2A4OA

Dual modes of modification of hepatitis a virus 3c protease by a serine derived beta-lactone: selective crytstallization and high resolution structure of the his102 adduct
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
b'STLEIAGLVRKNLVQFGVGEKNGSVRWVMNALGVKDDWLLVPSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAWRGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable protein P3C
molecule tags Hydrolase
source organism Human hepatitis a virus hu/northern africa/mbb/1978
publication title Dual Modes of Modification of Hepatitis A Virus 3C Protease by a Serine-derived beta-Lactone: Selective Crystallization and Formation of a Functional Catalytic Triad in the Active Site
pubmed doi rcsb
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a4oA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a4oA02
2ZFSA 4MNXA 1CVWH 4IC5A 1NRQH 1GI0A 3T27A 1UTNA 1HCGA 3T5FH 1SGRE 1BA8B 1P03A 5DGJA 1P2MA 2GP9B 1DUEA 3O8DA 3ZVCA 3SV8A 3AASA 4YTAA 1ARBA 1P2OA 1LDTT 2H9EH 4AG1A 1VGCC 1CBWC 1XKBC 2VGCB 3E90B 4BNRA 1TX7A 3LONA 2QF3A 4ZKSU 2G4UA 4BAHB 1TNKA 4MPXA 4ISNA 4CREA 1IQEA 1J16A 2A5IA 5GPIB 2G51A 2SFAA 3A88A 3NKKA 2ODPA 2WV4A 2WYJA 3RP2A 1ZGIA 1K2I1 2ZFPH 2Z9GA 3PLKA 3RMMH 3ZZ8A 1L1GA 1BQYA 4X1QU 1BTPA 1P9SA 4ZUHA 4YOJA 2PR3A 1DXPA 1ZJKA 3BEFB 5EQSA 1GHBG 4ZKNU 1SLXB 4YESB 2CF9H 2J38A 2BD5A 1SBWA 1TGCA 3A85A 2XBXA 2THFB 1IQNA 1K1PA 3H5CB 2ZNKH 1AVWA 2ZDAH 2XTTB 5A0BA 2B8OH 1GI6A 1D6WA 2EI8A 1C2LA 1ZRKA 2H9TH 1C1SA 1WQVH 1XMNB 3TNTA 1ZRBA 3E0PB 1C5TA 1TB6H 3B8JA 1GI5A 3MMGA 4HI3A 1O2PA 4XFQA 4NFEA 4NG9H 3OY5U 1UHBA 2OQ5A 3MNSA 1G3BA 4DOQA 1L4DA 1QURH 1XUJA 1O2IA 4E7RG 1VGCB 4MPWA 2BDGA 4YZUA 2GGVB 2VWNA 4K60A 2J9NA 1JWTA 1S0RA 2A7JA 1GBLA 1IHSH 1UTOA 2BVRH 3LGWA 4B74A 2OUAA 2O9QA 2O8UA 4FUHA 2BY8X 1O33A 3KQCA 1Y5UT 1ID5H 1A5IA 1C1WH 3CENA 1O3IA 1K28D 2WYGA 1P8VC 1C9TA 3HGNA 3QGNB 1WTHD 1DDJA 1Y3XA 1OPHB 2ZKSA 4WH6A 1XUGA 2XW9A 3UY9A 1U6QA 4CRBA 1ELEE 1EOLA 5H4IB 2QF0A 3FP8E 2PWXA 5F03A 1C2DA 2W3IA 4NCYA 1F0RA 4K8BA 1DSTA 1UVTH 1JBUH 1ANEA 4WMEA 1MTVA 3BTKE 4GLYA 1KIGH 1AIXH 1NFUA 2BY9X 4B2AA 1LMWB 1NESE 2OCVB 1A5GH 1AFQC 2BDBA 1IQGA 3GCTG 2C4FH 4JK6A 4GVUA 1TQ7B 2SGPE 1F0SA 3SUFA 1O0DH 1O3LA 4H42U 4I31A 4OS5A 5L6NH 2FI4E 4CR5A 1PQ8A 1TAWA 3E1XB 3F9GA 3RXIA 1N8OC 1UCYE 1RFNA 3A8AA 5GXPA 1V2RT 3RXBA 2GTBA 4NWKA 4XBCA 2CN0H 4AORA 1VITF 4JZEH 1BBRK 2SGDE 1CHGA 2Q6DA 3KHVA 4XBDA 1GGDC 2JKHA 3C1KA 2BD7A 2D2DA 1UTMA 1SHHB 1NU9A 2B9LA 1C5UA 1K1MA 3RXUA 1OP8A 4Y7AA 1SGPE 4IW4E 1QRZA 3V0XA 5CHAB 1C5PA 1QRXA 1P01A 1SL3A 1GBKA 1Z8RA 1AN1E 2VIVA 2ZWLH 3TITA 2A7CA 3GISB 2QC2A 4BXSA 1ZMNA 5HM2A 2G55A 1T4UH 4BAKB 1HJ9A 4Y71A 3A89A 1C5WB 2P3UB 1CA0C 3BTDE 2Y80A 1KXFA 1FN6A 4IMQA 4Y0YE 1QA0A 1TIOA 2IJOB 3TGIE 4FUJA 3QO6A 5EG4A 1GI8B 4LOYH 3T26A 2B7DH 1RS0A 2F9UA 2FODA 2O8WA 1G2MA 1TGNA 3RUOA 2FS8A 3QTOH 4H6SB 5JDUB 1P09A 3M37A 1N6XA 3EYDA 4B1TA 2F83A 1WSSH 1TFXA 4CRDA 1WV7H 1MU8B 1HAVA 3OU0A 3KN2A 4B73A 1IOEA 3UWIA 5DP7A 1EPTA 1OWDA 1W10U 1FONA 2A5AA 1GGDB 3M3SA 4Y76A 5E2OA 4OS1A 3MNBA 1QIXB 1JMOH 2HGTH 2Y5GA 1T31A 4ABHA 2ANYA 3BG4C 3K9XB 1ZR0A 3S7HB 4WJG2 1ZHPA 3GY7A 4X8SH 3BTGE 1EZUC 2FLBH 4CRFA 5FCKA 1THRH 4KTUA 3S7KB 1TABE 1IQMA 4Y10E 2D1JA 3PMBB 5HYOA 1H4WA 1GCTC 2J92A 6CHAC 1W14U 2VWOA 3EA9A 1V2WT 1P2NA 2R2WU 1DM4B 3BG8A 2BB4A 1N6YA 2A4RA 4UE7H 4DW2U 2H9HA 1VR1H 5LGOA 1C2KA 1HXFH 1GBIA 3RM0H 3T29A 5TCAA 1L2EA 1QL7A 4X6NA 1LKBA 3E91A 2ALPA 5JBCS 1DWDH 3LPRA 1A4WH 1C2JA 5CMXH 3BTME 3ELAH 2BMGB 5C1YA 3OSYA 3ESTA 4ABGA 1EOJA 4O3TA 2DE9A 3PMJA 1CGHA 1WOFA 1W12U 4WY3A 2VVVA 2ZU3A 1QJ1B 1MCVA 4NIWA 3RXRA 2RA0A 3A81A 2ANWA 3F1SB 1O2RA 1WAYB 3P17H 5EQRA 2JH6D 3PLBA 5JBBS 1MH0A 2ZCLP 1BIOA 1C9PA 2ZGJA 4JK5A 1BOQA 3PM3A 4A5TS 4AFUA 1MAYA 5C67A 4CRCA 1GCTB 3PLPA 3AAUA 1DXWA 4ABJA 1EJNA 2ZTZA 1GMDG 1RXPA 4NFFA 1IQHA 4TPIZ 2NU3E 1XKAC 4J2YB 2BDIA 1ZPZA 4OGXA 2R0LA 2OC1A 2CF8H 5A8YA 3TH2H 2ASUB 4NIXA 2BDYA 9ESTA 3ZVAA 3SU4A 1GI7B 2HNTF 3MTYA 4K2YA 7LPRA 3SV7A 2PKAA 2IPHA 2FESH 3DT0H 4A6LA 2ZPRA 3RC6A 1D9IA 1HAYB 2SGAA 1NS3A 1TPPA 1A3EH 3SNCA 2QXHA 1BDAA 3M7UA 2Q6GA 1O3JA 3SU0A 3TJUA 2LNCA 1BTZA 1TBZH 1SPJA 3LGUA 1UMAH 3KF2A 1K1IA 5SGAE 1SLWB 2ZTXA 2FX6A 5HM9A 1A3BH 1SQAA 4WMFA 1XUHA 2BX4A 1XXDA 3DFLA 1ESTA 2GZ8A 2CHAB 3B9FH 1EUFA 2DUCA 4B2BA 2VIPA 3ZZ3A 1SHYA 2ZPSA 4GPGA 4GSOA 2PKSB 1EQ9A 3U8OH 2UUKB 1ELBA 3ATKA 4X2XA 3O8RA 3P8NA 1AU8A 1MMJN 1SFQB 2IOTA 1ELCA 1SGFG 1ZGVA 1VCPA 3QUMP 1E37B 3A8BA 1FIWA 1JRSA 1BJVA 3A83A 3P95A 3SBKA 1P2IA 1XUFA 4KTSA 4GHTA 4WWYA 1CGJE 7KMEH 1O2UA 3NCLA 1QL9A 1ACBE 1S83A 3CP7A 1CQQA 1TLDA 1QGFA 1ANBA 1PJPA 4OS2A 1LPKB 3QK1A 2OBQA 2JH5D 5EXLA 2R3UA 1V2KT 2TGAA 3EDXB 1K1JA 2FDAA 3ATLA 5JB9S 1P05A 4K1TA 2TGPZ 1GBMA 3SGQE 2Y5HA 1FY8E 4DY7B 3W95A 2FWWA 1TNGA 2ZU5A 3LU9B 1UVSH 1C1MA 1DLKB 3BF6H 4KTCA 1ELDE 1BRBE 1EZXC 1T32A 4LZ1H 2FI5E 1C5NH 2BQ6B 1QBNA 5DJ7A 1TX6A 3PWBA 2KAIA 4SGAE 2YNAA 2Z9LA 1THPB 1VCWA 1F5KU 4R0IA 1EXFA 2VB0A 3CS7A 1RD3B 2VINA 4DT7B 2BLOA 2Z3EA 3RXMA 3ODDA 2VIQA 1C2IA 4MNWA 5LPRA 3LOXA 4UDWH 4MVNA 3A7YA 1LO6A 1NU7B 3TK5A 4BTUB 2OINA 1AVGH 3HK6B 3DHKH 3RXJA 3ENSB 1YCPM 2BZAA 3GY8A 1HFDA 4FUEA 2PW8H 1H9IE 3T62A 2QV1A 5EW1H 4AB9A 1TA6A 2PTNA 2SNWA 3MWIU 4I8KA 4Q7XA 2WV5A 1GHWH 5GWZA 1FJSA 1DICA 1O34A 3L33A 3B23B 1J15A 3Q00A 1HIAA 2QIQA 3U1JB 1CT2E 3T25A 1CSOE 1OXGA 1EAXA 3G01A 1C5VA 3TK6A 3BTQE 1KY9A 8GCHF 2BM2A 1JIMA 4B71A 1AUJA 2BY5X 4WH8A 2R0KA 2V6NA 1V2MT 1GI2A 2GMTC 1TGSZ 3DD2H 2XBWA 4PROA 2Q1JA 1TRYA 2C8ZB 2ZI2H 1TOMH 1ZPBA 1KLTA 2B5TB 4ABFA 1ELAA 2XRCA 2CGAA 5EPNA 4ZHLU 1YPGH 4X1PU 4DGJA 1CGIE 1UK2A 4ZXYH 7GCHF 2QGRA 1LTOA 1NPMA 3R3GB 2FXRA 1SGFA 1YPJH 2GKVE 1CE5A 3L6PA 4IC6A 3QLPH 3UOUA 3LC5A 2P3FH 4AN7A 2ZDKA 1SQTA 3GY5A 6GCHG 4HZHA 1L4ZA 1HAHH 2A4GA 2BZ6H 1GG6C 4ZHAA 3E8LA 5GDSH 1C1QA 1SMFE 3UNQA 1FI8A 1DPOA 2BD4A 3S0NA 1LHEH 4VGCB 1SC8U 1O37A 4WMDA 1AVXA 1SOZA 3IG6B 1WCZA 2ANMH 1W8BH 1YYY1 2FZZA 3KQBA 2ZQ1A 1MZDA 4AFQA 1LKAA 1VJ9U 5EOKA 1Q3XA 2OXSA 1LQEA 2GVFA 2RCEA 4UFDH 5E0JA 2FYQA 1O3BA 2Z7FE 1SB1H 3EE0B 4THNH 2SNVA 3M61U 4MQAA 1W7XH 2WUCA 1O2ZA 2W7UA 1MZAA 3V13A 2NU2E 1Y59T 1GL1A 1TONA 1XVMA 1YCPH 2FOAA 2VWLA 8ESTE 1QFKH 2RA3A 1XUIA 4YLQH 5JBTA 1H8DH 1ZMJA 2ZECA 1L1JA 4AGJA 1Y5AT 2BY7X 3UTUH 3BEIB 2BTCE 2ZHQH 1P3CA 2FOEA 1P02A 2PSYA 1HXEH 1IQKA 4BOHA 2Y81A 1G36A 2ZGCA 1GBBA 1GBFA 4O3UA 2J94A 1TWXB 2P3TB 1V2PT 1MQ6A 1O5GH 1QQ4A 1O3DA 2KAIB 1G37A 1M9UA 2RG3A 1TQ0B 1TPSA 4X6PA 3A8CA 3SORA 1NFYA 4BAQB 5FX6A 1NTPA 1DT2A 1HIAB 3MH7A 4Q7ZA 1EPTB 4ABAA 1ZYOA 3GYMA 1E0FD 6GCHF 1AE8H 4X6MA 5IYTA 3ZV8A 3NXPA 1B0FA 1Y3YA 3RC5A 1HJ8A 3DUXH 3ZZ9A 2AIQA 1XVOA 4MLFB 1V2UT 2WPJS 4GCHG 3M7QA 2O8LA 3VXFH 1A7SA 1Z8IB 2AYWA 2ZGXH 2ZG0H 3EGKH 2CV3A 2OBOA 3GOVB 1O3KA 4ASHA 1BRCE 3LH1A 4X1SU 4Y11E 4K1SA 1DWEH 4FXGH 2BVSH 1E35B 1KSNA 2ZDVH 1BHXF 1FY5A 1K1LA 1RIWC 2JH0D 3SW2B 1UCYK 2G5VA 1TRMA 3BV9B 7ESTE 1EB1H 1K9OE 5IDKA 1V6DA 3CS0A 2HPPH 4I8HA 1AB9C 1T8MA 1BMMH 2ZDNA 1FXYA 1DSUA 3HGPA 3TJNA 3M5MA 4X1NU 2PLXA 2AMPA 1EJAA 1TMBH 1Z8JB 4BTIB 2VWMA 3KQDA 5ABWA 1EJMA 1Y3UA 1NN6A 4CBNA 2WPLS 3GY6A 3M5LA 3MU1A 3FZDA 3M5OA 1DLEA 1J17T 2BXTH 4FVBA 1VITG 5CHAC 1DOJA 4NWLA 1GMCF 2GX4A 4XBBA 1O5EH 4UFGH 1O5FH 4HGCA 1KLIH 1C5SA 1UTPA 5FCRA 4K69A 2ZFQH 1KXCA 1YPHE 1RTFB 3RXEA 1ANDA 1YM0A 1O5BB 1V3XA 3A86A 3RXPA 1TGTA 4Y8XA 3MOCA 3AVZA 1FLEE 3U1IB 1DY9A 5FX5A 5J4QA 1HAZB 3GY4A 3VB5A 3LGVA 1ARCA 1RGQA 1S84A 2ZGBH 5T3HA 4LK4A 2NWNA 1Z1IA 3KEEA 4CHAC 2ZU1A 3K2UA 1ZSJA 1C5QA 1O3NA 1SG8B 5TCCA 1DITH 2Z9IA 3RXVA 5I25A 4J1YA 1RIWB 2UWOA 2FEQH 1P0SH 1MTNC 1O2HA 1QY6A 5FPYA 2C8XB 2GV6A 1C1UH 3KCGH 2P59A 2NU0E 3UQOA 1EATA 4X2WA 4UONA 1O2JA 2BOKA 5A8ZA 2FOFA 1FPHH 2C93B 1HLTH 2Y7ZA 1YPEH 2I6QA 1A1RA 1UK3A 2AFQB 3K6ZA 3H7OA 4NZQA 1O2NA 1QRWA 1GHZA 2ZDLA 2VGCC 1L1NA 1O2GH 1BZXE 1UVOA 4IS5A 1O32A 1JIRA 3SZNA 5DK1A 1ESAA 1BCUH 2AMQA 4A1XA 1ANCA 3A7XA 2H6MA 4NSYA 1GL0E 5L30H 1V2VT 1HYLA 2ESTE 3KL6A 5DKMA 4OGYA 1RTKA 4ISIH 4INKA 1BTUA 1C2GA 1FN8A 1V2ST 5E0HA 4O97A 2ZFRH 2STAE 1H9HE 1QQUA 1GJBB 3JZ1B 1GJAB 1QTFA 4M7GA 2JETC 3P92A 2SGQE 1GMDF 2OC7A 3UUZA 1SFIA 1C5RA 3RM2H 1GVKB 4TWWA 5ETXA 3P8FA 1O31A 4CH2B 2VU8E 3GYLB 4ZKRU 1O3HA 4NA7A 2HLCA 2BD2A 2FOCA 3GICB 3LGIA 3RXFA 1GVZA 3SJOA 2OC0A 3ZV9A 2F9OA 2AGGX 3SNAA 5EGMA 2PTCE 2WPHS 2J34A 4FU9A 4FUCA 1G32B 2QA9E 1S81A 1YBWA 1AO5A 1MD7A 1UVUH 3V7TA 1P3EA 1QA7A 1CHOF 3TH4H 3UNSA 4AG2A 3S9CA 1GDNA 1QNJA 2YOLA 5GCHG 1CT4E 1S82A 4I8GA 1J8AA 3N7OA 5C5NA 1IAUA 1GVLA 1BUIA 4I7YH 1NFXA 2FX4A 1C1PA 1HB0B 5JPMH 2EI6A 1GHBF 3S9AA 3ZVFA 4A1VA 4Y8ZA 2VVCA 1FPCH 1CU1A 1HGTH 1WTGH 4NGAH 2VNTA 1GBCA 3PV4A 3RLWH 4FUGA 3P8GA 2QXGA 3ZZDA 1PPHE 2P16A 3TLOA 1C2HA 1SI5H 2FP7B 2ZTYA 3RXQA 5LPEA 2FMJA 1O3MA 1O30A 5BRRE 5DPAA 3STIA 2ZFFH 5DP5A 1BTHH 1BTYA 3R0FA 1A61H 1LHFH 3MH5A 3V3MA 2LPRA 5JBAS 1C4V2 2G4TA 5E8EH 3SJ8A 3RXDA 1TALA 4KP0A 4A92A 4NIVA 2FS9A 1D6RA 3PTNA 5E2PA 2P8OC 5FPSA 4WXIA 1QB9A 2M5TA 4Y0ZE 3I77A 5AVDA 1SLUB 1F5RA 1O2VA 4FVDA 1MKXH 4LXBH 1ZPCA 2ZCHP 1Q31A 2J2UA 2O8MA 1GI9B 4FUFA 3E6PH 1AWFH 2A2XH 4YOIA 5EPYA 2HOBA 1C2EA 2QCYA 2GCHF 1HAOH 3MU0A 4ISLA 1HAVB 1TMUH 3SU3A 3OY6U 4GAWA 4WXVA 1EZQA 1LPGB 3UNRA 2UUYA 1S5SA 1ZLRA 1SSXA 3RXSA 3ZZ5A 4B75A 1EAWA 3RDZA 2Z94A 1YC0A 1WQSA 1PYTD 5TJXA 1MKWK 1MCTA 5HGGA 1PPFE 1VJAU 3SJIA 4MDSA 1DX5M 3DA9B 4DJZB 1DUAA 1MUEB 1QJ6B 4ISHH 2BDCA 2FO9A 1MBMA 4NZLA 2AH4X 3GCHB 1P12E 4CBOA 5L2YH 3FVFB 2P8OB 1GMHG 1KTTB 1QB6A 3QGJA 5CE1A 4GUXA 3STJA 2BD9A 1GBEA 1UTJA 1OS8A 2ZQ2A 2GCHG 1LVBA 4ZHMU 5DG6A 1B7XB 1O5CB 8GCHG 4X8TH 1IQIA 3SI3H 1BTXA 4H6TA 2TRMA 1GHYH 1BB0B 1OWEA 3QTVH 3ZYDA 3M7TA 4FU8A 1CA8B 3PYHA 4K3JA 4K8YA 1A0JA 3UREA 2WPKS 3M3TA 3U9AH 4BAOB 1ETRH 3E16B 4R8TB 3HKJB 1EAIA 4X0WU 1NT1A 2ZGHA 2BOHB 2FPZA 2H2ZA 2XC0A 5FBEA 3T2NA 1Y3WA 3VPKA 3RU4E 1F0UA 1O2OA 3GDVA 2BDAA 1X7AC 1GJ8B 2PV9B 3PMHB 3LJJA 2AIPA 1HBTH 1O5AB 3PMAB 2H5CA 2FOGA 4UD9H 4YT7H 3TGJE 4TPYA 4AYVB 1H1BA 1D3PB 2FLRH 3GCHC 5LH8A 1N1LA 1TNJA 1O3AA 2AMDA 1KDQB 2Z6BD 3ATIA 1YLCA 3RXGA 3LH3A 1BBRH 4YM9A 3RXAA 1UVPA 2R3YA 4O03A 1HRTH 1ZTKA 2A31A 1G30B 1AZ8A 2OD3B 1D3TB 1PPEE 1GJ9B 3SU2A 1JOUB 1O2KA 1ORFA 1P2JA 2AGEX 5FBIA 3MNXA 1V2QT 2GT8A 2Z9JA 2FIRH 2HALA 1QB1A 3TJOA 1O2WA 1Z71A 5EW2H 3VB4A 2VIWA 4TY7A 2CJIA 2ILNA 3SNEA 2C8YB 1TPOA 1TE0A 4CRGA 5AHGH 2PGBB 1C1VH 3SU6A 5GJ4B 4INLA 3SOSA 4DVAU 2XC5A 3SN8A 3SUEA 1GG6B 3E0NB 2FYRA 1ELTA 1W0ZU 3KGPA 3TK9A 2AS9A 4RSPA 1PPCE 2VVUA 5HMAA 1P2QA 2FOMB 1A5HA 2HVXA 4K5ZA 5DP6A 3NUMA 1G2LA 1A0LA 3SQEE 4E06H 1FUJA 4D9RA 4ZKOU 3ZZ6A 1PQ7A 4D7GA 5ESBA 3P6ZB 2EEKA 3AAVA 1HPGA 4TY6A 1T7CA 2GCTB 3A7WA 3D65E 1PPGE 1ZTLA 3A7TA 1SGYE 4Z6AH 2GMTB 5A0AE 4AX9H 2QAAA 4OS4A 1KXEA 3W94A 4X1RU 3L3TA 3VFEA 1P11E 3FAOA 3VB7A 2WUBA 1HDTH 1T8OA 4ZROA 3SJ9A 2TBSA 1FY3A 1WBGB 1Y3VA 1F5LA 1S6FA 2F9NA 3PROA 1GCDA 4U01A 1KDQA 5T6GA 1G3DA 3RMLH 1GBDA 1FQ3A 1O5DH 4SGBE 3MH4A 3ZVDA 2SGEE 3SV6A 2PUXB 2QY0B 2C90B 1W13U 2PKSC 1GHAF 1O3EA 1QBVH 1KLJH 4I32A 1QJ7B 3MO3A 1EPTC 1P2KA 2BYAX 3TH3H 1YPKH 3MI4A 1RTLA 1ZJDA 3UOPA 1VZQH 1YPMH 2V35A 1K1OA 3QX5H 1AI8H 1O2QA 1INCA 1F0TA 4Q80A 2BD3A 1HV7A 1C5ZB 1EP6A 2GT7A 2Y6TA 1AKSB 2H1UA 3ATWA 3VGCC 1QL8A 2GCTC 4QT8C 2STBE 2A45B 1V2OT 3P70B 1FZZA 1T4VH 4OS6A 2A2QH 2XYAA 5AF9H 1NROH 4DURA 1N8OB 3OYPA 3QWCH 1BHXB 1GJDB 4ABIA 3A80A 1AY6H 4XOJA 1UK4A 1BBRE 4JZ1A 4DIIH 5BPEA 3MU5A 1JXPA 1F7ZA 4ZMAH 2ODYB 4KELA 3KNXA 3UIRA 2XNIA 3UR6A 3PB1E 1K22H 4DG4A 5C1UA 6LPRA 3U8TH 1O2LA 1UO6A 1ZSLA 5F8ZA 1LVYA 1C5XB 2ZIQH 1FAKH 1C5MD 4WF8A 4Y7BA 1HJAB 1FNIA 2VIDA 1XUKA 1HUTH 1YP9A 1A2CH 3RXTA 3UQVA 2AGIX 2BDHA 2WINI 2Y7XA 4X2VA 1CA0B 2BY6X 2C3SA 1O3PB 1P9UA 2OC8A 5JB8S 2R9PA 3RXLA 5E0GA 1KYNA 3SU5A 4AYYB 2BX3A 2BXUH 2XC4A 4ESTE 1PQ5A 4FUIA 1O3GA 2BQWB 1D3DB 2OQUA 4Q2KA 2TIOA 3QDZB 3ODFA 3LGYA 2FTMA 3ZZCA 1MKXK 4XSKU 1W11U 5GIBA 2F91A 2HNTC 4D8NA 1NRPH 2A4QA 1E36B 2P95A 3ZVEA 3OX7U 3F9FA 1ZSKA 1DS2E 3HATH 1C5OH 2VJ1A 4KKDA 4I8LA 2OP9A 1GMCG 2ODQA 2J4IA 2ZU4A 2GZ7A 3HPTB 1LCYA 3KIDU 1GHVH 4XDEA 3SV2H 1KXAA 1CBWB 1Z7KA 2BVXH 1SQOA 1DE7H 1GBTA 1WU1A 3ZVGA 1Y5BT 1EP5A 5LPFA 3MHWU 3BTEE 1PPZA 4RKOB 6CHAB 3GDUA 3FFGA 1GJ7B 4E05H 4CR9A 8KME2 1EX3A 2K1QA 1SOTA 2FM2A 3M5NA 4LZ4B 1C1NA 1BTWA 1AFEH 2C8WB 1D3QB 1OOKB 2UUFB 1V2NT 2JETB 4YLUA 1QCPA 1EB2A 3SHAH 1AD8H 1HAIH 1OYQA 1DANH 4MPVA 3ZVBA 1V2LT 1BRUP 3JZ2B 3RXCA 3DFJA 2G5NA 3GDSA 3NPSA 3F9EA 3F6UH 1GWAA 1MTUA 1ZHRA 1WUNH 3GCTF 3SQHE 1W2KH 4HTCH 2ZDMA 4AFZA 1W7GH 1UTLM 3ZZ4A 5G4BA 3MYWA 1ZOMA 1MTWA 4JYVH 2G81E 4WVPE 1FY1A 3UWJH 4ISOA 1AFQB 1YKTA 4I33A 1THSH 9LPRA 2PFEA 1O2TA 2FTLE 1TNHA 1FY4A 1TBQH 2ZF0H 5EQQA 3ITIA 1GPZA 1ZTJA 3VB6A 2Y5FA 1GMHF 1RJXB 1SGIB 2QYIA 3SNBA 1FAXA 1LVOA 1ELFA 3ZZAA 4JZDH 2BLQA 5C5OA 3VEQB 1LHCH 2G52A 2XWBI 2ALVA 1NRNH 4F4OC 2ZHFH 2YNBA 1KTSB 5C20A 1O2SA 2ZHWH 1SGNE 1SGEE 1C4U2 5DO4H 1HAGE 2XCNA 8LPRA 4B2CA 4Z0KA 3BN9A 3FP6E 1IHTH 1MTSA 2FOBA 1PFXC 2W3KA 3SJKA 1SLVB 5JYIA 1TPAE 5PTPA 3RMOH 2R2MB 1A46H 3HK3B 2Z9KA 3SNDA 3SO3A 3U8RH 4MNVA 5K0HA 1Z8GA 1O2MA 1IQJA 2VH6A 3EA7A 1OKXA 2TGDA 2UWLA 4JYUH 4O9VA 3MO6A 3SGAE 4H4FA 1OP2A 2ZO3H 2CXVA 3EQ0H 1EKBB 3TJVA 1O3FA 5A09A 1GI4A 1HAXB 1NFWA 2AERH 5DP9A 2A0QB 3LJOA 3MH6A 2FI3E 3AW1A 1C2MA 4D9QA 1VCQA 5FAHA 3SI4H 2A5KA 2P93A 1GHXH 2BQ7B 3SGBE 2V3HH 4MTBA 1CHOG 2QXIA 4NSVA 4Y79A 4YOGA 4A1TA 5AFYH 4ABDA 4X8UH 2F9VA 7GCHG 1LHGH 3TNSA 3PO1B 1G3CA 2PGQB 3E3TA 1C4Y2 2Y82A 1GI1A 3A7VA 4UEHH 1AB9B 5EXMA 2EI7A 1B5GH 1PPBH 1S85A 2FOHA 4JCNA 1C1OA 4RKJB 3I78A 1DVAH 1MD8A 2F9BH 2ZPQA 2ZU2A 4U2WA 3RXOA 1AGJA 4IMZA 3P8OA 3AW0A 4NA9H 3BG4B 1NY22 1QBOA 3BSQA 4IN2A 1J9CH 2IN2A 1BMNH 1FDPA 4ABEA 3BTWE 3U98H 2PKAB 1GJCB 2RDLA 1QR3E 3SHCH 5EU8A 4AOQA 3GCNA 3RXKA 3MFJA 1GI3A 1EAUA 1TOCB 1TX8A 2ZP0H 1O3CA 1O2YA 1GJ6A 4I8JA 2Q6FA 4K1EA 4NIYA 1P06A 1XM1A 2A32A 3UFAA 1BMAA 4D76A 1YCPK 1ELVA 5ESTE 5A2MH 1OWIA 3RU4T 2VH0A 2P94A 1O36A 4TYDA 1ETSH 1OWJA 1MKWH 4RN6A 5A8XA 3LC3A 5FPTA 3WY8A 1Z6JH 2ZEBA 2A7HA 1SGCA 4CHAB 2A1DB 3URDA 2PSXA 1OSSA 1AQ7A 2HWLB 1UCYH 1NZQH 1T8LA 3QZRA 1G3EA 2W5EA 3K6YA 1OYTH 1GBJA 3M35A 3OTJE 1AHTH 2XXLA 2OLGA 3PO1C 3O8CA 3BTFE 1GHAG 1NM6A 1SGTA 4YO9A 1LVMA 1O38A 2TGTA 2ZZUH 3FZZA 2XWAA 4NA8A 1C5YB 3BEUA 1JRTA 1NC6A 4A7IB 1J14A 2HNTE 1BMLA 1DY8A 2DE8A 4Q7YA 1A0HB 1V2JT 3GY2A 2J95A 3UR9A 3V12A 1T8NA 2PUQH 3RC4A 5EODA 4IN1A 1TMTH 3M36A 3T28A 1E34B 1BT7A 2XBVA 1DWCH 1TGBA 2V3OH 1D4PB 1AUTC 4INHA 1C1TA 2WPMS 1DFPA 2ZHDA 4U30A 1O35A 2QXJA 1E38B 3TU7H 3A8DA 1KXBA 4ZAEA 1MQ5A 2Z3CA 2HRVA 3GCOA 1V2TT 5FXLA 4AZ2B 1CT0E 3BTTE 1AZZA 1BRAA 3LIWA 3LKWA 2OTVA 1H9LB 3A7ZA 1XX9A 1UJ1A 5K7RA 1G9IE 1ABIH 2W26A 2ZA5A 3K65B 3A87A 1O2XA 3RLYH 1FMGA 1ELGA 1O39A 1XXFA 4JMYA 4BXWA 1C5LH 1TA2A 1MU6B 2G8TA 1IQLA 5T6FA 4F49A 1W0YH 5F8TA 3RXHA 1P10A 3NK8A 3Q77A 1SR5C 4UFEH 1HNEE 3MNCA 1OWHA 2CHAC 1S6HA 1P04A 3TVJB 1SGDE 3RU4D 1UTKA 4FU7A 4D7FA 4ZXXH 2GDDA 1Z1JA 1Q2WA 3F68H 3ZZBA 4AB8A 3VXEH 3PTBA 2XCFA 3TIUA 1OP0A 1H8IH 2SGFE 3BTHE 3MU8A 4VGCC 5DP3A 4U32A 4X8VH 1F92A 1B0EA 1Y8TA 4OS7A 5AFZH 4GCHF 3S69A 1OWKA 1GJ5H 2UUJB 3RMNH 4IGDA 3URCA 2F3CE 3ZYEA 1EASA 2H5DA 1MAXA 1NO9H 2GZ9A 5DP8A 3NZIA 5A0CA 3NWUA 3IITA 2Z3DA 3LGTA 5EXNA 1GJ4H 1YPLH 1ZMLA 2ANKH 3C27B 2F9PA 2W7SA 3KQEA 2BD8A 1AWHB 5I46H 1YPHC 1K1NA 2G00A 2NU1E 2WPIS 4Y8YA 5F6MA 1RRKA 3LT3A 1ABJH 2NU4E 3ZZ7A 4FUDA 1TBRH 1UTQA 2EC9H 1Z6EA 1ESBA 3EA8A 1TNLA 3A84A 2D8WA 3TPIZ 3SUDA 4CRAA 3SV9A 4XE4A 4Y6DA 2BHGA 1IQFA 1TYNA 4ABBA 3Q3YA 1EZSC 1GBHA 3LDXH 4CH8B 3H7TA 1LHDH 1BJUA 3Q3XA 2GV7A 1OX1A 3PWCA 1YGCH 2UWPA 1LQDB 1L0ZA 4UFFH 3MO9A 5DP4A 1CO7E 4YT6H 3FP7E 2CMYA 2QN5T 3BIVH 2XBYA 1YF4A 3GY3A 4AGKA 2AEIH 2A4OA 2GDEH 3U69H 3M3VA 1FV9A 4JYTA 4MPUA 1GDUA 4GHQA 3Q76A 1F2SE 1AMHA 1C1RA 4BAMB 3F9HA 3HKIB 1AKSA 4ZH8A 5F8XA 3TGKE 4X2YA 2HPQH 4BANB 3SU1A 2ZCKP 2ZC9H 4HFPB 1SGQE 4JZIA 3S9BA 1WYKA 3Q3KA 3D23A 3VB3A 4AFSA 1W3CA 3IWMA 1YLDA 1ZZZA 4KGAA 4DIHH 4X6OA 3FANA 4MG3A 1BITA 1GBAA 3UPEA 2GD4B 5HXFA 4FUBA 1PQAA 2ZHEH 1HAPH 2ULLA 2V0BA 1S0QA 1GDQA 1FIZA 2I6SA 2O8TA 2BLVA 3EAJA 5L2ZH 4IBLH 3O8BA 1HJAC 2PHBA 4B76A 3QZQA 1ETTH 1K21H 2D26C 3D49H 3SUGA 5C1XA 1TNIA 4JZFH 1QHRB 5C2ZA 2VIOA 2TPIZ 4DCDA 2EA3A 1UHBB 1C2FA 6ESTA 1NRRH 3VGCB 1SVPA 3QN7A 3BIUH 1DWBH 1ZHMA 4TWYA 5GCHF 5T6DA 1LPZB 1NRSH 4E7NA 3MU4A 1VITH 1TRNA 5FHTA 2BLWA 1PYTC 5B6OA 1AE5A 1O3OA 3D62A 1KXDA 5C3NA 3ATMA 3A82A 1P57B 1MBQA 1MTNB 3I29A 5J4SA 2ZFTA 4MNYA 4BTTB 2B0FA
chains in the Genus database with same CATH superfamily
2ZFSA 4MNXA 1CVWH 4IC5A 1NRQH 1GI0A 3T27A 1UTNA 1HCGA 3T5FH 1SGRE 3EE7A 1BA8B 1P03A 3F0OA 5DGJA 1P2MA 2GP9B 1DUEA 3O8DA 4I86A 3ZVCA 3SV8A 1YLNA 3AASA 4YTAA 1ARBA 1P2OA 1LDTT 2H9EH 4AG1A 3OFND 1VGCC 1CBWC 1XKBC 2VGCB 3E90B 4BNRA 1TX7A 3LONA 2QF3A 4ZKSU 2G4UA 4BAHB 1QZ8A 1TNKA 1S6LA 4MPXA 4ISNA 4CREA 1IQEA 1J16A 2A5IA 5GPIB 2G51A 2SFAA 3A88A 3NKKA 2ODPA 2WV4A 3MQKC 2WYJA 3RP2A 1ZGIA 1K2I1 2ZFPH 2F43B 2Z9GA 3PLKA 3RMMH 3ZZ8A 1L1GA 1BQYA 4X1QU 1BTPA 1P9SA 4ZUHA 4YOJA 2PR3A 1DXPA 1ZJKA 3BEFB 5EQSA 1GHBG 3DSGA 4ZKNU 1SLXB 4YESB 1E1QD 2CF9H 2J38A 2BD5A 1SBWA 1TGCA 3A85A 2XBXA 3WWFA 3U28C 2THFB 1IQNA 1K1PA 3H5CB 2ZNKH 1AVWA 2ZDAH 2XTTB 5A0BA 2B8OH 1GI6A 1D6WA 2EI8A 1C2LA 1ZRKA 2H9TH 1C1SA 1WQVH 1XMNB 3TNTA 2J98A 1ZRBA 3E0PB 1C5TA 1TB6H 3B8JA 1GI5A 3MMGA 4HI3A 1O2PA 4XFQA 4NFEA 4NG9H 3OY5U 1UHBA 1UW7A 2OQ5A 3MNSA 1G3BA 4DOQA 1L4DA 1QURH 1XUJA 1O2IA 4E7RG 1VGCB 4MPWA 2BDGA 4YZUA 2GGVB 2VWNA 4K60A 2J9NA 1JWTA 1S0RA 2A7JA 1GBLA 1IHSH 1UTOA 2BVRH 3LGWA 4B74A 2JJ1D 2OUAA 2O9QA 2O8UA 4FUHA 2BY8X 1O33A 3KQCA 1Y5UT 1ID5H 1A5IA 1C1WH 3CENA 1O3IA 1K28D 2WYGA 1P8VC 1C9TA 3HGNA 3QGNB 1WTHD 1DDJA 3SZEA 1Y3XA 1OPHB 2ZKSA 4WH6A 1XUGA 2XW9A 3UY9A 1U6QA 4CRBA 1ELEE 1EOLA 5H4IB 2QF0A 3FP8E 2PWXA 1SQRA 5F03A 1C2DA 2W3IA 4NCYA 1F0RA 4K8BA 1DSTA 1UVTH 1JBUH 1ANEA 4WMEA 1MTVA 3BTKE 4GLYA 1KIGH 1AIXH 1NFUA 2BY9X 1H8ED 4B2AA 1LMWB 1NESE 2OCVB 1A5GH 1AFQC 2BDBA 1IQGA 3GCTG 2C4FH 4JK6A 4GVUA 1TQ7B 3OAAD 2SGPE 1F0SA 3SUFA 1O0DH 1O3LA 4H42U 4I31A 4OS5A 5L6NH 2F4LA 2FI4E 4CR5A 2KX4A 3F2FA 1PQ8A 1TAWA 3E1XB 3F9GA 4TT3D 3RXIA 1N8OC 1UCYE 1RFNA 3A8AA 5GXPA 1V2RT 3RXBA 2GTBA 4NWKA 4XBCA 2KCAA 2CN0H 4AORA 1VITF 4JZEH 1BBRK 2SGDE 1CHGA 2Q6DA 3KHVA 4XBDA 1GGDC 2JKHA 3C1KA 2BD7A 1WDIA 2D2DA 1UTMA 1SHHB 1NU9A 2B9LA 1C5UA 1K1MA 3RXUA 1OP8A 2JJ2D 4Y7AA 1SGPE 4IW4E 1QRZA 3V0XA 5CHAB 1C5PA 1QRXA 1P01A 1SL3A 1GBKA 1Z8RA 1AN1E 2VIVA 2ZWLH 3TITA 2A7CA 3GISB 2QC2A 4BXSA 1ZMNA 5HM2A 2G55A 1T4UH 4BAKB 1HJ9A 4Y71A 3A89A 1C5WB 2P3UB 1CA0C 3BTDE 2Y80A 1KXFA 1FN6A 4IMQA 4Y0YE 1QA0A 1TIOA 2IJOB 3TGIE 4FUJA 3QO6A 5EG4A 1GI8B 4LOYH 3T26A 2B7DH 1RS0A 2F9UA 2FODA 2O8WA 1G2MA 1TGNA 3RUOA 2FS8A 3QTOH 4H6SB 5JDUB 1P09A 3M37A 1N6XA 3EYDA 4B1TA 2F83A 1WSSH 1TFXA 4CRDA 1WV7H 1MU8B 1MABB 1HAVA 3OU0A 3KN2A 4B73A 1IOEA 3UWIA 5DP7A 1EPTA 1OWDA 1W10U 4F48B 1FONA 2A5AA 1GGDB 3M3SA 3WWBA 4Y76A 5E2OA 4OS1A 3MNBA 1QIXB 1JMOH 1YWUA 2HGTH 2Y5GA 1T31A 4ABHA 2ANYA 3BG4C 3K9XB 1ZR0A 3S7HB 4WJG2 1ZHPA 3GY7A 4X8SH 3BTGE 1EZUC 2FLBH 4CRFA 5FCKA 1THRH 4KTUA 3S7KB 1TABE 1IQMA 4Y10E 2D1JA 3PMBB 5HYOA 1H4WA 1GCTC 2J92A 6CHAC 1W14U 4Z1MD 2VWOA 3EA9A 1V2WT 1P2NA 2R2WU 1DM4B 3BG8A 2BB4A 3ZIAD 1N6YA 4ACAA 2HVYB 2A4RA 4UE7H 4DW2U 2H9HA 1VR1H 5LGOA 1C2KA 1HXFH 1GBIA 3RM0H 3T29A 5TCAA 1L2EA 1QL7A 4X6NA 1LKBA 3E91A 2ALPA 5JBCS 1DWDH 2WPDD 3LPRA 2KM0A 1A4WH 1C2JA 5CMXH 3BTME 3ELAH 2BMGB 5C1YA 3OSYA 3ESTA 4ABGA 1EOJA 4O3TA 2DE9A 3PMJA 1CGHA 1WOFA 5GNDA 1W12U 4WY3A 2VVVA 2ZU3A 1QJ1B 1MCVA 4NIWA 3RXRA 2RA0A 3A81A 2ANWA 3F1SB 1O2RA 1WAYB 3P17H 5EQRA 2JH6D 3PLBA 5JBBS 1MH0A 2ZCLP 1BIOA 2EY4C 1C9PA 2ZGJA 4JK5A 1BOQA 3PM3A 4A5TS 4AFUA 1MAYA 5C67A 4CRCA 1GCTB 3PLPA 3AAUA 1DXWA 4ABJA 1EJNA 2ZTZA 1GMDG 1RXPA 4NFFA 1IQHA 4TPIZ 2NU3E 1XKAC 4J2YB 2BDIA 1ZPZA 4OGXA 4HG6A 2R0LA 2OC1A 2CF8H 5A8YA 3TH2H 2ASUB 4NIXA 2BDYA 9ESTA 3ZVAA 3SU4A 1GI7B 2HNTF 3MTYA 4K2YA 5HIZA 7LPRA 3SV7A 2PKAA 2IPHA 2FESH 3DT0H 4A6LA 2ZPRA 3RC6A 1D9IA 1HAYB 2SGAA 1NS3A 1TPPA 1A3EH 3SNCA 2QXHA 1BDAA 3M7UA 2Q6GA 1O3JA 3SU0A 5F53A 3TJUA 2LNCA 1BTZA 1TBZH 1SPJA 3LGUA 1UMAH 3KF2A 1K1IA 5SGAE 1SLWB 2ZTXA 2FX6A 5HM9A 1A3BH 1SQAA 4WMFA 1XUHA 2BX4A 1XXDA 3DFLA 1ESTA 2GZ8A 2CHAB 3B9FH 1EUFA 2DUCA 4B2BA 2VIPA 3ZZ3A 1SHYA 2ZPSA 4GPGA 4GSOA 2PKSB 1EQ9A 3U8OH 5EJ1A 2UUKB 1ELBA 3ATKA 4X2XA 3O8RA 3P8NA 1AU8A 1MMJN 1SFQB 2IOTA 1ELCA 1SGFG 1ZGVA 1VCPA 3QUMP 1E37B 3A8BA 1FIWA 1JRSA 1BJVA 3A83A 3P95A 3SBKA 1P2IA 1XUFA 4KTSA 4GHTA 4WWYA 3SYJA 1CGJE 2K8IA 7KMEH 1O2UA 3NCLA 1QL9A 3FOAA 1ACBE 1S83A 3CP7A 1CQQA 1TLDA 1QGFA 1ANBA 1PJPA 4OS2A 2VBCA 1LPKB 3QK1A 4YXWD 2OBQA 2JH5D 5EXLA 2R3UA 1V2KT 2TGAA 3EDXB 1K1JA 2FDAA 3ATLA 5JB9S 1P05A 4K1TA 2TGPZ 1GBMA 3SGQE 2Y5HA 1FY8E 4DY7B 3W95A 2FWWA 1TNGA 2ZU5A 3LU9B 1UVSH 1C1MA 1DLKB 3BF6H 4KTCA 1ELDE 1BRBE 1EZXC 1T32A 4B6FA 4LZ1H 2FI5E 1C5NH 2BQ6B 1QBNA 5DJ7A 1TX6A 3PWBA 2KAIA 4SGAE 2YNAA 2Z9LA 1THPB 1VCWA 3H09A 1F5KU 4R0IA 1EXFA 2VB0A 3CS7A 1RD3B 2VINA 4DT7B 2BLOA 2Z3EA 2J98B 3RXMA 3ODDA 2VIQA 1C2IA 4MNWA 5LPRA 3LOXA 4UDWH 4MVNA 3A7YA 5KECA 1LO6A 1NU7B 3TK5A 4BTUB 1OHHD 2OINA 1AVGH 3HK6B 3DHKH 3RXJA 3ENSB 1YCPM 2BZAA 3GY8A 1HFDA 3OTPA 4FUEA 2PW8H 1H9IE 3T62A 2QV1A 5EW1H 4AB9A 1TA6A 2PTNA 2SNWA 3MWIU 4I8KA 4Q7XA 2WV5A 1GHWH 5GWZA 1FJSA 1DICA 1O34A 3L33A 3B23B 1J15A 3Q00A 1HIAA 2QIQA 4XRNA 3U1JB 1CT2E 3T25A 4TSFD 1CSOE 1OXGA 1EAXA 3G01A 1C5VA 3TK6A 3BTQE 1KY9A 8GCHF 2BM2A 1JIMA 4B71A 1AUJA 2BY5X 4WH8A 2YMSD 2R0KA 3PV2A 2V6NA 4XD7D 1V2MT 1GI2A 2GMTC 1TGSZ 3DD2H 2XBWA 4PROA 2Q1JA 1TRYA 2C8ZB 2ZI2H 1TOMH 1ZPBA 2RDEA 1KLTA 2B5TB 4ABFA 1ELAA 2XRCA 2CGAA 5EPNA 4ZHLU 1YPGH 4X1PU 4DGJA 1CGIE 1UK2A 4ZXYH 7GCHF 2QGRA 1LTOA 1NPMA 3R3GB 2FXRA 1SGFA 1YPJH 2GKVE 1CE5A 3L6PA 4IC6A 3QLPH 3UOUA 3LC5A 2P3FH 3FO8D 4AN7A 2ZDKA 1SQTA 5T1VA 3GY5A 6GCHG 4HZHA 1L4ZA 1HAHH 2A4GA 2BZ6H 1GG6C 4ZHAA 3E8LA 5GDSH 1C1QA 1SMFE 3UNQA 2WV9A 1FI8A 1DPOA 2BD4A 3S0NA 1LHEH 4VGCB 1SC8U 4P00A 1O37A 4WMDA 1AVXA 1SOZA 3IG6B 1WCZA 2ANMH 1W8BH 1YYY1 2FZZA 3KQBA 2ZQ1A 1MZDA 4AFQA 1LKAA 1VJ9U 5EOKA 1Q3XA 2OXSA 1LQEA 2GVFA 2RCEA 4UFDH 5E0JA 2FYQA 1O3BA 2Z7FE 1SB1H 2M2AA 3EE0B 4THNH 2SNVA 3M61U 4MQAA 1W7XH 2WUCA 1O2ZA 2W7UA 1MZAA 3V13A 2NU2E 1Y59T 1GL1A 1TONA 1XVMA 1YCPH 2FOAA 2VWLA 8ESTE 1QFKH 2RA3A 1XUIA 4YLQH 5JBTA 1H8DH 1ZMJA 2ZECA 1L1JA 4AGJA 1Y5AT 2BY7X 3UTUH 3BEIB 2BTCE 2ZHQH 1P3CA 2FOEA 1P02A 2PSYA 1HXEH 1IQKA 4BOHA 2Y81A 1G36A 2ZGCA 1GBBA 1GBFA 4O3UA 2J94A 1TWXB 2P3TB 1V2PT 1MQ6A 1O5GH 1QQ4A 1O3DA 2KAIB 1G37A 1M9UA 2RG3A 1TQ0B 1TPSA 4X6PA 3A8CA 3DCLA 3SORA 1NFYA 4BAQB 5FX6A 1NTPA 1DT2A 1HIAB 3MH7A 4Q7ZA 1EPTB 5HIYA 4ABAA 1ZYOA 3GYMA 1E0FD 6GCHF 1AE8H 4X6MA 5IYTA 3ZV8A 3NXPA 1B0FA 1Y3YA 3RC5A 1HJ8A 3DUXH 4AC9A 3ZZ9A 2AIQA 1BMFD 1XVOA 4MLFB 2K0QA 1V2UT 2WPJS 4GCHG 3M7QA 2O8LA 3VXFH 1A7SA 1Z8IB 2AYWA 3UB0A 2ZGXH 2ZG0H 3EGKH 2CV3A 2OBOA 3GOVB 1O3KA 4ASHA 1BRCE 3LH1A 4X1SU 4Y11E 4K1SA 1DWEH 4FXGH 2BVSH 1E35B 1KSNA 2ZDVH 1BHXF 3FKSD 1FY5A 1K1LA 1RIWC 2JH0D 3SW2B 1UCYK 2G5VA 1TRMA 3BV9B 7ESTE 1EB1H 1K9OE 5IDKA 1V6DA 3CS0A 2HPPH 3GS9A 4I8HA 1AB9C 1T8MA 1BMMH 2ZDNA 1FXYA 3OE7D 1DSUA 3HGPA 3TJNA 3M5MA 4X1NU 2PLXA 2AMPA 1EJAA 1TMBH 1Z8JB 4BTIB 2VWMA 4ZCNA 3KQDA 5ABWA 1EJMA 1Y3UA 1NN6A 4CBNA 2WPLS 3GY6A 3M5LA 2IJD1 3MU1A 3FZDA 3M5OA 1DLEA 1J17T 2BXTH 4FVBA 1VITG 5CHAC 1DOJA 4NWLA 1GMCF 2GX4A 4XBBA 1O5EH 4UFGH 1O5FH 4HGCA 1KLIH 1C5SA 1UTPA 5FCRA 4K69A 2LELA 2ZFQH 1KXCA 1YPHE 1RTFB 3RXEA 1ANDA 1YM0A 1O5BB 1V3XA 3A86A 5C0UA 3RXPA 2QE7D 1TGTA 4Y8XA 2EQNA 3MOCA 3AVZA 2KCYA 1FLEE 3U1IB 1DY9A 5FX5A 5J4QA 1HAZB 3GY4A 3VB5A 3LGVA 1ARCA 1RGQA 1S84A 2ZGBH 5T3HA 4LK4A 2NWNA 1Z1IA 3FN8A 3KEEA 4CHAC 2ZU1A 3K2UA 1ZSJA 1C5QA 1O3NA 1SG8B 4RI0A 5TCCA 1DITH 2Z9IA 2YMSC 3RXVA 5I25A 1KMHB 1RIWB 2UWOA 4J1YA 4FETA 2FEQH 1P0SH 1MTNC 1O2HA 1QY6A 5FPYA 2C8XB 2GV6A 1C1UH 3KCGH 2P59A 2NU0E 3UQOA 1EATA 4X2WA 3N7EA 4UONA 1O2JA 2BOKA 5A8ZA 2LP6A 2FOFA 3OEHD 1FPHH 2C93B 1HLTH 2Y7ZA 1YPEH 2I6QA 1A1RA 1UK3A 2AFQB 3K6ZA 3H7OA 4NZQA 5HKKD 1O2NA 1QRWA 1GHZA 2ZDLA 2VGCC 1L1NA 1O2GH 1BZXE 1UVOA 4IS5A 1O32A 1JIRA 3SZNA 5DK1A 1ESAA 1BCUH 2AMQA 4A1XA 1ANCA 3A7XA 2H6MA 4NSYA 1GL0E 5L30H 1V2VT 1HYLA 2ESTE 3KL6A 5DKMA 5B6LA 4OGYA 1RTKA 4ISIH 4INKA 1BTUA 1C2GA 1FN8A 1V2ST 5E0HA 4O97A 2ZFRH 2STAE 1H9HE 1QQUA 1GJBB 3JZ1B 1GJAB 1QTFA 4M7GA 2JETC 3P92A 2SGQE 1GMDF 2OC7A 3UUZA 1SFIA 1C5RA 5CDFE 3KYGA 2YMSB 3RM2H 1GVKB 4TWWA 5ETXA 3P8FA 1E1RD 2QF4A 1O31A 4CH2B 2VU8E 3GYLB 4ZKRU 1O3HA 4NA7A 2HLCA 2BD2A 2FOCA 3GICB 3LGIA 3RXFA 1GVZA 3SJOA 2OC0A 3ZV9A 2F9OA 2AGGX 3SNAA 5EGMA 2PTCE 2WPHS 2J34A 4FU9A 4FUCA 1G32B 2QA9E 1S81A 1YBWA 1AO5A 2PP6A 1MD7A 1UVUH 3V7TA 1P3EA 1QA7A 1CHOF 3TH4H 3UNSA 4AG2A 3S9CA 1GDNA 1QNJA 2YOLA 2KCPA 5GCHG 1CT4E 1S82A 4I8GA 1J8AA 3N7OA 5C5NA 2L74A 1IAUA 1GVLA 2AHME 1BUIA 4I7YH 1NFXA 5C17A 2FX4A 1C1PA 1HB0B 5JPMH 2EI6A 1GHBF 3S9AA 3ZVFA 4A1VA 5KGOA 4Y8ZA 2VVCA 1FPCH 1CU1A 1HGTH 1WTGH 4NGAH 2VNTA 3DSPA 1GBCA 3PV4A 3RLWH 4FUGA 3P8GA 4RT1A 2QXGA 3ZZDA 1PPHE 2P16A 3TLOA 3CNRA 1C2HA 1SI5H 2FP7B 2ZTYA 3RXQA 5LPEA 2FMJA 1O3MA 1O30A 5BRRE 5DPAA 3STIA 2ZFFH 5DP5A 1BTHH 1BTYA 3R0FA 1A61H 1LHFH 3MH5A 3V3MA 2LPRA 5JBAS 1C4V2 2G4TA 5E8EH 3SJ8A 3RXDA 1TALA 4KP0A 4A92A 4NIVA 2FS9A 1D6RA 3PTNA 5E2PA 2P8OC 5FPSA 4WXIA 1QB9A 2M5TA 4Y0ZE 3I77A 5AVDA 2KZ4A 1SLUB 1F5RA 1O2VA 4FVDA 1MKXH 4LXBH 1ZPCA 2ZCHP 1Q31A 2J2UA 2O8MA 1GI9B 4FUFA 3E6PH 1AWFH 2A2XH 4YOIA 5EPYA 2HOBA 1C2EA 2QCYA 2GCHF 3F3BA 1HAOH 3MU0A 4ISLA 1HAVB 3PV5A 1TMUH 3SU3A 3OY6U 4GAWA 4WXVA 5EJLA 1EZQA 1LPGB 3UNRA 2UUYA 1S5SA 1ZLRA 1SSXA 3RXSA 3ZZ5A 4B75A 1EAWA 3RDZA 2Z94A 1YC0A 1WQSA 1PYTD 5TJXA 1MKWK 1MCTA 5HGGA 1PPFE 1VJAU 3SJIA 4MDSA 1DX5M 3DA9B 4DJZB 1DUAA 1MUEB 1QJ6B 4ISHH 2BDCA 2FO9A 1MBMA 4NZLA 2AH4X 3GCHB 1P12E 4CBOA 5L2YH 3FVFB 2P8OB 1GMHG 1KTTB 1QB6A 3QGJA 5CE1A 4GUXA 3STJA 2BD9A 1GBEA 1UTJA 1OS8A 2ZQ2A 2GCHG 1LVBA 4ZHMU 5DG6A 1B7XB 1O5CB 8GCHG 4X8TH 1IQIA 3SI3H 1BTXA 4H6TA 2TRMA 1E79D 1BB0B 1GHYH 1OWEA 2J97A 3QTVH 3ZYDA 3M7TA 4FU8A 1CA8B 3PYHA 4K3JA 4K8YA 1A0JA 3UREA 2WPKS 3M3TA 3U9AH 4BAOB 1ETRH 3E16B 4R8TB 2WHXA 3HKJB 1EAIA 4X0WU 1NT1A 2ZGHA 2BOHB 2FPZA 2H2ZA 2XC0A 5FBEA 3T2NA 1Y3WA 3VPKA 3RU4E 4P02A 1F0UA 1O2OA 3GDVA 2BDAA 1X7AC 1GJ8B 2PV9B 3PMHB 3LJJA 2AIPA 1HBTH 1O5AB 3PMAB 2H5CA 2FOGA 5DSFA 4UD9H 4YT7H 3TGJE 4TPYA 4AYVB 1K0HA 3AK5A 1H1BA 1D3PB 2FLRH 3GCHC 5LH8A 1N1LA 1TNJA 1O3AA 2AMDA 1KDQB 2Z6BD 3ATIA 1YLCA 3RXGA 3LH3A 1BBRH 4YM9A 3RXAA 1UVPA 2R3YA 4O03A 1HRTH 1ZTKA 2A31A 1G30B 1AZ8A 2OD3B 1D3TB 1PPEE 1GJ9B 3SU2A 1JOUB 4ASUD 1O2KA 1ORFA 1P2JA 2AGEX 5FBIA 3MNXA 1V2QT 2GT8A 2Z9JA 1YY3A 2FIRH 2HALA 1QB1A 3TJOA 1O2WA 1Z71A 5EW2H 3VB4A 2VIWA 4TY7A 2CJIA 2ILNA 3SNEA 2C8YB 3NRLA 1TPOA 1W0KD 1TE0A 4CRGA 5AHGH 2PGBB 1C1VH 3SU6A 5GJ4B 4INLA 2V7QD 3SOSA 4DVAU 2XC5A 3SN8A 3SUEA 1GG6B 3E0NB 2FYRA 1ELTA 1W0ZU 3KGPA 3TK9A 2AS9A 4RSPA 1PPCE 2VVUA 5HMAA 1P2QA 2FOMB 1A5HA 2HVXA 4K5ZA 5DP6A 3NUMA 1G2LA 1A0LA 3SQEE 4E06H 1FUJA 4D9RA 4ZKOU 3ZZ6A 1PQ7A 4D7GA 5ESBA 3P6ZB 2EEKA 3AAVA 1HPGA 4TY6A 1T7CA 4Q63A 2GCTB 3A7WA 3D65E 1PPGE 1ZTLA 3A7TA 1SGYE 4Z6AH 2GMTB 5A0AE 4AX9H 2QAAA 4OS4A 2L6OA 1KXEA 4M9FA 3W94A 4X1RU 5IK2D 3L3TA 3VFEA 1P11E 3FAOA 3VB7A 2WUBA 1HDTH 1T8OA 4ZROA 3SJ9A 2TBSA 1FY3A 5FL7D 3F2HA 1WBGB 1Y3VA 1F5LA 1S6FA 2F9NA 3PROA 1GCDA 4U01A 1KDQA 5T6GA 1G3DA 3RMLH 1GBDA 1FQ3A 1O5DH 4SGBE 3MH4A 3ZVDA 2SGEE 3SV6A 2PUXB 2QY0B 2C90B 1W13U 2PKSC 1GHAF 1O3EA 1QBVH 1KLJH 4I32A 1QJ7B 3MO3A 1EPTC 1P2KA 2BYAX 3TH3H 1YPKH 3MI4A 1RTLA 1ZJDA 3UOPA 2XNDD 1VZQH 1YPMH 2V35A 1K1OA 3QX5H 1AI8H 1O2QA 1INCA 1F0TA 4Q80A 2BD3A 1HV7A 1C5ZB 1EP6A 2GT7A 2Y6TA 1AKSB 2H1UA 3ATWA 3VG8A 3VGCC 1QL8A 2GCTC 2KFWA 4QT8C 2STBE 2A45B 1V2OT 3P70B 1FZZA 1T4VH 4OS6A 2A2QH 2XYAA 5AF9H 1NROH 4DURA 1N8OB 3OYPA 3QWCH 1BHXB 1GJDB 4ABIA 5KEDA 3A80A 1AY6H 4XOJA 1UK4A 1BBRE 4JZ1A 4DIIH 5BPEA 3MU5A 1JXPA 1F7ZA 4ZMAH 2ODYB 4KELA 3KNXA 3UIRA 2XNIA 3UR6A 1H8HD 3PB1E 1K22H 4DG4A 5C1UA 2GJGA 6LPRA 3U8TH 1O2LA 1UO6A 1ZSLA 5F8ZA 1LVYA 1C5XB 2ZIQH 1FAKH 1C5MD 4WF8A 4Y7BA 1FX0B 1HJAB 1FNIA 2VIDA 1XUKA 1HUTH 1YP9A 1A2CH 3RXTA 3UQVA 2AGIX 2BDHA 2WINI 2Y7XA 4X2VA 5EJZA 1CA0B 2BY6X 2C3SA 1O3PB 1P9UA 2OC8A 5JB8S 2R9PA 3RXLA 5E0GA 1KYNA 3SU5A 4AYYB 2BX3A 2BXUH 2XC4A 4ESTE 1PQ5A 4FUIA 1O3GA 2BQWB 1D3DB 2OQUA 4Q2KA 2TIOA 3QDZB 3F0PA 3ODFA 3LGYA 2FTMA 3ZZCA 1MKXK 4XSKU 1W11U 2HLDD 2F91A 5GIBA 2HNTC 4D8NA 1NRPH 2A4QA 1E36B 2P95A 3ZVEA 3OX7U 3F9FA 1ZSKA 1DS2E 3HATH 1C5OH 2VJ1A 4KKDA 4I8LA 2OP9A 1GMCG 2ODQA 2J4IA 2ZU4A 2GZ7A 3HPTB 1LCYA 3KIDU 1GHVH 4XDEA 3SV2H 1KXAA 1CBWB 1Z7KA 2BVXH 1SQOA 1DE7H 1GBTA 1WU1A 3ZVGA 1Y5BT 1EP5A 5LPFA 3MHWU 3BTEE 1PPZA 4RKOB 6CHAB 3GDUA 2J5UA 3FFGA 1GJ7B 4E05H 4CR9A 2CK3D 8KME2 1EX3A 2K1QA 1SOTA 2FM2A 3M5NA 4LZ4B 1COWD 1C1NA 1BTWA 1AFEH 2C8WB 1D3QB 5EIYA 1OOKB 2UUFB 1V2NT 2JETB 2KR7A 4YLUA 1QCPA 1SKYE 1EB2A 2WZQA 3SHAH 1AD8H 1HAIH 1OYQA 1DANH 4MPVA 3ZVBA 1V2LT 3KYFA 1BRUP 3JZ2B 3RXCA 3DFJA 2G5NA 3GDSA 3NPSA 3F9EA 3F6UH 1GWAA 1MTUA 1ZHRA 1WUNH 3GCTF 3SQHE 1W2KH 4HTCH 2ZDMA 4AFZA 1W7GH 1UTLM 3ZZ4A 5G4BA 3MYWA 1ZOMA 1MTWA 4JYVH 2G81E 4WVPE 1FY1A 3UWJH 4ISOA 1AFQB 1YKTA 4I33A 1VKYA 1THSH 9LPRA 2PFEA 1O2TA 2FTLE 1TNHA 1FY4A 4F55A 1TBQH 2ZF0H 5EQQA 3ITIA 1GPZA 1ZTJA 3VB6A 2Y5FA 1GMHF 1RJXB 1SGIB 2QYIA 3SNBA 1FAXA 1LVOA 1ELFA 4Q4LA 4JZDH 3ZZAA 2BLQA 5C5OA 3VEQB 1LHCH 2G52A 2XWBI 2ALVA 2JIZD 1NRNH 4F4OC 2ZHFH 2YNBA 1KTSB 5C20A 1O2SA 2ZHWH 1SGNE 1SGEE 1C4U2 5DO4H 1HAGE 2XCNA 8LPRA 4B2CA 4Z0KA 3BN9A 3FP6E 1IHTH 3PRBA 1MTSA 2FOBA 1PFXC 2W3KA 2OK5A 3SJKA 1SLVB 5JYIA 1TPAE 5PTPA 3RMOH 2R2MB 1A46H 3HK3B 2Z9KA 3SNDA 3SO3A 3U8RH 2WSSD 4MNVA 5K0HA 1Z8GA 1O2MA 1IQJA 2VH6A 3EA7A 5CHBA 1OKXA 2TGDA 2UWLA 4JYUH 4O9VA 3MO6A 3SGAE 3WW7A 4H4FA 1OP2A 2ZO3H 2CXVA 3EQ0H 1EKBB 3TJVA 1O3FA 5A09A 1GI4A 1HAXB 1NFWA 2AERH 5DP9A 2A0QB 3LJOA 3MH6A 2FI3E 3AW1A 1C2MA 4D9QA 1VCQA 5FAHA 3SI4H 2W6JD 2A5KA 2P93A 1GHXH 2BQ7B 3SGBE 2V3HH 4MTBA 1CHOG 2QXIA 4NSVA 4Y79A 4YOGA 4A1TA 5AFYH 4ABDA 4X8UH 2F9VA 7GCHG 1LHGH 3TNSA 3PO1B 1G3CA 2PGQB 1NBME 3E3TA 1C4Y2 2Y82A 1GI1A 3A7VA 4UEHH 1AB9B 5EXMA 2EI7A 1B5GH 1PPBH 1S85A 2FOHA 4JCNA 1C1OA 4RKJB 3I78A 1DVAH 1MD8A 2F9BH 2ZPQA 2ZU2A 4U2WA 3RXOA 1AGJA 3OEED 4IMZA 3P8OA 3AW0A 4NA9H 3BG4B 1NY22 1QBOA 3BSQA 4IN2A 1J9CH 2IN2A 1BMNH 1FDPA 4ABEA 3BTWE 3U98H 2PKAB 1GJCB 2RDLA 1QR3E 3SHCH 5EU8A 4AOQA 3GCNA 3RXKA 3MFJA 1GI3A 1EAUA 1TOCB 1TX8A 2ZP0H 1O3CA 1O2YA 1GJ6A 4I8JA 2Q6FA 4K1EA 4NIYA 1P06A 1XM1A 2A32A 3UFAA 1BMAA 4D76A 1YCPK 1ELVA 5ESTE 5A2MH 1OWIA 3RU4T 2VH0A 2P94A 1O36A 4TYDA 1ETSH 1OWJA 1MKWH 4RN6A 5A8XA 3LC3A 5FPTA 3WY8A 1Z6JH 2ZEBA 2A7HA 1SGCA 4CHAB 2A1DB 3DSOA 3URDA 2PSXA 1OSSA 1AQ7A 2HWLB 1UCYH 1NZQH 1T8LA 3QZRA 1G3EA 2W5EA 3K6YA 1OYTH 1GBJA 3M35A 3OTJE 1AHTH 2XXLA 2OLGA 3PO1C 3O8CA 3BTFE 1GHAG 1NM6A 1SGTA 4YO9A 1LVMA 1O38A 3F2GA 2TGTA 2ZZUH 3FZZA 2XWAA 5DN6D 4NA8A 1C5YB 3BEUA 1JRTA 1NC6A 4A7IB 1J14A 4FOUC 2HNTE 1BMLA 2IPQX 1DY8A 2DE8A 4Q7YA 1A0HB 1V2JT 3GY2A 2J95A 3UR9A 3V12A 1WXRA 1EFRD 1T8NA 2PUQH 3RC4A 5EODA 4IN1A 1TMTH 3M36A 3T28A 1E34B 1BT7A 2XBVA 1DWCH 1TGBA 2V3OH 1D4PB 1AUTC 4INHA 1C1TA 2WPMS 1DFPA 2ZHDA 4U30A 1O35A 2QXJA 1E38B 3TU7H 3A8DA 1KXBA 4ZAEA 1MQ5A 2Z3CA 2HRVA 3GCOA 1V2TT 5FXLA 4AZ2B 1CT0E 3BTTE 1AZZA 1BRAA 3LIWA 3LKWA 2OTVA 1H9LB 3A7ZA 1XX9A 1UJ1A 5K7RA 1G9IE 1ABIH 2W26A 2ZA5A 3K65B 3A87A 1O2XA 3RLYH 1FMGA 1ELGA 1O39A 1XXFA 4JMYA 4B6EA 4BXWA 5C94A 1C5LH 1TA2A 1MU6B 2G8TA 3PRDA 1IQLA 5T6FA 4F49A 1W0YH 5F8TA 3RXHA 1P10A 3NK8A 3Q77A 1SR5C 4UFEH 1HNEE 3MNCA 1OWHA 2CHAC 1S6HA 1P04A 3TVJB 1SGDE 3RU4D 1UTKA 4FU7A 4D7FA 4ZXXH 2GDDA 1Z1JA 1Q2WA 1NBMD 3F68H 3ZZBA 4AB8A 3VXEH 3PTBA 2XCFA 3TIUA 1OP0A 1H8IH 2SGFE 3BTHE 3MU8A 4VGCC 3KQ5A 5DP3A 4U32A 4X8VH 1F92A 1B0EA 1Y8TA 4OS7A 5AFZH 4GCHF 3S69A 1OWKA 1GJ5H 2UUJB 3RMNH 4IGDA 4DT4A 3URCA 2F3CE 3ZYEA 1EASA 2H5DA 1MAXA 1NO9H 2GZ9A 5DP8A 3NZIA 5A0CA 3NWUA 3IITA 2Z3DA 3LGTA 5EXNA 1GJ4H 1YPLH 1W0JD 1ZMLA 2ANKH 3C27B 2F9PA 2W7SA 3KQEA 2BD8A 1AWHB 5I46H 1YPHC 1K1NA 2G00A 2NU1E 2WPIS 3W1EA 4Y8YA 5F6MA 1RRKA 3LT3A 1ABJH 2NU4E 3ZZ7A 4FUDA 1TBRH 1UTQA 2EC9H 1Z6EA 1ESBA 3EA8A 1TNLA 3A84A 2D8WA 2JDID 3SUDA 3TPIZ 4CRAA 3SV9A 4XE4A 2V3MA 4Y6DA 2BHGA 1IQFA 1TYNA 2XOKD 4ABBA 3Q3YA 1EZSC 1GBHA 3LDXH 4CH8B 3H7TA 1LHDH 1BJUA 3Q3XA 2GV7A 1OX1A 3PWCA 1YGCH 2UWPA 1LQDB 1L0ZA 4UFFH 3MO9A 3N7DA 5DP4A 1CO7E 4YT6H 3FP7E 2CMYA 2QN5T 3BIVH 2XBYA 1YF4A 3GY3A 4AGKA 2AEIH 2A4OA 2GDEH 3U69H 3M3VA 1FV9A 4JYTA 4MPUA 1GDUA 4GHQA 3Q76A 1F2SE 1AMHA 1C1RA 4BAMB 4RT0A 3F9HA 3HKIB 1AKSA 4ZH8A 5F8XA 5C0TA 3TGKE 4X2YA 2HPQH 4BANB 3SU1A 2ZCKP 2QF5A 2ZC9H 4HFPB 1SGQE 4JZIA 3S9BA 1WYKA 3Q3KA 3D23A 3VB3A 4AFSA 1W3CA 3IWMA 1YLDA 1ZZZA 4KGAA 4DIHH 4X6OA 3FANA 4MG3A 4OM9A 1BITA 2RFKC 1GBAA 3UPEA 2GD4B 5HXFA 2KCOA 4FUBA 1PQAA 2ZHEH 1HAPH 2W6ID 2ULLA 2V0BA 1S0QA 1GDQA 1FIZA 2I6SA 2O8TA 2BLVA 3EAJA 5L2ZH 4IBLH 3O8BA 1HJAC 2PHBA 4B76A 3QZQA 1ETTH 1K21H 2D26C 3D49H 3SUGA 5C1XA 1TNIA 4JZFH 1QHRB 5C2ZA 2VIOA 2TPIZ 3N99A 4DCDA 2EA3A 1UHBB 3UAIC 1C2FA 6ESTA 1NRRH 3VGCB 1SVPA 3QN7A 3BIUH 1DWBH 1ZHMA 4TWYA 5GCHF 5T6DA 1LPZB 1NRSH 4E7NA 3MU4A 1VITH 1TRNA 5FHTA 4ACBA 2BLWA 1PYTC 5B6OA 1AE5A 1O3OA 3D62A 1KXDA 5C3NA 3ATMA 3A82A 1P57B 1MBQA 1MTNB 3I29A 5J4SA 2ZFTA 4MNYA 4BTTB 2B0FA
chains in the Genus database with same CATH topology
2ZFSA 4MNXA 1CVWH 4IC5A 1NRQH 1GI0A 3T27A 1UTNA 1HCGA 3T5FH 1SGRE 1BA8B 1P03A 5DGJA 1P2MA 2GP9B 1DUEA 3O8DA 3ZVCA 3SV8A 3AASA 4YTAA 1ARBA 1P2OA 1LDTT 2H9EH 4AG1A 1VGCC 1CBWC 1XKBC 2VGCB 3E90B 4BNRA 1TX7A 3LONA 2QF3A 4ZKSU 2G4UA 4BAHB 1TNKA 4MPXA 4ISNA 4CREA 1IQEA 1J16A 2A5IA 5GPIB 2G51A 2SFAA 3A88A 3NKKA 2ODPA 2WV4A 2WYJA 3RP2A 1ZGIA 1K2I1 2ZFPH 2Z9GA 3PLKA 3RMMH 3ZZ8A 1L1GA 1BQYA 4X1QU 1BTPA 1P9SA 4ZUHA 4YOJA 2PR3A 1DXPA 1ZJKA 3BEFB 5EQSA 1GHBG 4ZKNU 1SLXB 4YESB 2CF9H 2J38A 2BD5A 1SBWA 1TGCA 3A85A 2XBXA 2THFB 1IQNA 1K1PA 3H5CB 2ZNKH 1AVWA 2ZDAH 2XTTB 5A0BA 2B8OH 1GI6A 1D6WA 2EI8A 1C2LA 1ZRKA 2H9TH 1C1SA 1WQVH 1XMNB 3TNTA 1ZRBA 3E0PB 1C5TA 1TB6H 3B8JA 1GI5A 3MMGA 4HI3A 1O2PA 4XFQA 4NFEA 4NG9H 3OY5U 1UHBA 2OQ5A 3MNSA 1G3BA 4DOQA 1L4DA 1QURH 1XUJA 1O2IA 4E7RG 1VGCB 4MPWA 2BDGA 4YZUA 2GGVB 2VWNA 4K60A 2J9NA 1JWTA 1S0RA 2A7JA 1GBLA 1IHSH 1UTOA 2BVRH 3LGWA 4B74A 2OUAA 2O9QA 2O8UA 4FUHA 2BY8X 1O33A 3KQCA 1Y5UT 1ID5H 1A5IA 1C1WH 3CENA 1O3IA 1K28D 2WYGA 1P8VC 1C9TA 3HGNA 3QGNB 1WTHD 1DDJA 1Y3XA 1OPHB 2ZKSA 4WH6A 1XUGA 2XW9A 3UY9A 1U6QA 4CRBA 1ELEE 1EOLA 5H4IB 2QF0A 3FP8E 2PWXA 5F03A 1C2DA 2W3IA 4NCYA 1F0RA 4K8BA 1DSTA 1UVTH 1JBUH 1ANEA 4WMEA 1MTVA 3BTKE 4GLYA 1KIGH 1AIXH 1NFUA 2BY9X 4B2AA 1LMWB 1NESE 2OCVB 1A5GH 1AFQC 2BDBA 1IQGA 3GCTG 2C4FH 4JK6A 4GVUA 1TQ7B 2SGPE 1F0SA 3SUFA 1O0DH 1O3LA 4H42U 4I31A 4OS5A 5L6NH 2FI4E 4CR5A 1PQ8A 1TAWA 3E1XB 3F9GA 3RXIA 1N8OC 1UCYE 1RFNA 3A8AA 5GXPA 1V2RT 3RXBA 2GTBA 4NWKA 4XBCA 2CN0H 4AORA 1VITF 4JZEH 1BBRK 2SGDE 1CHGA 2Q6DA 3KHVA 4XBDA 1GGDC 2JKHA 3C1KA 2BD7A 2D2DA 1UTMA 1SHHB 1NU9A 2B9LA 1C5UA 1K1MA 3RXUA 1OP8A 4Y7AA 1SGPE 4IW4E 1QRZA 3V0XA 5CHAB 1C5PA 1QRXA 1P01A 1SL3A 1GBKA 1Z8RA 1AN1E 2VIVA 2ZWLH 3TITA 2A7CA 3GISB 2QC2A 4BXSA 1ZMNA 5HM2A 2G55A 1T4UH 4BAKB 1HJ9A 4Y71A 3A89A 1C5WB 2P3UB 1CA0C 3BTDE 2Y80A 1KXFA 1FN6A 4IMQA 4Y0YE 1QA0A 1TIOA 2IJOB 3TGIE 4FUJA 3QO6A 5EG4A 1GI8B 4LOYH 3T26A 2B7DH 1RS0A 2F9UA 2FODA 2O8WA 1G2MA 1TGNA 3RUOA 2FS8A 3QTOH 4H6SB 5JDUB 1P09A 3M37A 1N6XA 3EYDA 4B1TA 2F83A 1WSSH 1TFXA 4CRDA 1WV7H 1MU8B 1HAVA 3OU0A 3KN2A 4B73A 1IOEA 3UWIA 5DP7A 1EPTA 1OWDA 1W10U 1FONA 2A5AA 1GGDB 3M3SA 4Y76A 5E2OA 4OS1A 3MNBA 1QIXB 1JMOH 2HGTH 2Y5GA 1T31A 4ABHA 2ANYA 3BG4C 3K9XB 1ZR0A 3S7HB 4WJG2 1ZHPA 3GY7A 4X8SH 3BTGE 1EZUC 2FLBH 4CRFA 5FCKA 1THRH 4KTUA 3S7KB 1TABE 1IQMA 4Y10E 2D1JA 3PMBB 5HYOA 1H4WA 1GCTC 2J92A 6CHAC 1W14U 2VWOA 3EA9A 1V2WT 1P2NA 2R2WU 1DM4B 3BG8A 2BB4A 1N6YA 2A4RA 4UE7H 4DW2U 2H9HA 1VR1H 5LGOA 1C2KA 1HXFH 1GBIA 3RM0H 3T29A 5TCAA 1L2EA 1QL7A 4X6NA 1LKBA 3E91A 2ALPA 5JBCS 1DWDH 3LPRA 1A4WH 1C2JA 5CMXH 3BTME 3ELAH 2BMGB 5C1YA 3OSYA 3ESTA 4ABGA 1EOJA 4O3TA 2DE9A 3PMJA 1CGHA 1WOFA 1W12U 4WY3A 2VVVA 2ZU3A 1QJ1B 1MCVA 4NIWA 3RXRA 2RA0A 3A81A 2ANWA 3F1SB 1O2RA 1WAYB 3P17H 5EQRA 2JH6D 3PLBA 5JBBS 1MH0A 2ZCLP 1BIOA 1C9PA 2ZGJA 4JK5A 1BOQA 3PM3A 4A5TS 4AFUA 1MAYA 5C67A 4CRCA 1GCTB 3PLPA 3AAUA 1DXWA 4ABJA 1EJNA 2ZTZA 1GMDG 1RXPA 4NFFA 1IQHA 4TPIZ 2NU3E 1XKAC 4J2YB 2BDIA 1ZPZA 4OGXA 2R0LA 2OC1A 2CF8H 5A8YA 3TH2H 2ASUB 4NIXA 2BDYA 9ESTA 3ZVAA 3SU4A 1GI7B 2HNTF 3MTYA 4K2YA 7LPRA 3SV7A 2PKAA 2IPHA 2FESH 3DT0H 4A6LA 2ZPRA 3RC6A 1D9IA 1HAYB 2SGAA 1NS3A 1TPPA 1A3EH 3SNCA 2QXHA 1BDAA 3M7UA 2Q6GA 1O3JA 3SU0A 3TJUA 2LNCA 1BTZA 1TBZH 1SPJA 3LGUA 1UMAH 3KF2A 1K1IA 5SGAE 1SLWB 2ZTXA 2FX6A 5HM9A 1A3BH 1SQAA 4WMFA 1XUHA 2BX4A 1XXDA 3DFLA 1ESTA 2GZ8A 2CHAB 3B9FH 1EUFA 2DUCA 4B2BA 2VIPA 3ZZ3A 1SHYA 2ZPSA 4GPGA 4GSOA 2PKSB 1EQ9A 3U8OH 2UUKB 1ELBA 3ATKA 4X2XA 3O8RA 3P8NA 1AU8A 1MMJN 1SFQB 2IOTA 1ELCA 1SGFG 1ZGVA 1VCPA 3QUMP 1E37B 3A8BA 1FIWA 1JRSA 1BJVA 3A83A 3P95A 3SBKA 1P2IA 1XUFA 4KTSA 4GHTA 4WWYA 1CGJE 7KMEH 1O2UA 3NCLA 1QL9A 1ACBE 1S83A 3CP7A 1CQQA 1TLDA 1QGFA 1ANBA 1PJPA 4OS2A 1LPKB 3QK1A 2OBQA 2JH5D 5EXLA 2R3UA 1V2KT 2TGAA 3EDXB 1K1JA 2FDAA 3ATLA 5JB9S 1P05A 4K1TA 2TGPZ 1GBMA 3SGQE 2Y5HA 1FY8E 4DY7B 3W95A 2FWWA 1TNGA 2ZU5A 3LU9B 1UVSH 1C1MA 1DLKB 3BF6H 4KTCA 1ELDE 1BRBE 1EZXC 1T32A 4LZ1H 2FI5E 1C5NH 2BQ6B 1QBNA 5DJ7A 1TX6A 3PWBA 2KAIA 4SGAE 2YNAA 2Z9LA 1THPB 1VCWA 1F5KU 4R0IA 1EXFA 2VB0A 3CS7A 1RD3B 2VINA 4DT7B 2BLOA 2Z3EA 3RXMA 3ODDA 2VIQA 1C2IA 4MNWA 5LPRA 3LOXA 4UDWH 4MVNA 3A7YA 1LO6A 1NU7B 3TK5A 4BTUB 2OINA 1AVGH 3HK6B 3DHKH 3RXJA 3ENSB 1YCPM 2BZAA 3GY8A 1HFDA 4FUEA 2PW8H 1H9IE 3T62A 2QV1A 5EW1H 4AB9A 1TA6A 2PTNA 2SNWA 3MWIU 4I8KA 4Q7XA 2WV5A 1GHWH 5GWZA 1FJSA 1DICA 1O34A 3L33A 3B23B 1J15A 3Q00A 1HIAA 2QIQA 3U1JB 1CT2E 3T25A 1CSOE 1OXGA 1EAXA 3G01A 1C5VA 3TK6A 3BTQE 1KY9A 8GCHF 2BM2A 1JIMA 4B71A 1AUJA 2BY5X 4WH8A 2R0KA 2V6NA 1V2MT 1GI2A 2GMTC 1TGSZ 3DD2H 2XBWA 4PROA 2Q1JA 1TRYA 2C8ZB 2ZI2H 1TOMH 1ZPBA 1KLTA 2B5TB 4ABFA 1ELAA 2XRCA 2CGAA 5EPNA 4ZHLU 1YPGH 4X1PU 4DGJA 1CGIE 1UK2A 4ZXYH 7GCHF 2QGRA 1LTOA 1NPMA 3R3GB 2FXRA 1SGFA 1YPJH 2GKVE 1CE5A 3L6PA 4IC6A 3QLPH 3UOUA 3LC5A 2P3FH 4AN7A 2ZDKA 1SQTA 3GY5A 6GCHG 4HZHA 1L4ZA 1HAHH 2A4GA 2BZ6H 1GG6C 4ZHAA 3E8LA 5GDSH 1C1QA 1SMFE 3UNQA 1FI8A 1DPOA 2BD4A 3S0NA 1LHEH 4VGCB 1SC8U 1O37A 4WMDA 1AVXA 1SOZA 3IG6B 1WCZA 2ANMH 1W8BH 1YYY1 2FZZA 3KQBA 2ZQ1A 1MZDA 4AFQA 1LKAA 1VJ9U 5EOKA 1Q3XA 2OXSA 1LQEA 2GVFA 2RCEA 4UFDH 5E0JA 2FYQA 1O3BA 2Z7FE 1SB1H 3EE0B 4THNH 2SNVA 3M61U 4MQAA 1W7XH 2WUCA 1O2ZA 2W7UA 1MZAA 3V13A 2NU2E 1Y59T 1GL1A 1TONA 1XVMA 1YCPH 2FOAA 2VWLA 8ESTE 1QFKH 2RA3A 1XUIA 4YLQH 5JBTA 1H8DH 1ZMJA 2ZECA 1L1JA 4AGJA 1Y5AT 2BY7X 3UTUH 3BEIB 2BTCE 2ZHQH 1P3CA 2FOEA 1P02A 2PSYA 1HXEH 1IQKA 4BOHA 2Y81A 1G36A 2ZGCA 1GBBA 1GBFA 4O3UA 2J94A 1TWXB 2P3TB 1V2PT 1MQ6A 1O5GH 1QQ4A 1O3DA 2KAIB 1G37A 1M9UA 2RG3A 1TQ0B 1TPSA 4X6PA 3A8CA 3SORA 1NFYA 4BAQB 5FX6A 1NTPA 1DT2A 1HIAB 3MH7A 4Q7ZA 1EPTB 4ABAA 1ZYOA 3GYMA 1E0FD 6GCHF 1AE8H 4X6MA 5IYTA 3ZV8A 3NXPA 1B0FA 1Y3YA 3RC5A 1HJ8A 3DUXH 3ZZ9A 2AIQA 1XVOA 4MLFB 1V2UT 2WPJS 4GCHG 3M7QA 2O8LA 3VXFH 1A7SA 1Z8IB 2AYWA 2ZGXH 2ZG0H 3EGKH 2CV3A 2OBOA 3GOVB 1O3KA 4ASHA 1BRCE 3LH1A 4X1SU 4Y11E 4K1SA 1DWEH 4FXGH 2BVSH 1E35B 1KSNA 2ZDVH 1BHXF 1FY5A 1K1LA 1RIWC 2JH0D 3SW2B 1UCYK 2G5VA 1TRMA 3BV9B 7ESTE 1EB1H 1K9OE 5IDKA 1V6DA 3CS0A 2HPPH 4I8HA 1AB9C 1T8MA 1BMMH 2ZDNA 1FXYA 1DSUA 3HGPA 3TJNA 3M5MA 4X1NU 2PLXA 2AMPA 1EJAA 1TMBH 1Z8JB 4BTIB 2VWMA 3KQDA 5ABWA 1EJMA 1Y3UA 1NN6A 4CBNA 2WPLS 3GY6A 3M5LA 3MU1A 3FZDA 3M5OA 1DLEA 1J17T 2BXTH 4FVBA 1VITG 5CHAC 1DOJA 4NWLA 1GMCF 2GX4A 4XBBA 1O5EH 4UFGH 1O5FH 4HGCA 1KLIH 1C5SA 1UTPA 5FCRA 4K69A 2ZFQH 1KXCA 1YPHE 1RTFB 3RXEA 1ANDA 1YM0A 1O5BB 1V3XA 3A86A 3RXPA 1TGTA 4Y8XA 3MOCA 3AVZA 1FLEE 3U1IB 1DY9A 5FX5A 5J4QA 1HAZB 3GY4A 3VB5A 3LGVA 1ARCA 1RGQA 1S84A 2ZGBH 5T3HA 4LK4A 2NWNA 1Z1IA 3KEEA 4CHAC 2ZU1A 3K2UA 1ZSJA 1C5QA 1O3NA 1SG8B 5TCCA 1DITH 2Z9IA 3RXVA 5I25A 4J1YA 1RIWB 2UWOA 2FEQH 1P0SH 1MTNC 1O2HA 1QY6A 5FPYA 2C8XB 2GV6A 1C1UH 3KCGH 2P59A 2NU0E 3UQOA 1EATA 4X2WA 4UONA 1O2JA 2BOKA 5A8ZA 2FOFA 1FPHH 2C93B 1HLTH 2Y7ZA 1YPEH 2I6QA 1A1RA 1UK3A 2AFQB 3K6ZA 3H7OA 4NZQA 1O2NA 1QRWA 1GHZA 2ZDLA 2VGCC 1L1NA 1O2GH 1BZXE 1UVOA 4IS5A 1O32A 1JIRA 3SZNA 5DK1A 1ESAA 1BCUH 2AMQA 4A1XA 1ANCA 3A7XA 2H6MA 4NSYA 1GL0E 5L30H 1V2VT 1HYLA 2ESTE 3KL6A 5DKMA 4OGYA 1RTKA 4ISIH 4INKA 1BTUA 1C2GA 1FN8A 1V2ST 5E0HA 4O97A 2ZFRH 2STAE 1H9HE 1QQUA 1GJBB 3JZ1B 1GJAB 1QTFA 4M7GA 2JETC 3P92A 2SGQE 1GMDF 2OC7A 3UUZA 1SFIA 1C5RA 3RM2H 1GVKB 4TWWA 5ETXA 3P8FA 1O31A 4CH2B 2VU8E 3GYLB 4ZKRU 1O3HA 4NA7A 2HLCA 2BD2A 2FOCA 3GICB 3LGIA 3RXFA 1GVZA 3SJOA 2OC0A 3ZV9A 2F9OA 2AGGX 3SNAA 5EGMA 2PTCE 2WPHS 2J34A 4FU9A 4FUCA 1G32B 2QA9E 1S81A 1YBWA 1AO5A 1MD7A 1UVUH 3V7TA 1P3EA 1QA7A 1CHOF 3TH4H 3UNSA 4AG2A 3S9CA 1GDNA 1QNJA 2YOLA 5GCHG 1CT4E 1S82A 4I8GA 1J8AA 3N7OA 5C5NA 1IAUA 1GVLA 1BUIA 4I7YH 1NFXA 2FX4A 1C1PA 1HB0B 5JPMH 2EI6A 1GHBF 3S9AA 3ZVFA 4A1VA 4Y8ZA 2VVCA 1FPCH 1CU1A 1HGTH 1WTGH 4NGAH 2VNTA 1GBCA 3PV4A 3RLWH 4FUGA 3P8GA 2QXGA 3ZZDA 1PPHE 2P16A 3TLOA 1C2HA 1SI5H 2FP7B 2ZTYA 3RXQA 5LPEA 2FMJA 1O3MA 1O30A 5BRRE 5DPAA 3STIA 2ZFFH 5DP5A 1BTHH 1BTYA