FUFA 8KME2 1O3KA 2PTCE 1AZZA 1W2KH 1YM0A 4H4FA 7ESTE 1BQYA 2H6MA 1TAWA 2PGBB 2G4TA 3RDZA 4ABHA 1IQNA 1BRCE 4MQAA 4X2VA 1TRYA 2GCTC 3V3MA 3RM0H 4XBDA 4UFDH 1DY9A 1EZXC 2FOMB 4YTAA 1KXAA 4A1TA 3SU2A 2LNCA 4AB9A 4Q7ZA 5FAHA 1C5XB 1UTKA 3BTHE 3MI4A 2QN5T 2VWMA 6LPRA 1GJDB 1A0HB 2YNBA 1DPOA 1ZHRA 2BLOA 3RMLH 3FP8E 1EJNA 3GISB 3MYWA 4XOJA 2V35A 1QQUA 2XCNA 3E91A 1UTQA 1Z8GA 2A32A 1TLDA 1FPCH 1HJ9A 1HV7A 1PFXC 1ZRBA 1L2EA 1AUJA 3V7TA 2FZZA 1A1RA 4VGCC 2FS8A 2ZA5A 1EAUA 1EOLA 3LC5A 3SUGA 1P10A 1XKAC 4O03A 4WWYA 2A4GA 1VGCC 1VCQA 2F9PA 4FUBA 1NRRH 2Z9JA 1O2TA 4JZDH 4CRDA 1T8NA 3CS0A 5DP7A 1SQTA 2K1QA 2HALA 1QJ6B 2BD7A 1AWHB 3M61U 1NFWA 1ZRKA 4KTUA 1P8VC 1G30B 2Q1JA 1TPOA 3V12A 4ZHLU 3KNXA 3LKWA 3M35A 1GHWH 4TY6A 1C1VH 2WPHS 4NFFA 1XVMA 1S81A 2VNTA 3TIUA 1KXEA 1O2YA 3A8BA 2F9UA 4JZEH 1TPAE 4QT8C 3B8JA 1O2PA 1WCZA 4LZ1H 1TONA 3FZDA 2NU3E 4ZMAH 1DX5M 4I31A 3BTKE 2BD2A 2WUCA 1ANCA 1ARCA 1YPLH 3F9FA 1ELBA 2B5TB 3OTJE 3KQEA 1GHBF 1C5ZB 3GYMA 1O3EA 2FP7B 1XUJA 1AVGH 1MU8B 3Q77A 2VB0A 3ZVBA 1K1IA 3BF6H 3SNDA 4CRBA 3SN8A 3LONA 2ZU4A 2G8TA 1GGDB 4X1SU 1J15A 3JZ1B 2C8YB 1AY6H 3WY8A 6ESTA 2F91A 5F8XA 1KDQB 1SGNE 4TPIZ 2UUFB 2BHGA 3P8GA 1OP2A 1TNJA 2XW9A 4K1EA 1P06A 1J14A 1K1PA 1UJ1A 5EQRA 5CE1A 4UFGH 2ZFQH 1EB1H 2ALVA 1TMTH 2AIPA 1G36A 1LVBA 1C5UA 3SNAA 2AERH 1UCYE 4ABAA 1GJ6A 2IN2A 2A45B 3MNCA 1A4WH 1VITF 3ITIA 3SO3A 2BZAA 1O2OA 1W10U 4OS6A 3UFAA 1LPZB 4JMYA 4KTSA 4B2CA 5EXNA 2O8MA 1ZLRA 1O5AB 1GVKB 3TGJE 1FMGA 1IQIA 2OC7A 3KQBA 4TYDA 4CRAA 1OWDA 1RXPA 1RD3B 2GCHF 1KYNA 1IQHA 1V2KT 3M5OA 1GCTB 4ABBA 1HYLA 3K65B 4RN6A 1BBRE 3SQEE 2VIVA 1GDUA 1ZMJA 4SGAE 2ANMH 4Z6AH 2A4QA 2OP9A 1W13U 1FY4A 1GMCF 1Q31A 3HPTB 4MVNA 3H7OA 4IMZA 1KY9A 1KXFA 1FY5A 5LGOA 3SV6A 4YLUA 1SLVB 3SU5A 1QCPA 2QYIA 4GCHF 3EA8A 4IN1A 4D9RA 2JETC 2BYAX 2ZDKA 4ABFA 3O8DA 1O33A 2P93A 4AX9H 1ZHPA 1C5SA 2AYWA 3NWUA 4MPWA 2PKSC 1OWHA 2PSXA 2ZI2H 5GDSH 1F7ZA 2ZDNA 4BOHA 3TJNA 1QBVH 1V2OT 1ZTJA 1NTPA 2ZO3H 2TPIZ 4JYTA 2JH6D 3UWJH 3PYHA 3CP7A 3BTFE 1TGCA 3RXBA 3RXLA 2BQWB 2XYAA 3QTVH 4UD9H 3T2NA 3GY8A 3SJKA 1TNLA 8GCHF 3KQDA 3OYPA 1LHGH 4H42U 4AYYB 1LHCH 1ORFA 3VB7A 1E37B 2F9BH 2PFEA 1QB9A 3HKJB 3SJIA 4ZKOU 2WPIS 4TWYA 5C5OA 2UUKB 2SGQE 3CS7A 1W7XH 4ABGA 6GCHF 1A7SA 3QDZB 2FDAA 2WUBA 1ZPCA 3MNXA 1YYY1 5C1YA 2R0KA 4F49A 1C1UH 1UVSH 1V2RT 1TNGA 2F3CE 1HAPH 3EA9A 1UHBA 5EW2H 4ABIA 2G00A 3ZV8A 2VH0A 1EJMA 4CH8B 1CSOE 3ZVGA 1GBFA 5TJXA 3S69A 3KCGH 2V0BA 2JETB 4HZHA 2BLQA 3SZNA 4ISHH 1FONA 4MDSA 4GSOA 1OOKB 1PQAA 1T7CA 2PKSB 1P01A 1ZSLA 1C1RA 4UFEH 3E3TA 1B7XB 1EUFA 2Y6TA 3OY5U 1P2IA 2HOBA 4DOQA 1TYNA 4NWLA 4GUXA 1ID5H 4H6SB 1SC8U 5FPTA 3F1SB 1BTWA 3QZRA 2B7DH 4WMDA 1GI8B 3BTGE 5B6OA 1G9IE 3DHKH 4OS7A 1YPMH 1TABE 1F2SE 1DXPA 3GCTG 1THSH 1O5BB 2FI5E 3AAVA 1SPJA 2OLGA 2BD4A 2C4FH 3QN7A 1V2MT 3F9HA 4Y11E 3ODFA 5GJ4B 4B74A 7GCHF 2PWXA 1SR5C 1O3JA 2BZ6H 5A8ZA 4O97A 1GBEA 5FCRA 2ZWLH 2EI6A 2G5NA 1BRUP 4UEHH 4MNWA 1XX9A 1AE8H 2BDHA 3U1JB 5F03A 2J2UA 4Y6DA 5T6GA 4X8TH 1EOJA 3QTOH 1Z6JH 4K8BA 5CHAB 3V13A 1P2KA 3A7YA 2DE8A 2ZC9H 3OY6U 4ZKNU 1N1LA 4AG1A 2C8XB 1K9OE 1EP6A 2Z3DA 3M5NA 3QGNB 4WXVA 4CRFA 1UTMA 3SV9A 1OS8A 3U9AH 3TNTA 4FUGA 1SGFG 4GHQA 1DM4B 1C2KA 2ZCLP 2Z94A 4BXSA 3PLBA 3ATIA 1BOQA 2FI3E 1E35B 2BLVA 2GKVE 5GCHF 5A2MH 3TH2H 1K1JA 2J9NA 1YPJH 4WMFA 3M3SA 4IW4E 4ISLA 3FZZA 1EZSC 3SJ8A 1O5EH 3SV7A 2VVUA 5AHGH 2ZCHP 1SL3A 1TGBA 1C2FA 2YOLA 4XDEA 1TPSA 2XBXA 4AFSA 1HRTH 3I29A 1MQ5A 3RXHA 2BY7X 1C5QA 2WPMS 4OGYA 3O8BA 1HJ8A 3QLPH 1ELFA 1KLTA 1YP9A 3A83A 3T27A 4FUHA 3LJOA 2SNWA 1TE0A 3SV2H 1GI5A 1OYQA 2ZNKH 4X2WA 1LKBA 2F9VA 1ELDE 1GMHG 1Q3XA 3E6PH 1YF4A 2A5IA 2PLXA 3A85A 5C3NA 3F9GA 1C2LA 1C9PA 2QIQA 2A7JA 3U1IB 2ZDLA 2Q6GA 1ANEA 3RLWH 1P09A 1S6FA 1UK3A 3DA9B 2NU0E 1HAZB 3F6UH 1EPTB 4NSYA 5A8XA 3M5LA 2EC9H 1DDJA 1TOMH 2KAIB 1RTLA 1FN6A 3LU9B 3TK5A 4Q2KA 1SGQE 1QGFA 4NIVA 4IMQA 3SBKA 1O35A 1EZUC 3LH3A 2A1DB 4AFQA 2H9TH 4D9QA 4LK4A 1LQEA 1O2ZA 3TLOA 4BAHB 3S0NA 4YESB 3U8OH 1IQGA 1SLUB 5FHTA 2BDCA 2OINA 3RP2A 2SGPE 4FU7A 2PKAA 3HGPA 4GHTA 1QB1A 4A1VA 2Y5HA 1O3MA 2V6NA 3O8RA 2QXGA 2XBWA 1DE7H 2BOKA 2VU8E 4YOIA 1O32A 2TGTA 3VXEH 1GHAG 1IQKA 2SGEE 2RG3A 1E36B 4O3TA 3C1KA 1A5IA 3ZYDA 3LGTA 2ZCKP 4AZ2B 4F4OC 2FOHA 2TGPZ 2GMTC 1Y8TA 2PR3A 3T29A 3BTDE 1WOFA 3SHCH 1HAVA 4IS5A 2A7CA 1O2GH 4NSVA 5JDUB 4A7IB 4MPUA 3UNQA 3LPRA 1GHVH 2Q6FA 2WV4A 4Y7BA 2CHAC 1AKSA 3IWMA 5EXMA 1J9CH 4K60A 3TVJB 1DSTA 3A7TA 1C2JA 2ZFFH 3E0PB 1LHFH 5EQQA 3SUDA 4X6NA 4X8VH 1TGNA 2XRCA 2XBVA 3A80A 2HNTF 4X6PA 5SGAE 1RTKA 2G81E 3E90B 3DUXH 5EOKA 1ETSH 3L3TA 1HDTH 3GCTF 4D76A 4AFZA 3VGCC 3A8DA 4MNXA 5J4SA 3D65E 2UWLA 4FUEA 4SGBE 2HGTH 2BD3A 2PTNA 1GHYH 1ESTA 1XXDA 1ETTH 1Z6EA 5EG4A 1MKWH 2J92A 1ELTA 4ZXYH 2AMQA 2Y7XA 2FPZA 1B5GH 1D6RA 1PJPA 2TRMA 3L6PA 5HM2A 1D3PB 2VVVA 3SU4A 5DP9A 5K0HA 2ZFSA 1TWXB 1HJAB 1CT0E 5T6DA 1O30A 1JRSA 1SVPA 2ZHFH 1DT2A 3PTNA 1VITH 1GDQA 1V6DA 3LGYA 1DUEA 3MU4A 4O9VA 3BIUH 3U8RH 4X0WU 3P70B 1FI8A 2TIOA 3GDUA 3EQ0H 2P3TB 3TGIE 1W11U 1UTJA 2PV9B 2GX4A 2UWOA 4GPGA 4NA8A 1F0SA 3T28A 2GMTB 3PLPA 4X8UH 3ZZAA 1LPGB 1GBKA 4IN2A 3RXJA 4A6LA 2BVXH 3RXRA 1MTWA 1KLJH 1C1SA 3BTWE 4NA9H 1FAXA 1N6YA 2ZIQH 1MTUA 2QXJA 4MNVA 4BTTB 3LGUA 4DW2U 1V2PT 1H8IH 2R2WU 5ESTE 1EXFA 5IYTA 1GJBB 1BMAA 4KELA 4U2WA 2Z3CA 4ABJA 3STIA 4I8KA 3MO6A 2I6SA 2ZG0H 1Y5AT 4CHAB 1DITH 1EAXA 2ULLA 3P8FA 2ODYB 1ZOMA 4B2BA 3TITA 1G2LA 3BEIB 1MTSA 1C4U2 5I46H 1S84A 1XMNB 1DSUA 1GI0A 2ZFTA 4FVBA 3SGBE 1NFYA 1RGQA 2ZTZA 2Y82A 2ODPA 3SNEA 2SGAA 1ZR0A 2FODA 1MCVA 4I8LA 1ELEE 1CQQA 2R3UA 1BRBE 2FOCA 1QHRB 1WBGB 4ZKSU 2V3HH 2I6QA 1XUIA 3P95A 1YC0A 1CGIE 1LO6A 1LHDH 1IQFA 3SJOA 2OTVA 3Q3KA 1PPCE 1GBDA 2STAE 1G3CA 5BPEA 4INKA 2ZU2A 3M36A 1T4VH 2FM2A 1O3NA 2QXHA 1O3FA 2BY6X 5EODA 1P2QA 4AN7A 3UREA 1QJ7B 1HBTH 1A2CH 2QV1A 2OXSA 1C5NH 3UUZA 2SFAA 1ZJDA 1TNHA 1H9IE 1ZSKA 2FI4E 3RMNH 3SOSA 1ABJH 3SGAE 1FY1A 1TGTA 3ENSB 4KGAA 1RS0A 3KGPA 2VH6A 2BVRH 1GI7B 1LHEH 2C8ZB 3BIVH 4ZHMU 3ZZ5A 1TX6A 4MTBA 2GTBA 5F8TA 2QCYA 1VJAU 1FIZA 4AGKA 1FJSA 1GHAF 5H4IB 5T6FA 1BDAA 1JBUH 1D9IA 2FOFA 1V3XA 2GCTB 2ILNA 5HMAA 1GMDG 1VCWA 1O3BA 1K1OA 3N7OA 1QA7A 2ZDMA 4RKJB 1W8BH 3P8NA 1PPBH 2WPJS 1CHOG 1BZXE 1OPHB 1V2ST 3MU8A 1ETRH 1P9SA 3AASA 5HYOA 2BDAA 4KTCA 3I78A 2ZHEH 3GY7A 2AMDA 4FVDA 3M3TA 9ESTA 1AFEH 3GDSA 1PYTD 5EPNA 3UY9A 1YPHC 4Y8YA 1O34A 4Q7YA 2ANWA 1O37A 4YT6H 4VGCB 2Y7ZA 2Y80A 1XUFA 2XC4A 3MFJA 1YLDA 1BHXB 1C5WB 1EP5A 4WH6A 1XKBC 1VGCB 1AVXA 3SV8A 3MH6A 1TX8A 3RU4D 3LH1A 5DO4H 1FY8E 5DG6A 1TBRH 1O2IA 3BTTE 1TBZH 3ATWA 1QA0A 3ZVDA 4R8TB 3ESTA 1GHZA 3MH7A 3PB1E 2EA3A 1L1JA 1MAYA 1JWTA 2FXRA 3RXFA 3KL6A 1ZJKA 2XWBI 3I77A 4HI3A 1DICA 1GWAA 3GCHC 1HB0B 3A84A 5FPYA 1A3EH 4JK5A 1GG6C 1TFXA 3RUOA 1DXWA 1EX3A 1OWKA 3AVZA 1G2MA 5K7RA 2ZDAH 1QL7A 2W26A 1UVPA 1ELCA 1C2MA 3LGWA 1BJUA 3KQCA 2CF9H 2DE9A 1A3BH 1DANH 2OC1A 1WTHD 2FIRH 1S0QA 1WQSA 2BDYA 5JB9S 3TJOA 1P12E 2STBE 3TK9A 2BDBA 1TMBH 4JZFH 1K1NA 4Y0YE 1O2QA 1YPGH 1AD8H 1UTPA 4WXIA 1KXCA 3ATMA 2SGFE 1A0LA 4K2YA 4DT7B 1AB9C 1ANDA 2O8TA 4WY3A 1QQ4A 3VB5A 2R9PA 1BTYA 1T4UH 2OC0A 3UIRA 3VPKA 2FOBA 3MU1A 1O31A 1AUTC 3MNSA 3Q76A 1DLEA 1CBWC 5DK1A 3UNRA 2XC0A 4Y8XA 1IHSH 3PROA 4LOYH 2HNTC 1MCTA 4YZUA 3KEEA 4B76A 1TNKA 5E0HA 3M7TA 3S9CA 1TOCB 3EYDA 1O3OA 3SI4H 1GJCB 1CE5A 3QO6A 3E1XB 3SNCA 1JXPA 4I32A 4AORA 4CH2B 1WSSH 2V3OH 1Y5BT 4MNYA 4HGCA 2TGAA 2GDEH 2WINI 1UVOA 2P8OC 1DVAH 1KXBA 1XUKA 3UOUA 1OWJA 1LVMA 9LPRA 2BX4A 4UFFH 1EJAA 1NU9A 2A2XH 1IOEA 2QC2A 4K1SA 4U32A 1SG8B 1FUJA 1BUIA 1BTUA 1O2NA 2CV3A 1C5OH 3MHWU 1WTGH 1B0EA 1SGFA 3QK1A 1B0FA 3PV4A 5ETXA 1NT1A 1UMAH 1NPMA 1EATA 3AW1A 2J4IA 4IC5A 3EA7A 3BTME 2IPHA 1V2TT 2FESH 4I8JA 2JH0D 2AGIX 3LGIA 2ZHDA 2OC8A 4ISNA 2JKHA 3W95A 1F5LA 3Q3YA 3GOVB 3RXIA 2UUJB 1MKXK 2FYQA 5C2ZA 1GMDF 1TNIA 2W3IA 1QB6A 2TBSA 2JH5D 4Q7XA 4DIIH 2ZP0H 2BXUH 4K69A 1P05A 4X2YA 2R3YA 1CHOF 2BY9X 1P57B 4RSPA 1RFNA 3MMGA 2ZTXA 2W5EA 3R0FA 5LH8A 3LIWA 1T8MA 1HAIH 3A88A 4OS4A 1RRKA 1MZDA 2GGVB 4BAOB 1LDTT 1C5VA 2HLCA 1O2WA 3TGKE 3RXSA 3LOXA 5EW1H 3EGKH 1QURH 2J94A 1LTOA 2C3SA 1WQVH 1THRH 2AH4X 1FZZA 5A8YA 1NY22 1Y3YA 1AI8H 1AE5A 1O5CB 3KIDU 4JK6A 2ALPA 1MKWK 3MH5A 3VB6A 1KTSB 4BXWA 3TK6A 2UUYA 1TMUH 4XBBA 2GZ8A 2HPPH 3RM2H 3RMMH 1P04A 1CO7E 2THFB 3TPIZ 3ATKA 1XVOA 2D1JA 1AVWA 2GZ9A 4AFUA 2Z6BD 1THPB 2QF3A 3ZYEA 1Y3VA 1DY8A 2OQ5A 1QRZA 1CT4E 2ZGHA 4X6MA 1EPTA 2PHBA 1YKTA 1HLTH 1SGTA 1GI6A 1NROH 1TB6H 1NRQH 1TA6A 5L6NH 4A1XA 5FBEA 1O2VA 4JZIA 1OX1A 3G01A 4JYVH 1EAWA 1Z1JA 1S0RA 2XXLA 3M37A 5C20A 3ZVAA 1VJ9U 5FX5A 4X8SH 2HVXA 3UWIA 2BB4A 3URDA 2C93B 1D3DB 1OP8A 1P2OA 4ABEA 1DWEH 1TPPA 2AFQB 2QAAA 3AW0A 3CENA 3D23A 4X2XA 3C27B 4YLQH 4ZHAA 3A7VA 1TX7A 4DURA 2VGCC 3DD2H 3RC5A 2Y5GA 2ZFRH 5EU8A 1O5DH 1Y3UA 8LPRA 4GVUA 2GT7A 3FP7E 4CR5A 4ZAEA 1OSSA 1CA0C 1Z8IB 2BDGA 5F6MA 1H8DH 1HIAB 1AFQC 3OSYA 4Z0KA 1CT2E 3KF2A 4UE7H 2BX3A 4BAMB 3EAJA 1ZZZA 2P59A 3S9BA 2FEQH 1GCDA 6CHAC 3NKKA 5HGGA 2BY5X 4DY7B 2Z9IA 4ZUHA 4Y0ZE 1NM6A 1ZPBA 1GBLA 1AQ7A 4ESTE 1RIWC 1MD7A 3SNBA 3HK6B 1VR1H 2G4UA 2ZU3A 3V0XA 3PMBB 2ZU5A 1SGRE 2G51A 1AU8A 2ZGJA 3PM3A 4JYUH 3ZV9A 1FN8A 1GBHA 1JOUB 1BJVA 1DWCH 2SGDE 1GI3A 2UWPA 2VWLA 4YO9A 1ZTLA 1P2NA 3IITA 2HRVA 4INLA 5T3HA 1A5GH 2AIQA 1NFUA 3MOCA 1FQ3A 1P03A 1YCPK 2F9NA 1YPHE 3RLYH 1MMJN 1DS2E 1UTOA 3PO1C 1O3CA 2WV5A 3MWIU 1ZSJA 1WAYB 3ZZCA 4CBOA 4X1PU 1K1LA 1BITA 1T32A 5E0GA 3MNBA 2VGCB 5CMXH 5GIBA 1RTFB 3RXMA 1MKXH 3DFLA 5DP4A 2FTMA 1GBTA 1SQOA 3EE0B 1GI1A 1GBJA 1CA0B 3P92A 4CBNA 1PYTC 1W0YH 1MBMA 3VB3A 1ELVA 1Y3WA 2FOGA 1L4ZA 1YGCH 3SGQE 3RXVA 1N8OC 2OQUA 1J8AA 1O0DH 1P11E 1O5FH 2P94A 1OKXA 4E7NA 1RIWB 3S7HB 5DP3A 1QY6A 2YNAA 1Y59T 2OD3B 1QBNA 1TRMA 1D6WA 1GHBG 5E0JA 3L33A 2ZZUH 4XBCA 4NA7A 2QA9E 1O2LA 3GYLB 3ZZBA 1VCPA 3MU0A 4CREA 4FUCA 2BD5A 1O2SA 2C8WB 1PPFE 3TJUA 5I25A 3BG8A 1NC6A 5AF9H 1Z8RA 1MQ6A 1ZHMA 4XFQA 3SUEA 3RXDA 1C1PA 1OWEA 3PO1B 3HKIB 3F9EA 1ELAA 4BTIB 4NIYA 5JB8S 1G37A 5IDKA 4ZH8A 1BIOA 2R0LA 2ESTE 5C5NA 5ABWA 4FU8A 3GDVA 1O38A 3URCA 1K22H 1VITG 2HNTE 3KN2A 4PROA 1QL9A 4B75A 4IC6A 2VINA 1ANBA 1YCPM 5FXLA 2VWOA 3LC3A 4YM9A 2ANYA 2W7SA 2CHAB 4ASHA 3TNSA 1N8OB 3JZ2B 2CGAA 4GAWA 2G52A 1H1BA 4WF8A 1KXDA 3RC6A 4U30A 1EZQA 3F68H 2BQ6B 1O2UA 1DWBH 3MO3A 2O8LA 1ZGIA 2H9HA 3P8OA 2A4OA 1ZYOA 4DG4A 1QIXB 2NU4E 2VIQA 3VGCB 1CA8B 1EAIA 2P3UB 4WJG2 1G3EA 2H1UA 1O3LA 1C5LH 1LVOA 2BXTH 1ZPZA 3STJA 1SOZA 2FYRA 3ODDA 1E34B 4TWWA 1GJAB 1GMCG 1IHTH 4X6OA 1INCA 1BTHH 1GJ8B 1GI4A 5TCCA 1QRXA 3QX5H 5DGJA 4GCHG 5DP8A 4I8HA 2ZPQA 3RMOH 4ISIH 4XE4A 3K9XB 3W94A 4MPVA 1SGYE 3RXAA 4ISOA 1GMHF 1FDPA 3LDXH 2C90B 4K8YA 4OGXA 5AFYH 4IGDA 3ZZ8A 4D7GA 1UO6A 1QJ1B 3SW2B 1LMWB 3U69H 1SFQB 3GY2A 3E16B 1FAKH 5E8EH 4B71A 1LQDB 1W12U 2CJIA 5AVDA 5J4QA 4BANB 2EEKA 1P3CA 1JIRA 3NPSA 1D3TB 8GCHG 3RU4T 2A5AA 1P02A 2O8UA 1ACBE 3PLKA 1KDQA 1YCPH 2D26C 1WUNH 4DCDA 3D49H 3UOPA 1PPEE 3S7KB 2ZEBA 3M3VA 3A81A 5ESBA 1GGDC 1IAUA 4NIXA 1F5KU 2Z9GA 3LJJA 6GCHG 2XC5A 1DFPA 1FXYA 3ZVFA 2H5DA 3ZZ3A 1CHGA 1XM1A 3SORA 1MZAA 1AIXH 1KLIH 1SLWB 3PMJA 1ZTKA 2AEIH 3UR6A 4ZKRU 1O3AA 2OCVB 1O5GH 2B0FA 1YPEH 1LVYA 1IQJA 1CVWH 3RXGA 4NZQA 2QY0B 1FV9A 1GHXH 5A0AE 1C1MA 1TQ7B 2NWNA 3RXPA 1UVUH 4I8GA 2GVFA 3BTQE 2Y81A 1HFDA 1C5PA 1D4PB 2ZFPH 3PTBA 3TU7H 4X1NU 1GI2A 1CGJE 1ZMLA 1XXFA 1NZQH 1QRWA 1C2HA 1E0FD 3HGNA 3VXFH 1O2JA 3NXPA 1E38B 3RXQA 2F83A 1C2GA 3PMAB 3GY4A 3U8TH 5C1XA 3T25A 3ZZ4A 2ZQ1A 1Y3XA 1SSXA 4I33A 2SNVA 1F5RA 1MD8A 1J16A 3BG4C 4O3UA 3RXKA 2GV7A 2OUAA 1GCTC 1KTTB 1QNJA 1W14U 4TPYA 4AOQA 3B9FH 2IOTA 1L1NA 4NIWA 5GXPA 1GJ9B 2FO9A 3SU0A 4DGJA 7GCHG 3QUMP 2PSYA 2ZF0H 7KMEH 2A0QB 1MUEB 1PQ5A 3QWCH 5JPMH 2IJOB 1C5RA 1MH0A 2VJ1A 1C1TA 1O2HA 1TGSZ 5A09A 1MBQA 3MTYA 4E05H 1P0SH 4DJZB 3SU1A 1FIWA 3OU0A 5AFZH 1GBCA 4Y76A 2J95A 4Y7AA 1FNIA 1F92A 4Y79A 2QXIA 1VZQH 4TY7A 3GICB 1AHTH 1NESE 3U98H 1MTNC 5FX6A 2J38A 1NRNH 3RC4A 4DVAU 3M7QA 5GCHG 3ZVCA 3Q3XA 1ABIH 1SGDE 2CXVA 2GV6A 2H2ZA 3ELAH 1GJ4H 3PMHB 5JBTA 2WYJA 3BG4B 2ODQA 2GDDA 1AWFH 3ZZDA 4ZXXH 3A7ZA 7LPRA 1NRPH 2ASUB 3ATLA 2ZGBH 4B73A 4J1YA 1SHHB 4IBLH 1O3GA 5JYIA 1XUGA 1WYKA 2QF0A 2CN0H 2ZGCA 2Z3EA 3UNSA 5LPEA 4E7RG 4OS1A 1EASA 1C5YB 4M7GA 2WPLS 2HWLB 2M5TA 1ZMNA 1KIGH 1NRSH 3O8CA 1ARBA 3GCHB 4OS2A 5A0BA 1BT7A 4FUJA 1GG6B 1G3DA 1S6HA 4DIHH 1AN1E 1N6XA 4AG2A 2FX4A 2FOEA 2VVCA 4K5ZA 1BB0B 3BSQA 4D8NA 1UK2A 1G32B 1AGJA 4D7FA 2W7UA 3K6ZA 5EGMA 2FS9A 5L30H 1S5SA 2RCEA 1V2WT 1O2XA 2G5VA 2CMYA 5LPFA 4X1QU 4WH8A 5C67A 5TCAA 2ANKH 5BRRE 1MTNB 1PPHE 3RU4E 2EI8A 1EKBB 4B2AA 2PGQB 2ZDVH 3TJVA
chains in the Genus database with same CATH superfamily
2AS9A 1WDIA 3BTEE 1SMFE 1XUHA 1F0RA 1AB9B 5PTPA 1O3PB 1PQ7A 3BN9A 3KHVA 1V2JT 5F53A 1OYTH 4A92A 4UDWH 4Q4LA 2Z7FE 4F48B 2BMGB 3SUFA 3BEFB 1TALA 1CU1A 1GVLA 1CBWB 2WYGA 2RFKC 4BNRA 1ESAA 2OBQA 5CHAC 5KGOA 1JMOH 1AO5A 1EQ9A 3FO8D 3A86A 4THNH 2BVSH 1TA2A 1NS3A 1Z1IA 3VEQB 2B9LA 1HAXB 5DP6A 4B6EA 1UCYK 2GT8A 3A7XA 1BMLA 1JRTA 2Q6DA 2Z9LA 3T26A 4CR9A 1CGHA 1JIMA 2GP9B 1SB1H 1L0ZA 3T5FH 1FPHH 1GBMA 1L4DA 3ZZ6A 4HFPB 2P8OB 2XWAA 5L2YH 1BTPA 1UK4A 3SQHE 1K21H 2BD9A 3GCNA 2A5KA 4MPXA 2XBYA 2O9QA 3UTUH 3NUMA 3P6ZB 4FXGH 2A7HA 1SLXB 2P95A 2AMPA 2J34A 4NWKA 1O36A 2O8WA 2GD4B 4FUIA 4Y8ZA 5DP5A 1T31A 3FFGA 3NCLA 1BBRK 1GVZA 3HATH 3UPEA 1HAOH 1Q2WA 1SGIB 1HIAA 1HAHH 2ZTYA 1M9UA 4CRGA 3A87A 2OBOA 1GPZA 1A61H 3F0OA 3D62A 1OXGA 4AYVB 3SU6A 1O39A 2A31A 3K2UA 1UVTH 2B8OH 1BHXF 1UHBB 2ZPSA 5E2PA 1IQLA 1W3CA 5HM9A 1H9LB 1BTZA 2VIPA 3T62A 4BAQB 1YBWA 2ZECA 1BRAA 1S83A 2KAIA 2BDIA 1T8LA 3WW7A 1K1MA 1W7GH 2ZPRA 3DFJA 3LGVA 2A4RA 2H5CA 4YT7H 3P17H 1EPTC 1COWD 2Z9KA 2ZU1A 2HLDD 1IQEA 3RXUA 2QGRA 1SQAA 4R0IA 1GL0E 1TQ0B 4INHA 3UQVA 1KSNA 4BAKB 5GWZA 1C9TA 2CF8H 1C4V2 1AZ8A 1DUAA 1GJ7B 1BMNH 1H4WA 5JBBS 4YOGA 1TRNA 1J17T 5FCKA 2XCFA 3ZZ7A 1LPKB 1P3EA 3IG6B 2VIDA 1WU1A 2RA3A 2PUXB 3A8CA 2PW8H 3OX7U 1K2I1 3OE7D 2FLBH 2FTLE 2GZ7A 2W3KA 5A0CA 1GJ5H 1DWDH 2Y5FA 1C1OA 1QTFA 4J2YB 1OP0A 5DJ7A 4JCNA 3H7TA 2D2DA 1GBBA 3M5MA 5FPSA 2KCOA 4LZ4B 4X1RU 1WV7H 5EJLA 3FVFB 2TGDA 1HCGA 4GLYA 4P00A 4B1TA 1GDNA 1O3DA 3PWCA 1P2JA 1X7AC 3HK3B 3SJ9A 2FWWA 1S85A 1PQ8A 3FP6E 3RXOA 1O2MA 1O3HA 1SBWA 2FX6A 1UTNA 2FOAA 2BD8A 4WMEA 1PPGE 3R3GB 2F9OA 3H5CB 4NGAH 1NN6A 1H9HE 1C1NA 4MG3A 1O2RA 3WWFA 2D8WA 2NU1E 1HUTH 1A0JA 1ZGVA 8ESTE 1C2EA 3PRDA 1MAXA 1A5HA 2HPQH 3TH3H 1LCYA 4CRCA 1S82A 3B23B 5FBIA 1TIOA 1HPGA 1NFXA 1NU7B 3VFEA 1PPZA 1SGPE 3FAOA 4KKDA 3GY6A 1P2MA 1D3QB 2ZHWH 4OS5A 1BTXA 2H9EH 4WVPE 1OWIA 4ZROA 2KCYA 1YLCA 1HJAC 2PUQH 4MLFB 1BMFD 2BM2A 1BA8B 1T8OA 1EB2A 2GJGA 5G4BA 1DOJA 2XNIA 3A82A 3ZZ9A 4ACBA 5GPIB 5L2ZH 1Y5UT 1Z71A 1C2DA 1IQMA 5C1UA 1A46H 2W6ID 1AFQB 1HGTH 2ZKSA 1SOTA 3GY3A 1Z8JB 5LPRA 1UCYH 1SGEE 3FANA 1MTVA 5JBAS 4NCYA 4AB8A 6CHAB 3DT0H 4E06H 4Q80A 1GBIA 3M7UA 3UQOA 4NFEA 1ELGA 1FLEE 1C2IA 1QBOA 2XTTB 2BLWA 1P9UA 3N7DA 2ZQ2A 1HXFH 1AMHA 1HXEH 1V2UT 5F8ZA 3NK8A 1K28D 1O2KA 2WPKS 3A8AA 3PWBA 1YPKH 4HTCH 2K8IA 1HAGE 1Z7KA 3E8LA 1F0UA 1C1QA 2DUCA 3MU5A 1L1GA 3QZQA 1LKAA 3RXCA 1BBRH 1GL1A 4Y10E 3TH4H 4K3JA 1GI9B 3MH4A 1TBQH 2BQ7B 4RT1A 5DPAA 1UTLM 1GBAA 4CHAC 5C94A 1QR3E 3EDXB 1O3IA 1MU6B 1BCUH 2G55A 1QFKH 3UR9A 2VWNA 1SHYA 2PKAB 2ZHQH 4YXWD 1G3BA 3BEUA 3Q00A 2AGGX 1V2QT 2VIWA 2KCAA 1C5MD 4U01A 1V2LT 2P3FH 5JBCS 1SFIA 3AK5A 4FUDA 1SGCA 5EPYA 3GCOA 4LXBH 1QL8A 4FU9A 1U6QA 4RT0A 2AGEX 1ESBA 4ABDA 3SHAH 1HNEE 4UONA 4H6TA 1WXRA 3AAUA 2BY8X 2R2MB 1V2VT 5HIZA 1F0TA 4BTUB 2ZGXH 1C1WH 3RXEA 3UB0A 5EQSA 3LT3A 1BMMH 3N7EA 3RXTA 1DLKB 1HAVB 2FMJA 3QGJA 3NZIA 2EI7A 4NZLA 4AGJA 4I7YH 3GY5A 3ZVEA 1FY3A 2RA0A 2VIOA 4XSKU 5HXFA 2BTCE 1W0ZU 1C5TA 2AHME 5EXLA 3VB4A 4KP0A 1AKSB 2GCHG 2FLRH 4JZ1A 3A7WA 1C4Y2 1HAYB 2NU2E 5E2OA 3A89A 4YOJA 5IK2D 1SI5H 3SI3H 3MO9A 2LPRA 3K6YA 2BOHB 3E0NB 5DKMA 4K1TA 3BV9B 4RKOB 1V2NT 4Y71A 1NO9H 4A5TS 4NG9H 1RJXB 2P16A 3SU3A 2RDLA 2A2QH 3S9AA 4FUFA 8KME2 1O3KA 2PTCE 1AZZA 1W2KH 1YM0A 4H4FA 7ESTE 1BQYA 2H6MA 1TAWA 2PGBB 2G4TA 3RDZA 4ABHA 1IQNA 1BRCE 4MQAA 3F2HA 4X2VA 1TRYA 2GCTC 3V3MA 3RM0H 4XBDA 4UFDH 1DY9A 1EZXC 2FOMB 4YTAA 1KXAA 4A1TA 3SU2A 2LNCA 4AB9A 4Q7ZA 5FAHA 1C5XB 3SZEA 1UTKA 3BTHE 3MI4A 2QN5T 2VWMA 6LPRA 1GJDB 1A0HB 2YNBA 1DPOA 1ZHRA 2BLOA 3RMLH 3FP8E 1EJNA 3GISB 3MYWA 4XOJA 2V35A 1QQUA 2XCNA 3E91A 1UTQA 1Z8GA 2A32A 1TLDA 1FPCH 1HJ9A 1HV7A 1PFXC 2OK5A 1ZRBA 1L2EA 4P02A 1AUJA 3V7TA 2FZZA 1A1RA 4VGCC 4FOUC 2FS8A 2ZA5A 1EAUA 1EOLA 3LC5A 3SUGA 1P10A 1XKAC 4M9FA 4O03A 4WWYA 2A4GA 1VGCC 1VCQA 2F9PA 4FUBA 1NRRH 2Z9JA 1O2TA 4JZDH 4CRDA 2EY4C 1T8NA 3CS0A 5DP7A 1SQTA 1YY3A 2K1QA 2HALA 1QJ6B 2BD7A 1AWHB 4Z1MD 3M61U 1NFWA 1ZRKA 4KTUA 1P8VC 1G30B 2Q1JA 1TPOA 3V12A 4ZHLU 3KNXA 3LKWA 3M35A 1GHWH 4TY6A 1C1VH 2WPHS 4NFFA 1XVMA 1S81A 2VNTA 3TIUA 1KXEA 1O2YA 3A8BA 2QF4A 2F9UA 4JZEH 3EE7A 1TPAE 4QT8C 3B8JA 1O2PA 1WCZA 4LZ1H 1TONA 3FZDA 2NU3E 4ZMAH 1DX5M 4I31A 3BTKE 2BD2A 2WUCA 1ANCA 1ARCA 1YPLH 3F9FA 1ELBA 2B5TB 3OTJE 3KQEA 1GHBF 1C5ZB 3GYMA 1O3EA 4AC9A 2FP7B 1XUJA 1AVGH 1MU8B 3Q77A 2VB0A 3ZVBA 1K1IA 3BF6H 3SNDA 4CRBA 3SN8A 3LONA 2ZU4A 2G8TA 1GGDB 4X1SU 1J15A 3JZ1B 2C8YB 1AY6H 3WY8A 6ESTA 2F91A 2RDEA 5F8XA 1KDQB 1SGNE 4TPIZ 2UUFB 2BHGA 3P8GA 1OP2A 1TNJA 2XW9A 5DN6D 4K1EA 1P06A 3ZIAD 1J14A 1K1PA 1UJ1A 4XRNA 5EQRA 5CE1A 4UFGH 2ZFQH 1EB1H 2ALVA 1TMTH 2AIPA 1G36A 1LVBA 1C5UA 3SNAA 2AERH 1UCYE 4ABAA 1GJ6A 2IN2A 2A45B 3MNCA 1A4WH 1VITF 3OEED 3ITIA 3SO3A 5HIYA 2BZAA 1O2OA 1W10U 4OS6A 3UFAA 1LPZB 5EJ1A 4JMYA 3W1EA 4KTSA 4B2CA 5EXNA 2O8MA 1ZLRA 1O5AB 1GVKB 3TGJE 1FMGA 1IQIA 2OC7A 3KQBA 1W0KD 4TYDA 4CRAA 1OWDA 1RXPA 1RD3B 2GCHF 1KYNA 1IQHA 1V2KT 3M5OA 1GCTB 4ABBA 1HYLA 3K65B 4RN6A 1BBRE 3SQEE 2VIVA 1GDUA 1ZMJA 4SGAE 2ANMH 3F2GA 4Z6AH 2A4QA 2OP9A 1W13U 1FY4A 1GMCF 1Q31A 3HPTB 4MVNA 3H7OA 4IMZA 1KY9A 1KXFA 1FY5A 5LGOA 3SV6A 4YLUA 1SLVB 3SU5A 1QCPA 2QYIA 4GCHF 3EA8A 4IN1A 4D9RA 2JETC 2BYAX 2ZDKA 4ABFA 3O8DA 1O33A 2P93A 3CNRA 4AX9H 1ZHPA 1C5SA 2AYWA 3NWUA 4MPWA 2PKSC 1OWHA 2PSXA 2ZI2H 5GDSH 1F7ZA 5B6LA 2ZDNA 4BOHA 3TJNA 1QBVH 1V2OT 1ZTJA 1NTPA 2ZO3H 2TPIZ 4JYTA 2JH6D 5FL7D 3UWJH 3PYHA 1W0JD 3CP7A 3BTFE 5DSFA 1TGCA 3RXBA 3RXLA 2BQWB 2XYAA 3QTVH 4UD9H 3T2NA 3GY8A 3SJKA 1TNLA 8GCHF 2CK3D 3KQDA 3OYPA 1EFRD 1LHGH 4H42U 4AYYB 1LHCH 1ORFA 3VB7A 1E37B 2F9BH 2PFEA 1QB9A 3HKJB 3SJIA 4ZKOU 2WPIS 4TWYA 5C5OA 2UUKB 2V7QD 2SGQE 3CS7A 1W7XH 4ABGA 6GCHF 1A7SA 3QDZB 2FDAA 2WUBA 1ZPCA 3MNXA 1YYY1 5C1YA 2R0KA 4F49A 1C1UH 1UVSH 2V3MA 1V2RT 3VG8A 1TNGA 2F3CE 1HAPH 3EA9A 1UHBA 5EW2H 4ABIA 2G00A 3ZV8A 2VH0A 1EJMA 4CH8B 1CSOE 3ZVGA 1GBFA 5TJXA 3S69A 3KCGH 2V0BA 2JETB 4HZHA 2BLQA 3SZNA 4ISHH 1SKYE 1FONA 4MDSA 4GSOA 1OOKB 1PQAA 1T7CA 2PKSB 1P01A 1ZSLA 1C1RA 4UFEH 3E3TA 1B7XB 1EUFA 2Y6TA 3OY5U 1P2IA 2HOBA 4DOQA 1TYNA 4NWLA 4GUXA 1ID5H 4H6SB 1SC8U 5FPTA 3F1SB 3KQ5A 1BTWA 3QZRA 2B7DH 4WMDA 1GI8B 3BTGE 5B6OA 1G9IE 3DHKH 4OS7A 1YPMH 1TABE 1F2SE 1DXPA 3GCTG 1THSH 1O5BB 2FI5E 3AAVA 1SPJA 2OLGA 2BD4A 2C4FH 3QN7A 1V2MT 3F9HA 4Y11E 3ODFA 4DT4A 5GJ4B 4B74A 7GCHF 2PWXA 1SR5C 1O3JA 2BZ6H 5A8ZA 4O97A 1GBEA 5FCRA 2ZWLH 2EI6A 2G5NA 1BRUP 4UEHH 4MNWA 1XX9A 1AE8H 2BDHA 3U1JB 5F03A 2J2UA 4Y6DA 5T6GA 4X8TH 1EOJA 3QTOH 1Z6JH 4K8BA 5CHAB 3V13A 1P2KA 3A7YA 2DE8A 2ZC9H 3OY6U 4ZKNU 1N1LA 4AG1A 2C8XB 3OFND 1K9OE 1EP6A 2Z3DA 3M5NA 3QGNB 4WXVA 4CRFA 1UTMA 3SV9A 1OS8A 3U9AH 3TNTA 4FUGA 1SGFG 4GHQA 1DM4B 1C2KA 2ZCLP 2Z94A 4BXSA 3PLBA 3ATIA 1BOQA 2FI3E 1E35B 2BLVA 2GKVE 5GCHF 5A2MH 3FKSD 3TH2H 1K1JA 2J9NA 1YPJH 4WMFA 3M3SA 4IW4E 4ISLA 3FZZA 1EZSC 3SJ8A 4F55A 1O5EH 3SV7A 2VVUA 5AHGH 2ZCHP 1SL3A 1TGBA 1C2FA 2YOLA 4XDEA 1TPSA 2XBXA 4AFSA 1HRTH 3I29A 1MQ5A 3RXHA 2BY7X 1C5QA 2WPMS 4OGYA 3O8BA 1HJ8A 3QLPH 1ELFA 1KLTA 1YP9A 3A83A 3T27A 4FUHA 3LJOA 2SNWA 1TE0A 3SV2H 1GI5A 1OYQA 2ZNKH 4X2WA 1LKBA 2F9VA 4TT3D 1ELDE 1GMHG 1Q3XA 3E6PH 1YF4A 2A5IA 2PLXA 3A85A 5C3NA 3F9GA 1C2LA 1C9PA 2QIQA 2A7JA 3U1IB 2ZDLA 2Q6GA 1ANEA 3RLWH 1P09A 1S6FA 1UK3A 3DA9B 2NU0E 1HAZB 3F6UH 1EPTB 4NSYA 5A8XA 1E79D 3M5LA 2EC9H 1DDJA 1TOMH 2KAIB 1RTLA 1FN6A 3LU9B 3TK5A 4Q2KA 1SGQE 1QGFA 1VKYA 4NIVA 4IMQA 3SBKA 1O35A 1EZUC 3LH3A 2A1DB 4AFQA 2H9TH 4D9QA 4LK4A 1LQEA 1O2ZA 3TLOA 4BAHB 3S0NA 4YESB 3U8OH 1IQGA 1SLUB 5FHTA 3SYJA 2BDCA 2OINA 3RP2A 2SGPE 4FU7A 2PKAA 3HGPA 4GHTA 1QB1A 4A1VA 2Y5HA 2L6OA 1O3MA 2V6NA 3O8RA 2QXGA 2XBWA 1DE7H 2BOKA 2VU8E 4YOIA 1O32A 2TGTA 3VXEH 1GHAG 1IQKA 2SGEE 3N99A 2RG3A 1E36B 4O3TA 3C1KA 1A5IA 3ZYDA 3LGTA 2ZCKP 4AZ2B 4F4OC 2FOHA 2TGPZ 2GMTC 1Y8TA 2PR3A 3T29A 3BTDE 1WOFA 3SHCH 1HAVA 4IS5A 2A7CA 1O2GH 4NSVA 5JDUB 4A7IB 4MPUA 3UNQA 3LPRA 1GHVH 2Q6FA 2WV4A 4Y7BA 2CHAC 1AKSA 3IWMA 5EXMA 1J9CH 4K60A 3TVJB 1DSTA 3A7TA 1C2JA 2ZFFH 3E0PB 1LHFH 5EQQA 3SUDA 2KFWA 4X6NA 4X8VH 1TGNA 2XRCA 2XBVA 3A80A 2HNTF 4X6PA 5SGAE 1RTKA 2G81E 3E90B 3DUXH 3OEHD 5EOKA 1ETSH 3L3TA 1HDTH 3GCTF 4D76A 4AFZA 3VGCC 3A8DA 4MNXA 5J4SA 3D65E 2UWLA 4FUEA 4SGBE 2HGTH 2BD3A 2PTNA 1GHYH 1ESTA 1XXDA 1ETTH 1Z6EA 5EG4A 1MKWH 2J92A 1ELTA 4ZXYH 2AMQA 2Y7XA 2FPZA 1B5GH 1D6RA 1PJPA 2TRMA 3L6PA 5HM2A 1D3PB 2VVVA 3GS9A 3SU4A 5DP9A 3H09A 5K0HA 2ZFSA 1TWXB 1HJAB 1CT0E 5T6DA 1O30A 1JRSA 1SVPA 2ZHFH 1DT2A 3PTNA 1VITH 1GDQA 1V6DA 3LGYA 1DUEA 3MU4A 4O9VA 3BIUH 3U8RH 4X0WU 3P70B 1FI8A 2TIOA 3GDUA 3EQ0H 2P3TB 3TGIE 2JJ1D 1W11U 1UTJA 2PV9B 2GX4A 2UWOA 4GPGA 4NA8A 1F0SA 3T28A 2GMTB 3PLPA 4X8UH 3ZZAA 1LPGB 1GBKA 4IN2A 3RXJA 4A6LA 2BVXH 3RXRA 1MTWA 2J98B 1SQRA 1KLJH 1C1SA 3BTWE 2JIZD 4NA9H 1FAXA 1N6YA 2ZIQH 1MTUA 2QXJA 4MNVA 4BTTB 3LGUA 4DW2U 1V2PT 1H8IH 2R2WU 5ESTE 1EXFA 5IYTA 1GJBB 1BMAA 4KELA 4U2WA 2Z3CA 4Q63A 4ABJA 3STIA 4I8KA 3MO6A 2I6SA 2ZG0H 1FX0B 1NBME 1Y5AT 4CHAB 1DITH 1EAXA 2ULLA 3P8FA 2J5UA 1ZOMA 2ODYB 4B2BA 3TITA 1G2LA 3BEIB 1MTSA 1C4U2 5I46H 1S84A 1XMNB 1DSUA 1GI0A 3F3BA 2ZFTA 4FVBA 3SGBE 1NFYA 1RGQA 2ZTZA 2Y82A 2ODPA 3SNEA 2SGAA 1ZR0A 2FODA 1MCVA 4I8LA 1ELEE 1CQQA 2R3UA 3PV5A 1BRBE 2FOCA 2HVYB 1QHRB 1WBGB 4ZKSU 2V3HH 2I6QA 1XUIA 3P95A 1YC0A 1CGIE 1LO6A 1LHDH 1IQFA 4XD7D 3SJOA 2OTVA 3Q3KA 1PPCE 1GBDA 2STAE 1G3CA 2XOKD 5BPEA 4INKA 2ZU2A 3M36A 1T4VH 2FM2A 2JDID 1O3NA 2QXHA 1O3FA 2BY6X 5EODA 1P2QA 4AN7A 3UREA 1QJ7B 1HBTH 1MABB 1A2CH 2QV1A 2OXSA 1C5NH 1H8HD 3UUZA 2SFAA 1ZJDA 1TNHA 1H9IE 1ZSKA 2FI4E 3RMNH 3SOSA 1ABJH 3SGAE 1FY1A 1TGTA 3ENSB 4KGAA 1RS0A 3KGPA 2VH6A 2BVRH 1GI7B 1LHEH 2C8ZB 3BIVH 4ZHMU 3ZZ5A 1TX6A 4MTBA 2GTBA 5F8TA 2QCYA 1VJAU 1FIZA 4AGKA 1FJSA 1GHAF 5H4IB 5T6FA 1BDAA 1JBUH 1D9IA 2FOFA 1V3XA 2GCTB 2ILNA 5HMAA 1S6LA 1GMDG 1VCWA 1O3BA 1K1OA 3N7OA 1QA7A 2ZDMA 4RKJB 1W8BH 3P8NA 1PPBH 2WPJS 1CHOG 1BZXE 1OPHB 3UAIC 1V2ST 3MU8A 1ETRH 1P9SA 3AASA 5HYOA 2BDAA 4KTCA 3I78A 3F2FA 2ZHEH 3GY7A 2AMDA 4FVDA 3M3TA 9ESTA 1AFEH 3GDSA 1PYTD 5EPNA 3UY9A 1YPHC 4Y8YA 1O34A 4Q7YA 2ANWA 1O37A 4YT6H 4VGCB 2Y7ZA 2Y80A 5C17A 1XUFA 2XC4A 3MFJA 1K0HA 1YLDA 1BHXB 1C5WB 1EP5A 4WH6A 1XKBC 1VGCB 1AVXA 3SV8A 3MH6A 1TX8A 3RU4D 3LH1A 5DO4H 1FY8E 5DG6A 1TBRH 1O2IA 3BTTE 1TBZH 3ATWA 1QA0A 3WWBA 3ZVDA 4R8TB 3ESTA 1GHZA 3MH7A 3PB1E 2EA3A 1L1JA 1MAYA 1JWTA 2FXRA 3RXFA 3KL6A 1ZJKA 2XWBI 3I77A 4HI3A 1DICA 1GWAA 3GCHC 1HB0B 3A84A 5FPYA 1A3EH 2WPDD 1GG6C 4JK5A 1TFXA 3RUOA 1DXWA 1EX3A 1OWKA 3AVZA 1G2MA 2M2AA 5K7RA 2ZDAH 1QL7A 2W26A 1UVPA 1ELCA 1C2MA 3LGWA 1BJUA 3KQCA 2CF9H 2DE9A 1A3BH 1DANH 2OC1A 1WTHD 2FIRH 1S0QA 1WQSA 2BDYA 5JB9S 3TJOA 1P12E 2STBE 3TK9A 2BDBA 1TMBH 1YWUA 4JZFH 1K1NA 4Y0YE 2QF5A 1O2QA 1YPGH 1KMHB 1AD8H 1UTPA 4WXIA 1KXCA 3ATMA 2SGFE 1A0LA 4K2YA 4DT7B 1AB9C 1ANDA 2O8TA 4WY3A 1QQ4A 3VB5A 2R9PA 1BTYA 1T4UH 2OC0A 3UIRA 3VPKA 2FOBA 3MU1A 1O31A 1AUTC 3DSOA 3MNSA 5CDFE 3Q76A 1DLEA 2WZQA 1CBWC 5DK1A 3UNRA 2XC0A 4Y8XA 1IHSH 3PROA 4LOYH 2HNTC 1MCTA 4YZUA 3KEEA 4B76A 1TNKA 5E0HA 3M7TA 3S9CA 1TOCB 3EYDA 1O3OA 3SI4H 1GJCB 2K0QA 4ACAA 1CE5A 3QO6A 3E1XB 3SNCA 1JXPA 4I32A 4AORA 4CH2B 1WSSH 2YMSD 2V3OH 1Y5BT 4MNYA 4HGCA 2TGAA 2GDEH 2WINI 2XNDD 3OTPA 1UVOA 2P8OC 1DVAH 1KXBA 1XUKA 3UOUA 1OWJA 1LVMA 4ASUD 9LPRA 5T1VA 2BX4A 4UFFH 1EJAA 1NU9A 1QZ8A 2A2XH 1IOEA 2QC2A 4K1SA 4U32A 1SG8B 1FUJA 1BUIA 1BTUA 1O2NA 2CV3A 1C5OH 3MHWU 1WTGH 1B0EA 1SGFA 3QK1A 1B0FA 3PV4A 5ETXA 5KECA 1NT1A 1UMAH 1NPMA 1EATA 3AW1A 2J4IA 4IC5A 3EA7A 3BTME 2IPHA 1V2TT 2FESH 4I8JA 2JH0D 2AGIX 3LGIA 2ZHDA 2OC8A 4ISNA 2JKHA 2KX4A 3W95A 1F5LA 3Q3YA 3GOVB 4B6FA 3RXIA 2UUJB 1MKXK 2FYQA 5C2ZA 1GMDF 1TNIA 2W3IA 1QB6A 2TBSA 3KYFA 2JH5D 4Q7XA 4DIIH 2ZP0H 2BXUH 4K69A 1P05A 4X2YA 2R3YA 1CHOF 2BY9X 1P57B 4RSPA 1RFNA 3MMGA 2ZTXA 2W5EA 5HKKD 3R0FA 5LH8A 3LIWA 1E1QD 1T8MA 1HAIH 3A88A 4OS4A 1RRKA 1MZDA 2GGVB 2JJ2D 1LDTT 1C5VA 4BAOB 2HLCA 1O2WA 3TGKE 3RXSA 3LOXA 5EW1H 2PP6A 3EGKH 1QURH 2J94A 1LTOA 2C3SA 1WQVH 1THRH 2AH4X 1FZZA 5A8YA 4TSFD 1NY22 1Y3YA 1AI8H 1AE5A 1O5CB 3KIDU 4JK6A 2ALPA 1MKWK 3MH5A 3VB6A 1KTSB 4BXWA 3TK6A 2UUYA 1TMUH 4XBBA 2GZ8A 2HPPH 3RM2H 3RMMH 1P04A 3OAAD 1CO7E 2THFB 3TPIZ 3ATKA 2GZ9A 1XVOA 1AVWA 2D1JA 4AFUA 2Z6BD 1THPB 2QF3A 3ZYEA 1Y3VA 1DY8A 2OQ5A 1QRZA 1CT4E 2ZGHA 4X6MA 1EPTA 2WHXA 2PHBA 1YKTA 1HLTH 1SGTA 1GI6A 1NROH 1TB6H 1NRQH 1TA6A 2EQNA 5L6NH 4A1XA 5FBEA 1O2VA 4JZIA 1OX1A 3G01A 5C0UA 4JYVH 1EAWA 1Z1JA 1S0RA 2XXLA 3M37A 5C20A 3ZVAA 1VJ9U 5FX5A 4X8SH 2HVXA 3UWIA 2BB4A 3URDA 2C93B 1D3DB 1OP8A 1P2OA 4ABEA 1DWEH 1TPPA 2AFQB 2QAAA 3AW0A 3CENA 3D23A 4X2XA 3C27B 4YLQH 4ZHAA 3A7VA 1TX7A 4DURA 2VGCC 3DD2H 3RC5A 2Y5GA 2ZFRH 5EU8A 1O5DH 1Y3UA 8LPRA 4GVUA 2GT7A 3FP7E 4CR5A 4ZAEA 1OSSA 1CA0C 1Z8IB 2BDGA 5F6MA 1H8DH 1HIAB 1AFQC 3OSYA 4Z0KA 1CT2E 3KF2A 4UE7H 2BX3A 4BAMB 3EAJA 3MQKC 1ZZZA 2P59A 3S9BA 2FEQH 1GCDA 6CHAC 3NKKA 5HGGA 2BY5X 4DY7B 2Z9IA 4ZUHA 4Y0ZE 1NM6A 1ZPBA 1GBLA 1AQ7A 4ESTE 1RIWC 1MD7A 3SNBA 3HK6B 1VR1H 2G4UA 2ZU3A 3V0XA 3PMBB 2ZU5A 1SGRE 2G51A 1AU8A 2ZGJA 3FOAA 3PM3A 4JYUH 3ZV9A 1FN8A 1GBHA 3PV2A 1JOUB 1BJVA 1DWCH 2SGDE 1GI3A 3DSGA 2UWPA 2VWLA 4YO9A 1ZTLA 1P2NA 3IITA 2HRVA 4INLA 5T3HA 1A5GH 2AIQA 1NFUA 3MOCA 1FQ3A 1P03A 1YCPK 2F9NA 1YPHE 3RLYH 2J97A 1MMJN 1DS2E 1UTOA 3PO1C 1O3CA 2WV5A 3MWIU 1ZSJA 1WAYB 3ZZCA 3F0PA 4CBOA 4X1PU 5C0TA 1K1LA 1BITA 1T32A 5E0GA 3MNBA 2VGCB 5CMXH 5GIBA 1RTFB 3RXMA 1MKXH 3DFLA 5DP4A 2FTMA 1GBTA 1SQOA 3EE0B 1NBMD 1GI1A 1GBJA 1CA0B 4ZCNA 3P92A 3NRLA 4CBNA 1PYTC 1W0YH 1MBMA 3VB3A 1ELVA 1Y3WA 2FOGA 1L4ZA 1YGCH 3SGQE 2J98A 2F4LA 3RXVA 5EJZA 1N8OC 2OQUA 1J8AA 1O0DH 1P11E 1O5FH 4RI0A 2P94A 1OKXA 4E7NA 1RIWB 1UW7A 3S7HB 5DP3A 1QY6A 2YNAA 2IJD1 1Y59T 2OD3B 1QBNA 1TRMA 1D6WA 1GHBG 5E0JA 3L33A 2ZZUH 4XBCA 4NA7A 2QA9E 1O2LA 3GYLB 3ZZBA 1VCPA 3MU0A 4CREA 4FUCA 2BD5A 1O2SA 2C8WB 1PPFE 3TJUA 5I25A 3BG8A 1NC6A 5AF9H 1Z8RA 1MQ6A 1ZHMA 4XFQA 3SUEA 4I86A 3RXDA 1C1PA 1OWEA 3PO1B 3HKIB 3F9EA 1ELAA 4BTIB 4NIYA 5JB8S 1G37A 5IDKA 4ZH8A 1BIOA 2R0LA 2ESTE 5C5NA 5ABWA 4FU8A 3GDVA 1O38A 3URCA 3DSPA 1K22H 1VITG 2HNTE 3KN2A 4PROA 1QL9A 4B75A 4IC6A 2VINA 1ANBA 1YCPM 5FXLA 2VWOA 3LC3A 4YM9A 2ANYA 2W7SA 2CHAB 4ASHA 3TNSA 1N8OB 3JZ2B 2CGAA 4GAWA 2G52A 1H1BA 4WF8A 1KXDA 3RC6A 4U30A 1EZQA 3F68H 2BQ6B 1O2UA 1DWBH 3MO3A 2O8LA 1ZGIA 2H9HA 3P8OA 2A4OA 1ZYOA 4DG4A 1QIXB 2NU4E 2VIQA 3VGCB 1CA8B 1EAIA 2P3UB 4WJG2 1G3EA 2H1UA 1O3LA 1C5LH 1LVOA 2BXTH 1ZPZA 3STJA 1SOZA 2FYRA 3ODDA 1E34B 4TWWA 1GJAB 1GMCG 1IHTH 4X6OA 1INCA 1BTHH 1GJ8B 1GI4A 5TCCA 1QRXA 3QX5H 5DGJA 4GCHG 5DP8A 4I8HA 2ZPQA 3RMOH 4ISIH 4XE4A 3K9XB 2YMSC 3W94A 4MPVA 1SGYE 2KCPA 3RXAA 4ISOA 1GMHF 1FDPA 3LDXH 2C90B 4K8YA 4OGXA 5AFYH 4IGDA 3ZZ8A 4D7GA 1UO6A 1QJ1B 3SW2B 1LMWB 3U69H 1SFQB 2F43B 3GY2A 3E16B 1FAKH 5E8EH 4B71A 1LQDB 1W12U 2CJIA 5AVDA 5EIYA 5J4QA 4BANB 2EEKA 1P3CA 1JIRA 3NPSA 1D3TB 8GCHG 3RU4T 2A5AA 1P02A 2O8UA 1ACBE 3PLKA 3FN8A 1KDQA 1YCPH 2D26C 1WUNH 4DCDA 3D49H 3UOPA 1PPEE 3S7KB 2ZEBA 3M3VA 2L74A 3A81A 5ESBA 1GGDC 1IAUA 4NIXA 1F5KU 2Z9GA 3LJJA 6GCHG 2XC5A 1DFPA 1FXYA 3ZVFA 2H5DA 3PRBA 3ZZ3A 1CHGA 1XM1A 2WSSD 3SORA 1MZAA 1AIXH 1KLIH 1SLWB 3PMJA 1ZTKA 2AEIH 3UR6A 4ZKRU 1O3AA 5KEDA 2OCVB 1O5GH 2B0FA 1YPEH 1LVYA 1IQJA 1CVWH 3RXGA 4NZQA 2QY0B 1FV9A 4HG6A 1GHXH 5A0AE 1C1MA 1TQ7B 2NWNA 3RXPA 1UVUH 4I8GA 2GVFA 3BTQE 2Y81A 1HFDA 2YMSB 1C5PA 1D4PB 2ZFPH 3PTBA 3TU7H 4X1NU 1GI2A 1CGJE 1ZMLA 1XXFA 1NZQH 1QRWA 1C2HA 1E0FD 3HGNA 3U28C 3VXFH 1O2JA 3NXPA 1E38B 3RXQA 2WV9A 2F83A 1C2GA 3PMAB 3GY4A 3U8TH 1YLNA 5C1XA 2KZ4A 3T25A 3ZZ4A 2ZQ1A 1Y3XA 1SSXA 4I33A 2SNVA 1F5RA 1MD8A 1J16A 3BG4C 4O3UA 3RXKA 2GV7A 2OUAA 1GCTC 1KTTB 1QNJA 1W14U 4TPYA 4AOQA 3B9FH 2IOTA 1L1NA 4NIWA 5GXPA 1GJ9B 2FO9A 3SU0A 4DGJA 7GCHG 3QUMP 2PSYA 2ZF0H 7KMEH 2A0QB 2KR7A 1MUEB 2IPQX 1PQ5A 3QWCH 5JPMH 2IJOB 1C5RA 1MH0A 2VJ1A 1C1TA 1O2HA 2LELA 5CHBA 1TGSZ 5A09A 1MBQA 3MTYA 4E05H 3KYGA 1P0SH 4DJZB 3SU1A 1FIWA 3OU0A 5AFZH 1GBCA 4FETA 4Y76A 2J95A 4Y7AA 1FNIA 1F92A 4Y79A 2LP6A 2QXIA 1VZQH 4TY7A 3GICB 1AHTH 1NESE 3U98H 1MTNC 5FX6A 2J38A 1NRNH 3RC4A 4DVAU 3M7QA 5GCHG 3ZVCA 3Q3XA 1ABIH 2KM0A 1SGDE 2CXVA 2GV6A 2H2ZA 3ELAH 1GJ4H 3PMHB 5JBTA 2WYJA 3BG4B 2ODQA 2GDDA 1E1RD 1AWFH 3ZZDA 4ZXXH 3A7ZA 7LPRA 1NRPH 1H8ED 2ASUB 3ATLA 2ZGBH 4B73A 4J1YA 1SHHB 4IBLH 1O3GA 5JYIA 1XUGA 2QE7D 1WYKA 2QF0A 2CN0H 2ZGCA 2Z3EA 3UNSA 1OHHD 5LPEA 4E7RG 4OS1A 1EASA 1C5YB 4OM9A 4M7GA 5GNDA 2W6JD 2WPLS 2HWLB 2M5TA 1ZMNA 1KIGH 1NRSH 3O8CA 1ARBA 3GCHB 4OS2A 5A0BA 1BT7A 2VBCA 4FUJA 1GG6B 1G3DA 1S6HA 3DCLA 4DIHH 1AN1E 1N6XA 4AG2A 2FX4A 2FOEA 2VVCA 4K5ZA 1BB0B 3BSQA 4D8NA 1UK2A 1G32B 1AGJA 4D7FA 2W7UA 3K6ZA 5EGMA 2FS9A 5L30H 1S5SA 2RCEA 1V2WT 1O2XA 2G5VA 2CMYA 5LPFA 4X1QU 4WH8A 5C67A 5TCAA 2ANKH 5BRRE 1MTNB 1PPHE 3RU4E 2EI8A 1EKBB 4B2AA 2PGQB 2ZDVH 3TJVA
chains in the Genus database with same CATH topology
2AS9A 3BTEE 1SMFE 1XUHA 1F0RA 1AB9B 5PTPA 1O3PB 1PQ7A 3BN9A 3KHVA 1V2JT 4A92A 1OYTH 4UDWH 2Z7FE 2BMGB 3SUFA 3BEFB 1TALA 1CU1A 1GVLA 1CBWB 2WYGA 4BNRA 1ESAA 2OBQA 5CHAC 1JMOH 1AO5A 1EQ9A 3A86A 4THNH 2BVSH 1TA2A 1NS3A 1Z1IA 3VEQB 2B9LA 1HAXB 5DP6A 1UCYK 2GT8A 3A7XA 1BMLA 1JRTA 2Q6DA 2Z9LA 3T26A 4CR9A 1CGHA 1JIMA 2GP9B 1SB1H 1L0ZA 3T5FH 1FPHH 1GBMA 1L4DA 3ZZ6A 4HFPB 2P8OB 2XWAA 5L2YH 1BTPA 1UK4A 3SQHE 1K21H 2BD9A 3GCNA 2A5KA 4MPXA 2XBYA 2O9QA 3UTUH 3NUMA 3P6ZB 4FXGH 2A7HA 1SLXB 2P95A 2AMPA 2J34A 4NWKA 1O36A 2O8WA 2GD4B 4FUIA 4Y8ZA 5DP5A 1T31A 3FFGA 3NCLA 1BBRK 1GVZA 3HATH 3UPEA 1HAOH 1Q2WA 1SGIB 1HIAA 1HAHH 2ZTYA 1M9UA 4CRGA 3A87A 2OBOA 1GPZA 1A61H 3D62A 1OXGA 4AYVB 3SU6A 1O39A 2A31A 3K2UA 1UVTH 2B8OH 1BHXF 1UHBB 2ZPSA 5E2PA 1IQLA 1W3CA 5HM9A 1H9LB 1BTZA 2VIPA 3T62A 4BAQB 1YBWA 2ZECA 1BRAA 1S83A 2KAIA 2BDIA 1T8LA 1K1MA 1W7GH 2ZPRA 3DFJA 3LGVA 2A4RA 2H5CA 4YT7H 3P17H 1EPTC 2ZU1A 2Z9KA 1IQEA 3RXUA 2QGRA 1SQAA 4R0IA 1GL0E 1TQ0B 4INHA 3UQVA 1KSNA 4BAKB 5GWZA 1C9TA 2CF8H 1C4V2 1AZ8A 1DUAA 1GJ7B 1BMNH 1H4WA 5JBBS 4YOGA 1TRNA 1J17T 5FCKA 2XCFA 3ZZ7A 1LPKB 1P3EA 3IG6B 2VIDA 1WU1A 2RA3A 2PUXB 3A8CA 2PW8H 3OX7U 1K2I1 2FLBH 2FTLE 2GZ7A 2W3KA 5A0CA 1GJ5H 1DWDH 2Y5FA 1C1OA 1QTFA 4J2YB 1OP0A 5DJ7A 4JCNA 3H7TA 2D2DA 1GBBA 3M5MA 5FPSA 4LZ4B 4X1RU 1WV7H 3FVFB 2TGDA 1HCGA 4GLYA 4B1TA 1GDNA 1O3DA 3PWCA 1P2JA 1X7AC 3HK3B 3SJ9A 2FWWA 1S85A 1PQ8A 3FP6E 3RXOA 1O2MA 1O3HA 1SBWA 2FX6A 1UTNA 2FOAA 2BD8A 4WMEA 1PPGE 3R3GB 2F9OA 3H5CB 4NGAH 1NN6A 1H9HE 1C1NA 4MG3A 1O2RA 2D8WA 2NU1E 1HUTH 1A0JA 1ZGVA 8ESTE 1C2EA 1MAXA 1A5HA 2HPQH 3TH3H 1LCYA 4CRCA 1S82A 3B23B 5FBIA 1TIOA 1HPGA 1NFXA 1NU7B 3VFEA 1PPZA 1SGPE 3FAOA 4KKDA 3GY6A 1P2MA 1D3QB 2ZHWH 4OS5A 1BTXA 2H9EH 4WVPE 1OWIA 4ZROA 1YLCA 1HJAC 2PUQH 4MLFB 2BM2A 1BA8B 1T8OA 1EB2A 5G4BA 1DOJA 2XNIA 3A82A 3ZZ9A 5GPIB 5L2ZH 1Y5UT 1Z71A 1C2DA 1IQMA 5C1UA 1A46H 1AFQB 1HGTH 2ZKSA 1SOTA 3GY3A 1Z8JB 5LPRA 1UCYH 1SGEE 3FANA 1MTVA 5JBAS 4NCYA 4AB8A 6CHAB 3DT0H 4E06H 4Q80A 1GBIA 3M7UA 3UQOA 4NFEA 1ELGA 1FLEE 1C2IA 1QBOA 2XTTB 2BLWA 1P9UA 2ZQ2A 1HXFH 1AMHA 1HXEH 1V2UT 5F8ZA 3NK8A 1K28D 1O2KA 2WPKS 3A8AA 3PWBA 1YPKH 4HTCH 1HAGE 1Z7KA 3E8LA 1F0UA 1C1QA 2DUCA 3MU5A 1L1GA 3QZQA 1LKAA 3RXCA 1BBRH 1GL1A 4Y10E 3TH4H 4K3JA 1GI9B 3MH4A 1TBQH 2BQ7B 5DPAA 1UTLM 1GBAA 4CHAC 1QR3E 3EDXB 1O3IA 1MU6B 1BCUH 2G55A 1QFKH 3UR9A 2VWNA 1SHYA 2PKAB 2ZHQH 1G3BA 3BEUA 3Q00A 2AGGX 1V2QT 2VIWA 1C5MD 4U01A 1V2LT 2P3FH 5JBCS 1SFIA 4FUDA 1SGCA 5EPYA 3GCOA 4LXBH 1QL8A 4FU9A 1U6QA 2AGEX 1ESBA 4ABDA 3SHAH 1HNEE 4UONA 4H6TA 3AAUA 2BY8X 2R2MB 1V2VT 1F0TA 4BTUB 2ZGXH 1C1WH 3RXEA 5EQSA 3LT3A 1BMMH 3RXTA 1DLKB 1HAVB 2FMJA 3QGJA 3NZIA 2EI7A 4NZLA 4AGJA 4I7YH 3GY5A 3ZVEA 1FY3A 2RA0A 2VIOA 4XSKU 5HXFA 2BTCE 1W0ZU 1C5TA 5EXLA 3VB4A 4KP0A 1AKSB 2GCHG 2FLRH 4JZ1A 3A7WA 1C4Y2 1HAYB 2NU2E 5E2OA 3A89A 4YOJA 1SI5H 3SI3H 3MO9A 2LPRA 3K6YA 2BOHB 3E0NB 5DKMA 4K1TA 3BV9B 4RKOB 1V2NT 4Y71A 1NO9H 4A5TS 4NG9H 1RJXB 2P16A 3SU3A 2RDLA 2A2QH 3S9AA 4FUFA 8KME2 1O3KA 2PTCE 1AZZA 1W2KH 1YM0A 4H4FA 7ESTE 1BQYA 2H6MA 1TAWA 2PGBB 2G4TA 3RDZA 4ABHA 1IQNA 1BRCE 4MQAA 4X2VA 1TRYA 2GCTC 3V3MA 3RM0H 4XBDA 4UFDH 1DY9A 1EZXC 2FOMB 4YTAA 1KXAA 4A1TA 3SU2A 2LNCA 4AB9A 4Q7ZA 5FAHA 1C5XB 1UTKA 3BTHE 3MI4A 2QN5T 2VWMA 6LPRA 1GJDB 1A0HB 2YNBA 1DPOA 1ZHRA 2BLOA 3RMLH 3FP8E 1EJNA 3GISB 3MYWA 4XOJA 2V35A 1QQUA 2XCNA 3E91A 1UTQA 1Z8GA 2A32A 1TLDA 1FPCH 1HJ9A 1HV7A 1PFXC 1ZRBA 1L2EA 1AUJA 3V7TA 2FZZA 1A1RA 4VGCC 2FS8A 2ZA5A 1EAUA 1EOLA 3LC5A 3SUGA 1P10A 1XKAC 4O03A 4WWYA 2A4GA 1VGCC 1VCQA 2F9PA 4FUBA 1NRRH 2Z9JA 1O2TA 4JZDH 4CRDA 1T8NA 3CS0A 5DP7A 1SQTA 2K1QA 2HALA 1QJ6B 2BD7A 1AWHB 3M61U 1NFWA 1ZRKA 4KTUA 1P8VC 1G30B 2Q1JA 1TPOA 3V12A 4ZHLU 3KNXA 3LKWA 3M35A 1GHWH 4TY6A 1C1VH 2WPHS 4NFFA 1XVMA 1S81A 2VNTA 3TIUA 1KXEA 1O2YA 3A8BA 2F9UA 4JZEH 1TPAE 4QT8C 3B8JA 1O2PA 1WCZA 4LZ1H 1TONA 3FZDA 2NU3E 4ZMAH 1DX5M 4I31A 3BTKE 2BD2A 2WUCA 1ANCA 1ARCA 1YPLH 3F9FA 1ELBA 2B5TB 3OTJE 3KQEA 1GHBF 1C5ZB 3GYMA 1O3EA 2FP7B 1XUJA 1AVGH 1MU8B 3Q77A 2VB0A 3ZVBA 1K1IA 3BF6H 3SNDA 4CRBA 3SN8A 3LONA 2ZU4A 2G8TA 1GGDB 4X1SU 1J15A 3JZ1B 2C8YB 1AY6H 3WY8A 6ESTA 2F91A 5F8XA 1KDQB 1SGNE 4TPIZ 2UUFB 2BHGA 3P8GA 1OP2A 1TNJA 2XW9A 4K1EA 1P06A 1J14A 1K1PA 1UJ1A 5EQRA 5CE1A 4UFGH 2ZFQH 1EB1H 2ALVA 1TMTH 2AIPA 1G36A 1LVBA 1C5UA 3SNAA 2AERH 1UCYE 4ABAA 1GJ6A 2IN2A 2A45B 3MNCA 1A4WH 1VITF 3ITIA 3SO3A 2BZAA 1O2OA 1W10U 4OS6A 3UFAA 1LPZB 4JMYA 4KTSA 4B2CA 5EXNA 2O8MA 1ZLRA 1O5AB 1GVKB 3TGJE 1FMGA 1IQIA 2OC7A 3KQBA 4TYDA 4CRAA 1OWDA 1RXPA 1RD3B 2GCHF 1KYNA 1IQHA 1V2KT 3M5OA 1GCTB 4ABBA 1HYLA 3K65B 4RN6A 1BBRE 3SQEE 2VIVA 1GDUA 1ZMJA 4SGAE 2ANMH 4Z6AH 2A4QA 2OP9A 1W13U 1FY4A 1GMCF 1Q31A 3HPTB 4MVNA 3H7OA 4IMZA 1KY9A 1KXFA 1FY5A 5LGOA 3SV6A 4YLUA 1SLVB 3SU5A 1QCPA 2QYIA 4GCHF 3EA8A 4IN1A 4D9RA 2JETC 2BYAX 2ZDKA 4ABFA 3O8DA 1O33A 2P93A 4AX9H 1ZHPA 1C5SA 2AYWA 3NWUA 4MPWA 2PKSC 1OWHA 2PSXA 2ZI2H 5GDSH 1F7ZA 2ZDNA 4BOHA 3TJNA 1QBVH 1V2OT 1ZTJA 1NTPA 2ZO3H 2TPIZ 4JYTA 2JH6D 3UWJH 3PYHA 3CP7A 3BTFE 1TGCA 3RXBA 3RXLA 2BQWB 2XYAA 3QTVH 4UD9H 3T2NA 3GY8A 3SJKA 1TNLA 8GCHF 3KQDA 3OYPA 1LHGH 4H42U 4AYYB 1LHCH 1ORFA 3VB7A 1E37B 2F9BH 2PFEA 1QB9A 3HKJB 3SJIA 4ZKOU 2WPIS 4TWYA 5C5OA 2UUKB 2SGQE 3CS7A 1W7XH 4ABGA 6GCHF 1A7SA 3QDZB 2FDAA 2WUBA 1ZPCA 3MNXA 1YYY1 5C1YA 2R0KA 4F49A 1C1UH 1UVSH 1V2RT 1TNGA 2F3CE 1HAPH 3EA9A 1UHBA 5EW2H 4ABIA 2G00A 3ZV8A 2VH0A 1EJMA 4CH8B 1CSOE 3ZVGA 1GBFA 5TJXA 3S69A 3KCGH 2V0BA 2JETB 4HZHA 2BLQA 3SZNA 4ISHH 1FONA 4MDSA 4GSOA 1OOKB 1PQAA 1T7CA 2PKSB 1P01A 1ZSLA 1C1RA 4UFEH 3E3TA 1B7XB 1EUFA 2Y6TA 3OY5U 1P2IA 2HOBA 4DOQA 1TYNA 4NWLA 4GUXA 1ID5H 4H6SB 1SC8U 5FPTA 3F1SB 1BTWA 3QZRA 2B7DH 4WMDA 1GI8B 3BTGE 5B6OA 1G9IE 3DHKH 4OS7A 1YPMH 1TABE 1F2SE 1DXPA 3GCTG 1THSH 1O5BB 2FI5E 3AAVA 1SPJA 2OLGA 2BD4A 2C4FH 3QN7A 1V2MT 3F9HA 4Y11E 3ODFA 5GJ4B 4B74A 7GCHF 2PWXA 1SR5C 1O3JA 2BZ6H 5A8ZA 4O97A 1GBEA 5FCRA 2ZWLH 2EI6A 2G5NA 1BRUP 4UEHH 4MNWA 1XX9A 1AE8H 2BDHA 3U1JB 5F03A 2J2UA 4Y6DA 5T6GA 4X8TH 1EOJA 3QTOH 1Z6JH 4K8BA 5CHAB 3V13A 1P2KA 3A7YA 2DE8A 2ZC9H 3OY6U 4ZKNU 1N1LA 4AG1A 2C8XB 1K9OE 1EP6A 2Z3DA 3M5NA 3QGNB 4WXVA 4CRFA 1UTMA 3SV9A 1OS8A 3U9AH 3TNTA 4FUGA 1SGFG 4GHQA 1DM4B 1C2KA 2ZCLP 2Z94A 4BXSA 3PLBA 3ATIA 1BOQA 2FI3E 1E35B 2BLVA 2GKVE 5GCHF 5A2MH 3TH2H 1K1JA 2J9NA 1YPJH 4WMFA 3M3SA 4IW4E 4ISLA 3FZZA 1EZSC 3SJ8A 1O5EH 3SV7A 2VVUA 5AHGH 2ZCHP 1SL3A 1TGBA 1C2FA 2YOLA 4XDEA 1TPSA 2XBXA 4AFSA 1HRTH 3I29A 1MQ5A 3RXHA 2BY7X 1C5QA 2WPMS 4OGYA 3O8BA 1HJ8A 3QLPH 1ELFA 1KLTA 1YP9A 3A83A 3T27A 4FUHA 3LJOA 2SNWA 1TE0A 3SV2H 1GI5A 1OYQA 2ZNKH 4X2WA 1LKBA 2F9VA 1ELDE 1GMHG 1Q3XA 3E6PH 1YF4A 2A5IA 2PLXA 3A85A 5C3NA 3F9GA 1C2LA 1C9PA 2QIQA 2A7JA 3U1IB 2ZDLA 2Q6GA 1ANEA 3RLWH 1P09A 1S6FA 1UK3A 3DA9B 2NU0E 1HAZB 3F6UH 1EPTB 4NSYA 5A8XA 3M5LA 2EC9H 1DDJA 1TOMH 2KAIB 1RTLA 1FN6A 3LU9B 3TK5A 4Q2KA 1SGQE 1QGFA 4NIVA 4IMQA 3SBKA 1O35A 1EZUC 3LH3A 2A1DB 4AFQA 2H9TH 4D9QA 4LK4A 1LQEA 1O2ZA 3TLOA 4BAHB 3S0NA 4YESB 3U8OH 1IQGA 1SLUB 5FHTA 2BDCA 2OINA 3RP2A 2SGPE 4FU7A 2PKAA 3HGPA 4GHTA 1QB1A 4A1VA 2Y5HA 1O3MA 2V6NA 3O8RA 2QXGA 2XBWA 1DE7H 2BOKA 2VU8E 4YOIA 1O32A 2TGTA 3VXEH 1GHAG 1IQKA 2SGEE 2RG3A 1E36B 4O3TA 3C1KA 1A5IA 3ZYDA 3LGTA 2ZCKP 4AZ2B 4F4OC 2FOHA 2TGPZ 2GMTC 1Y8TA 2PR3A 3T29A 3BTDE 1WOFA 3SHCH 1HAVA 4IS5A 2A7CA 1O2GH 4NSVA 5JDUB 4A7IB 4MPUA 3UNQA 3LPRA 1GHVH 2Q6FA 2WV4A 4Y7BA 2CHAC 1AKSA 3IWMA 5EXMA 1J9CH 4K60A 3TVJB 1DSTA 3A7TA 1C2JA 2ZFFH 3E0PB 1LHFH 5EQQA 3SUDA 4X6NA 4X8VH 1TGNA 2XRCA 2XBVA 3A80A 2HNTF 4X6PA 5SGAE 1RTKA 2G81E 3E90B 3DUXH 5EOKA 1ETSH 3L3TA 1HDTH 3GCTF 4D76A 4AFZA 3VGCC 3A8DA 4MNXA 5J4SA 3D65E 2UWLA 4FUEA 4SGBE 2HGTH 2BD3A 2PTNA 1GHYH 1ESTA 1XXDA 1ETTH 1Z6EA 5EG4A 1MKWH 2J92A 1ELTA 4ZXYH 2AMQA 2Y7XA 2FPZA 1B5GH 1D6RA 1PJPA 2TRMA 3L6PA 5HM2A 1D3PB 2VVVA 3SU4A 5DP9A 5K0HA 2ZFSA 1TWXB 1HJAB 1CT0E 5T6DA 1O30A 1JRSA 1SVPA 2ZHFH 1DT2A 3PTNA 1VITH 1GDQA