2A53A

Fluorescent protein asfp595, a143s, off-state
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
HGSASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like non-fluorescent chromoprotein FP595 chain 1
publication title Structure and mechanism of the reversible photoswitch of a fluorescent protein
pubmed doi rcsb
source organism Anemonia sulcata
molecule tags Luminescent protein
total genus 9
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a53A00
3LF4A 2A53A 2GW4A 3CFFL 2G16A 2G5ZA 2A52A 3CFAL 3CFHL 2G2SA 2A54A 2A50A 2A56A 2G3DA 5EXCA
chains in the Genus database with same CATH superfamily
2A53A 3IOCA 3MXTA 2LMEA 4EF6A 4MUJA 2GR7A 1N2OA 2G3DA 2A84A 4DDMA 3UK2A 4EFKA 3CFHL 3IMGA 1N2JA 4DDKA 2G16A 2A52A 3MUEA 1MOPA 3COYA 4IXJA 2A54A 2A50A 3IOBA 4MUNA 3IMCA 4MQ6A 3QTTA 4MUIA 3CFAL 2I52A 3IVCA 3HL6A 3AG6A 3IVGA 4MULA 5KWVA 4G5YA 3INNA 2G2SA 2RETA 3CI0K 3UY4A 2IECA 1N2BA 4DE5A 3IUBA 4DDHA 2A56A 4G5FA 3AG5A 3IVXA 3LE8A 2X3FA 2GW4A 2A86A 3UA0A 4MUEA 1N2IA 3COWA 1IHOA 3Q12A 3EMOA 5BW0B 3ISJA 1N2GA 3CFIA 2EJCA 4MUKA 3Q10A 3COZA 1UFVA 1N2HA 3N8HA 2A88A 4BHRA 3CFFL 3IMEA 3CI0I 1V8FA 3IOEA 5G2FA 4MUGA 4FZJA 3IUEA 3COVA 3IODA 2OGFA 2A7XA 4MUFA 1N2EA 2G5ZA 4MUHA 5HG0A 2GR8A 3LF4A 5EXCA
chains in the Genus database with same CATH topology
2A53A 3IOCA 3MXTA 4EF6A 4MUJA 1N2OA 2G3DA 2A84A 4DDMA 3UK2A 4EFKA 3CFHL 3IMGA 1N2JA 4DDKA 2G16A 2A52A 3MUEA 1MOPA 3COYA 4IXJA 2A54A 2A50A 3IOBA 4MUNA 3IMCA 4MQ6A 3QTTA 4MUIA 3CFAL 3IVCA 3HL6A 3AG6A 3IVGA 4MULA 5KWVA 4G5YA 3INNA 2G2SA 3UY4A 1N2BA 4DE5A 3IUBA 4DDHA 2A56A 4G5FA 3AG5A 3IVXA 3LE8A 2X3FA 2GW4A 2A86A 3UA0A 4MUEA 1N2IA 3COWA 1IHOA 3Q12A 3ISJA 1N2GA 2EJCA 4MUKA 3Q10A 3COZA 1UFVA 1N2HA 3N8HA 2A88A 4BHRA 3CFFL 3IMEA 1V8FA 3IOEA 5G2FA 4MUGA 4FZJA 3IUEA 3COVA 3IODA 2A7XA 4MUFA 1N2EA 2G5ZA 4MUHA 5HG0A 3LF4A 5EXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LF4 A;  2A53 A;  2GW4 A;  3CFF L;  2G16 A;  2G5Z A;  2A52 A;  3CFA L;  3CFH L;  2G2S A;  2A54 A;  2A50 A;  2A56 A;  2G3D A;  5EXC A; 
#chains in the Genus database with same CATH topology
 2A53 A;  3IOC A;  3MXT A;  2LME A;  4EF6 A;  4MUJ A;  2GR7 A;  1N2O A;  2G3D A;  2A84 A;  4DDM A;  3UK2 A;  4EFK A;  3CFH L;  3IMG A;  1N2J A;  4DDK A;  2G16 A;  2A52 A;  3MUE A;  1MOP A;  3COY A;  4IXJ A;  2A54 A;  2A50 A;  3IOB A;  4MUN A;  3IMC A;  4MQ6 A;  3QTT A;  4MUI A;  3CFA L;  2I52 A;  3IVC A;  3HL6 A;  3AG6 A;  3IVG A;  4MUL A;  5KWV A;  4G5Y A;  3INN A;  2G2S A;  2RET A;  3CI0 K;  3UY4 A;  2IEC A;  1N2B A;  4DE5 A;  3IUB A;  4DDH A;  2A56 A;  4G5F A;  3AG5 A;  3IVX A;  3LE8 A;  2X3F A;  2GW4 A;  2A86 A;  3UA0 A;  4MUE A;  1N2I A;  3COW A;  1IHO A;  3Q12 A;  3EMO A;  5BW0 B;  3ISJ A;  1N2G A;  3CFI A;  2EJC A;  4MUK A;  3Q10 A;  3COZ A;  1UFV A;  1N2H A;  3N8H A;  2A88 A;  4BHR A;  3CFF L;  3IME A;  3CI0 I;  1V8F A;  3IOE A;  5G2F A;  4MUG A;  4FZJ A;  3IUE A;  3COV A;  3IOD A;  2OGF A;  2A7X A;  4MUF A;  1N2E A;  2G5Z A;  4MUH A;  5HG0 A;  2GR8 A;  3LF4 A;  5EXC A; 
#chains in the Genus database with same CATH homology
 2A53 A;  3IOC A;  3MXT A;  4EF6 A;  4MUJ A;  1N2O A;  2G3D A;  2A84 A;  4DDM A;  3UK2 A;  4EFK A;  3CFH L;  3IMG A;  1N2J A;  4DDK A;  2G16 A;  2A52 A;  3MUE A;  1MOP A;  3COY A;  4IXJ A;  2A54 A;  2A50 A;  3IOB A;  4MUN A;  3IMC A;  4MQ6 A;  3QTT A;  4MUI A;  3CFA L;  3IVC A;  3HL6 A;  3AG6 A;  3IVG A;  4MUL A;  5KWV A;  4G5Y A;  3INN A;  2G2S A;  3UY4 A;  1N2B A;  4DE5 A;  3IUB A;  4DDH A;  2A56 A;  4G5F A;  3AG5 A;  3IVX A;  3LE8 A;  2X3F A;  2GW4 A;  2A86 A;  3UA0 A;  4MUE A;  1N2I A;  3COW A;  1IHO A;  3Q12 A;  3ISJ A;  1N2G A;  2EJC A;  4MUK A;  3Q10 A;  3COZ A;  1UFV A;  1N2H A;  3N8H A;  2A88 A;  4BHR A;  3CFF L;  3IME A;  1V8F A;  3IOE A;  5G2F A;  4MUG A;  4FZJ A;  3IUE A;  3COV A;  3IOD A;  2A7X A;  4MUF A;  1N2E A;  2G5Z A;  4MUH A;  5HG0 A;  3LF4 A;  5EXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...