2A57A

Structure of 6,7-dimthyl-8-ribityllumazine synthase from schizosaccharomyces pombe mutant w27y with bound ligand 6-carboxyethyl-7-oxo-8-ribityllumazine
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
LKGPELRILIVHARYNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSWELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVILGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
publication title Structural basis of charge transfer complex formation by riboflavin bound to 6,7-dimethyl-8-ribityllumazine synthase
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 49
structure length 146
sequence length 146
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2a57A00
1DI0A 1C41A 1KYXA 1XN1A 1KYVA 2A59A 2A57A 2F59A 2O6HA 2C94A 3MK31 3NQ41 1RVV1 1W29A 1NQXA 5IM4A 1NQVA 1C2YA 1ZISA 2B99A 2C9DA 1HQKA 1KZ1A 1W19A 1EJBA 1KYYA 2B98A 4KQ6A 1NQUA 1KZ6A 2JFBA 1KZ9A 5IM5A 2OBXA 2C97A 4J07A 1T13A 1KZ4A 1NQWA 2I0FA 2C9BA 2VI5A 2A58A 2C92A
chains in the Genus database with same CATH superfamily
4KYIB 5A5GA 2P67A 3PTAA 4O1HA 2RHTA 4B6QA 1A71A 2DPHA 3U62A 3UH1A 3GLFE 1FFAA 4TWBA 1V26A 2AVDA 2JIDA 3U7RA 1FX1A 1YQXA 1JIKA 4TQGA 2NTEA 5F2EA 1XD2B 3LDAA 1W581 4QFBA 4IDAA 3U16A 3ED1A 1TCCA 1VG0B 4G2NA 4MVCA 1PZHA 1YR9A 3CZAA 1SVOA 5A9TA 2CNKA 4IJWA 1IDOA 1MR3F 4AF8A 4RAOA 4WNIA 1JI3A 4OJYA 4GGPA 4LRTB 3O90A 1B42A 5IEBA 3GCXA 3YASA 1GAQA 3EDYA 4Y9TA 4AZWA 2I6SA 3USES 4OKIA 1N8KA 3FKQA 3T0FA 2B1GA 1RHJA 4BGUA 2HL6A 1U5BB 2H63A 3G0OA 3OOHA 5BQ5A 3KYCB 4OHPA 4NABA 4RFSB 1Z12A 1SBYA 3PNPA 5EIOA 4LJ9A 1D2GA 4GPBA 1YKGA 1E1RA 3SJ7A 3ANMA 5B4TA 5C7OO 1SU6A 4TOIA 4JOSA 1KMHB 1KYZA 2KHZA 2JAXA 4I9HA 2I2DA 1E3DA 4JFRA 1SVLA 3CVXA 4A8JC 1JDUA 3EQ7A 1HNXB 4FBLA 2P3OA 3FOZA 1QHYA 4BMZA 1DQSA 2GK4A 1OV4A 2P4EA 2IH5A 3HADA 4EKIA 4IRXA 1Q2UA 5K8JB 5K8IA 5FA5A 1HPLA 1NXQA 3DZHA 3HI6A 1EINA 1P3JA 1TT5B 2BDUA 1L4FA 1R27A 2CL0X 1EFRA 3ABZA 3BCSA 4PNHA 3RREA 1I7SB 1SM4A 4FE3A 4QQKA 1P0FA 4N5LA 4K05A 6NULA 1KH3A 1F14A 5EZQA 4JJKA 1NI5A 2J9ZB 2FY8A 3HFSA 3L0OA 1VCHA 3ZH2A 3PJEA 4GOKA 1SD5A 1OI2A 2EX4A 1OPXA 2Q1XA 3IIMA 4QHTA 1TK3A 3E9DA 4DJ5X 3WYNA 1HBJA 1PKXA 4JGGA 1OYVA 1M9NA 2FUG1 3ELUA 4GXQA 4RANA 4DYDA 4P80A 1JA9A 2RKOA 1DMSA 5HUJA 3WGMA 2HLDD 3ZCRA 1UQTA 4C06A 4E5MA 3JZDA 2D0IA 3B1YA 4X92A 4CV1A 3UMJA 3NV9A 2QTLA 1C30A 2NZUG 3B9BA 3F67A 4F04A 4ZYXA 1CHDA 5ALRA 3FB4A 3MBIA 2IF0A 3BM5A 2VI5A 2YIMA 3K94A 4TZ0A 1II8A 3KEMA 2QS9A 4QVKA 3K0BA 4JT2A 2QMOA 4TXNA 1DS6A 2JKZA 2BISA 4Y2QA 2H1SA 3SZOA 3W2GA 1PG0A 3RJ5A 4ZFNA 1R0XA 2Z95A 1M1NA 1R2QA 3DOCA 5AVOA 3PZBA 4YJGA 1MJFA 2R8EA 2OBLA 3KR0A 4RK6A 3U37A 2PY6A 1A5AB 2YS6A 3L9WA 5COAA 1T15A 5D3KA 1CW2B 1DKQA 1ZNZA 2VT7A 4Q3CA 5E0OA 1FTWA 2DCUA 5HOEA 2I7DA 3OF5A 1AC5A 4C4TA 4HRYA 4CMKA 3U9TA 4W5NA 1MT0A 2DY1A 2HU8A 3E9ZA 2BYTA 1MN6A 3GWGA 3LQYA 4TX1A 2AFIA 1XA3A 4L5BA 3HC7A 1BJRE 4P5DA 5HIKA 1Y8RA 3RPEA 1Q0UA 3BGIA 3D6HA 2ZUFA 2PZEA 4R2IA 3WXBA 2R6JA 2A58A 2A5LA 4ZYZA 5K6AC 1W2HA 4MKZA 5A6SA 5HKAA 1TCUA 1LEHA 1NV9A 3KZMA 3OICA 4PRYA 3SS8A 2PLNA 4G0UA 1RRKA 2QMQA 1BCRB 1PW5A 1NQXA 3D2AA 3HPQA 4RD2A 4UE6A 3RIHA 4OU4A 3ZYZA 2H17A 4EGJA 1NQ5A 1GPAA 3NVAA 1FX0B 3DAGA 2PS1A 4OP3A 5HYVA 5IS2A 2Z6QA 4B0PA 4AJKA 1KMIY 4KQCA 3R1IA 3OOJA 5KAPA 3U7GA 4CV2A 1O0BA 3U3RA 2VYCA 4A2QA 1Z38A 4JHLA 2EGGA 4GSKA 4L7VA 1X2EA 3OX4A 4GGMX 2H1WA 1R66A 4DNFA 1BU8A 2QJRA 2R66A 5BSVA 5LM3A 2ZJYA 1IJKA 2QUKA 3BFPA 2OGWA 2HNAA 1IWOA 1KYTA 1VHWA 2IYUA 3V8RA 3ZU5A 1K89A 3A9WA 1L4BA 1O94D 3EVNA 4MIKA 4RV4A 2UVDA 1OWPA 2ROQA 3I09A 1RAHA 1N75A 1OY1A 4EI8A 1ZD9A 5FLYA 1VGRA 2O20A 2Z2ZA 3LWDA 1N6HA 5EPUA 4C3VA 3U81A 1ITZA 2F43A 4NECA 4PPYA 3ZZ1A 5A06A 5FX2A 2W7TA 2FKAA 2ZVJA 4M7WA 5I7WA 4UCQA 1X7XA 1HE1C 1LBEA 1C9KA 1T3ZA 2AOWA 2B35A 3OX1A 4OM7A 4QBGB 4JVSB 1BCSB 1FUEA 2JFYA 2N1BA 2A14A 2YASA 3OEED 1YCGA 3PXUA 4FGUA 4GZMA 4ZQCB 4LF8B 3LX8A 2WUFA 1JPUA 1GSAA 3GG2A 4LDRA 3FM9A 1ZCFA 2ZB4A 1RQXA 3OG9A 4E2WA 4BEVA 1IUPA 5HIMA 4LI3X 2IBMA 1RZRD 1YZUA 2QY6A 1JE0A 4TMFA 4OK5A 3V3TA 2XRYA 4Z3DA 1DHRA 2AZTA 4G1MB 2EFJA 1XDDA 2WZDA 4HDKA 4QDJA 5EJEA 5IZ4A 3BYZA 4YHBA 5LQAA 2QGZA 4WFJA 1W8DA 2XWPA 4E13A 2JEYA 1BVHA 1YVRA 2FWRA 1CJKC 4BMCA 3AF4A 2RAVA 1YO6A 4YJHA 1JGTA 3IDFA 5TPWB 1USUA 2VH1A 3EJ6A 5J9FA 1KF0A 3SYTA 4G0VA 5E3HA 1LBIA 3TNLA 3EEOA 3BT7A 1HDGO 4X0EA 4TMWA 4M6WB 4CM4B 3D2LA 3UWMA 4HDSB 1A1SA 1VIDA 1X1SA 1M34E 1T1RA 4I55F 2VJMB 3IPXA 4HUQB 4KX3A 1QCYA 1O57A 4BFUA 3MJFA 1CJCA 3VVLA 4C4ZA 3KKPA 2VF8A 2QLTA 2XUQA 3FZQA 1AHHA 2H59A 1I0LA 4HY3A 4RVFA 3ZKAA 4BB6A 1M73E 2UUPA 1BG6A 4OQNA 2Y76A 3RBVA 1SZDA 3GLQA 5EIHA 3K8OE 1UOOA 1VKRA 4IQ0A 4XM1A 4LYYA 3PSHA 4AP6A 4MIEA 5EWJB 3CLUD 1MJGM 2NYVA 4RJLA 4RHYA 4WBNF 1EE1A 1EEXB 4QUEA 1G16A 3OWXA 4OX9B 3RTCA 1G6HA 3AOGA 5CEEA 5F9MA 4ZDKA 3P9QA 1C29B 1QR6A 4CL3A 1PQ4A 3OEYA 3TMKA 2RGYA 4J3NA 5TIIA 4M1TA 4NDNE 1F4LA 3MS7A 3OZIA 5FO1A 3UUGA 1JNYA 4KPGA 3B6MA 1D7AA 4FKZA 1W29A 1HURA 3WXMA 2MOKA 2ZROA 1HT1E 4TL9A 4AT1A 1AU9A 3BS4A 4Y98A 2ODNA 3K1YA 2IZ7A 5KVSA 2PMBA 4EEXA 4GR4A 4CV0A 2GZSA 2WRZA 3OJFA 4HDQB 1J6UA 1RU3A 4GMHA 4ZAZA 3WIOA 4B3GA 1OLOA 1U7UA 1TVCA 4V2UA 1PJ8A 2G1KA 2P30A 2D06A 4YYZA 1I2DA 5LXTB 5DNCA 4GR5A 2PMWB 2W2VA 2XB4A 3GA5A 5H68A 1DAGA 1IBMB 1GCOA 4QTTB 1X9IA 3SC2A 1UBLS 4MRRA 3VZRA 2WSMA 4F6RA 4MUHA 5GOTA 5BV7A 1Z0ZA 1PEKE 3ESBA 2G7MC 3RM3A 1NJGA 1FBTA 2HFJA 1EXMA 4GQAA 3BF7A 2AKAB 4JH0A 1O5IA 4NYJQ 1UAYA 5JVDA 2HREA 3EXHA 4FVTA 4G0XA 4KUGA 3KOMA 5JDIC 1C1DB 2EEZA 4ZXPA 4GVXA 2VJCA 1G4AE 1XMSA 2R1TB 2HU5A 1DHTA 3PUIA 4BU1A 3K2BA 5CEJA 1GT6A 3KT3A 4DPMA 1BQEA 1ZR2A 3TL3A 3ZQUA 2BLLA 2EFHB 2B1JA 3DP9A 4IBOA 4QUAA 3UKJA 3WMEA 2EJTA 1NUSA 1D1SA 1V95A 1NSYA 3ZZMA 4E1AA 3H7IA 5DNEA 2PQ6A 2KW5A 3N2ZB 3CRMA 1I0ZA 1CUWA 3HRIA 3C3WA 4YMLA 3HE3A 4CL0A 4TMZA 2BF4A 3SY8A 1EZ1A 1V9LA 4IUDS 1GV1A 1ZKMA 2DFKB 2HJWA 3MWGA 3PCXA 4NE9A 4DMGA 5CFQA 2FETA 2XMSA 3EBOA 3M4XA 5IHXA 1KMQA 4IL5A 2C9YA 1J8DA 4CDRA 1YS2X 2O3UA 1ICIA 2WTUA 2GVDC 1T5BA 2CLEB 5I7VA 4EUHA 4A16A 3SDBA 1UK8A 1HH4A 3EGWA 2HXGA 4HDMA 3LHFA 1JJBA 2Q4BA 2R8OA 4LYDA 4RQTA 1VPDA 1N92A 1V8ZA 2A94A 3SHTA 2GZAA 2PU7A 2XQIA 1IJEA 4WVFA 1YCFA 4KIUA 3TD6A 3GXBA 4BBPA 5CDSA 3VNVA 2QJOA 3GAAA 2JD1A 1Y0BA 2C9ZA 3G89A 1MH1A 3QENA 3BL5A 1EUCA 1SQFA 1XMOB 2OGZA 5HP4A 2DU8A 4L28A 3GZTB 5KYYB 1Z4PX 2QPAA 4FB5A 2AUNA 5A2QA 2YHUA 1OVGA 4EECA 1REQA 4QYWA 3BXOA 1VJTA 1CDEA 2G0TA 3LY7A 4J4TA 4XVCA 3DCNA 2CLMB 4GWGA 2GF2A 3U7IA 1WW8A 1CULC 1GOTA 4EF4A 1SUFA 4HPJB 3U0VA 1KEEB 4N0DA 4D80A 5FOQA 3UJ3X 5GOZA 4AN0A 1U3UA 2WAAA 4XASA 5J47A 5JYDA 4K9MA 4E46A 4JIGA 1NM5A 3G2NA 2C2HA 4G8JA 1UC8A 1TA4A 2PZLA 2X5NA 1ZL0A 1J20A 3EGCA 5JQGB 4C21A 4UDOA 2PLRA 2AN1A 3BD6A 2IV2X 3CJQA 4QTUB 3QLUA 4HAOA 4W7IA 3ZNOA 4IFEA 5ELMA 1GGJA 1UOEA 3ZD7A 4D46A 4KQIA 1N5RA 4R81A 4BB0A 3ZNQA 3UMYA 3OC0A 4E4YA 5DLQC 2GN8A 3NHYA 4JMPA 1GM5A 2QY9A 1N2XA 3L46A 3Q2IA 2V6GA 5H3LA 2G6TA 1CUXA 2GJAA 4UULA 5KJEA 3LPAA 5LCXA 4OGGA 5A2GA 1DAHA 3HNRA 1CJVC 4MQFB 1Y1PA 5FT9A 1O95A 1ZOLA 5HJ2A 3ZD8A 1SXJD 3JVDA 1XK6A 2J3DA 5IXSA 7MDHA 2QI9C 3FA2A 2OQ2A 3JWEA 5F7ZA 1VSBA 2EEPA 1BD3A 2WWVD 2IK8A 3AZOA 4OH1A 4WGGA 4EZIA 1C3XA 1KFJB 4KJXA 1ZOPA 5IJ9A 1IBSA 3R0XA 1IZZA 3L8GA 4EL0A 3JS5A 1WX1A 1X9HA 2GASA 3RVBA 1UEIA 421PA 5KOIA 2GTPA 3G0IA 3R5KA 1NMQA 4L8LA 1NZDA 1SELA 3UYKA 5JCOC 4N3NA 4ZVQA 4DA0A 2HMYB 1DDOA 2GR9A 4FE7A 2J9XB 4UNQA 5EE5B 3UQZA 1C0PA 4HWKA 1K3UB 1RWVA 1L3IA 2IXBA 4ETIA 2V0GA 1H3EA 4MI9A 4YFYA 2PUDA 3W4IA 5ENZA 1GCUA 2VHQA 4LE0A 1MABB 4EVSA 1KR5A 3NS7A 2QUHA 3C6QA 721PA 3VYSB 1IATA 3DLHA 2H00A 3DR5A 3IUJA 4AC9A 3RV3A 2BGUA 3PQCA 5D00A 1QDEA 4HDCA 4ZN6A 3F2IA 2XLCA 1L5VA 2D0PB 3EVZA 3A8TA 4RKFA 4F4DA 3GJXC 3WK7A 3MMNA 2C95A 3GH1A 2BIFA 1GKYA 2PUCA 3H2JA 1IXRC 4R40A 4DJJA 4LNUB 5BW8A 3LH5A 4OQZA 5DSXA 5JROA 4GXRA 4V0MA 3BFXA 1ZK2A 3O6VA 2OXTA 3AZQA 4CR6A 4JNKA 1FSGA 1WU8A 1CJMA 3CPHA 1TGYA 1VE6A 1ML3A 4M99A 2CUZA 3DD5A 4MZXA 4OOFA 2VS1A 3W77A 2DBQA 3SSOA 4AQDA 2DKFA 3CONA 1GGHA 1LDGA 3FSJX 2WICA 4HX2A 2RGWA 3U26A 1ZN9A 3L8CA 3RRFA 5B2FA 2RHGB 1ADYA 5U4QA 5KNCA 2AJLI 5A05A 3CKYA 4CUZA 3K31A 4OXYA 3LLSA 2GK6A 5CD1A 1PDVA 2GJKA 5KSYA 2VP0A 3NH6A 2ET6A 1QYVA 3BMCB 2OOSA 3PNMA 4XIIA 3LT0A 3M5PA 1J2RA 3IILA 1NN5A 1P18A 3VO8A 3SQDA 1QZ3A 4YQEA 4JVNA 3SEZA 4H6PA 3SQXA 1XVTA 2CVPA 3Q6MA 1H2WA 1I3NA 3CVYA 4KWTA 3V8EA 4J07A 4X7MA 4F4CA 3C8HA 3H8JA 4MQEA 4D4KA 4DWVA 1NVMB 4MUGA 2O8BB 1COWA 4BIIA 1AHNA 3N6XA 4D79A 2PZKA 4Z53A 4AKSA 1RYFA 4W8OA 1RJ9B 4C14A 4QC2A 1GKIA 3IVCA 2YWCA 3RYCA 1AKEA 2AD1A 5JFTA 3FUCA 1EK0A 2FR1A 4CZ2A 4B3BA 2ZI5A 3EBLA 3I83A 1MJNA 1K6MA 1NVWQ 4JQOA 3VPGA 3UFBA 2FSUA 2QDKA 3FN4A 3K09A 5DYNA 3FFXA 3ZTWA 3LVRE 4DLRA 3EDQA 4PX9A 2BMEA 3NTRA 5CT5A 2ZXFA 1IJFA 2W2KB 1Q14A 4B3JA 2Y1LA 2WKWA 3KKEA 4M37A 3H5VA 2G9QA 1ZVVA 2J46A 1FFGA 3KJFA 2HBQA 4ZAFA 4KR2A 2MINB 4YJFA 5JSKA 3VV3A 1F48A 4UHBA 1F51E 3JQBA 2ZCJA 5HUHA 4MB0A 5EZ5A 3L9XA 4CL2A 2QTBA 5E4TA 1TTTA 1E2EA 1XVVA 1N6NA 1GCGA 2WVGA 1HORA 4Q93A 1I14A 3L6BA 4DRXA 2LR0A 4MW6A 4BBAA 4TGLA 4F2HA 3HQ4O 2PX2A 3DB1A 4OI1A 3CEPB 4V24A 2NU7B 3JPWA 4QL3A 4B3FX 4ALKA 2ASEA 3DZDA 3PQ6A 1WPXA 1BXZA 3BORA 2XECA 5BN4A 2M1XA 1PR9A 2ZYWX 3EQZA 1UANA 3V8BA 1VCIA 1U8YA 2Q5QA 1EXDA 2GXUA 4IDOA 4ARVA 4HLDA 3B8EA 3ZJVA 2BFBA 1Q6YA 3A1FA 4RSGA 2L69A 2A9PA 3MWYW 4H3VA 5L6LB 3CLRD 1NL3A 4O0LA 5C34B 3LKZA 1YGPA 3T41A 3R7DA 1TLLA 2GPWA 1U1CA 3QVOA 4TKLA 2EC5A 3NI2A 3VBEA 3KU4A 1OPRA 1QGAA 3Q8XB 2IPOA 3DUWA 2PUAA 3SICE 2FRDC 1MXHA 1XP8A 3H3XA 3FPEA 3CSUA 1K27A 3NRCA 3QLTA 4H7FA 3CWCA 5EIBD 3C4JA 3ZWPA 5JI3E 1RI2A 1JHRA 1T8PA 3T5MA 2Z04A 3UJ8A 4LJ4A 3DV0A 4Q12A 1EWQA 3FSRA 4WQMA 2WF6A 3BQMB 2G77B 1QVRA 1PS8A 2XNDA 2IELA 3OTQA 5IAJA 5J1SB 2YOFA 3GQBA 5L8VA 2H5LA 4LWZA 4N0PA 1DQRA 2R1UA 2O8DA 1PTKA 3ER6A 2NSJA 3DE2X 3PIDA 2FDXA 2DX7A 2WYVA 3GLSA 3IESA 3II6X 5FTJA 4YPFA 2X2PA 1NVUQ 3NYQA 3HDYA 1GRRA 1B7GO 1LGYA 5TQ0B 3ANYB 3G1TA 4POAA 1DO2A 1RAGA 4Q6WA 5IWAB 1I9GA 3V1UA 3C8MA 5DBHX 2X23A 3R7FA 1C1XA 5ERXA 1LNQA 1M8JA 5J2UF 1YJCA 1KYIA 1IN7A 2V8BA 3VKHA 1CQPA 4GE0A 1BDMA 1CUCA 2C2XA 2MJLA 1Z5UA 4MVJA 3PNOA 1T5SA 4XD7D 1T2CA 3QXCA 4E6PA 3QLEA 3ZK9A 2WTBA 4JLOA 3DFKA 3ZVKA 1R10A 2YV2A 1LQTA 3BL8A 3W34A 5LPNA 5IKOA 2ZRAA 5KMGB 3EA4A 1O1YA 5GIOE 1CRLA 2P5YA 3VX4A 4CF3A 1NDQA 3QELB 1VPTA 3ADOA 1JYSA 2O54A 4OU5A 2XGOA 3KT8A 4BRSA 3B12A 1BHJA 2NSHA 1XNHA 1KXJA 1E9SA 1YH3A 3FMOB 3GUCA 2V7WA 3KBOA 4LC0A 4F3KA 1LVHA 4OV6B 4Q7EA 4FI3F 4YP0A 4YAEA 5BQFA 4QQRA 5FOWA 4URVR 2ACWA 2ECQA 3UT6A 1KYWA 4RA6A 1RI5A 5B7NA 5FTKA 4NK5A 4HVTA 5CXSA 2EP8A 2TS1A 4DF3A 1Q7CA 1GPLA 4JBHA 3DHWC 3BMNA 1SUEA 3ZU3A 2X22A 3FHJA 1PK9A 4FZ3A 3IEIA 1BH2A 2AGVA 5K4GA 3P2IA 4EPXA 2GJ8A 5DCWA 1E3SA 1PT6A 1SXQA 1QVWA 1GTG1 1XRPA 1FVFA 1IN8A 2YZNA 1LFDB 5E9AA 4PHCA 4DA8A 5LYJF 2O8FA 5F76A 1NQAO 3LUFA 3ESXA 4OLHA 1WXGA 2MMGA 4IHJF 3KDAA 4RXMA 2EV9A 3LU1A 1OFUX 4H0NA 4Z54A 3BQ9A 4GMKA 1JDTA 4F9EA 1RWXA 1CE8B 1XALA 1V4VA 3PXGA 4ZDIA 1AUOA 4BNFA 5IULC 1GITA 1K98A 1YZNA 1KZ7B 1XJ0A 4P32A 2RBKA 2ANCA 4DG8A 3A9RA 4TKVA 2WSIA 5CLLA 3JAKB 1E2QA 3DOEA 3KS9A 3KYJB 1XNRB 3COZA 1U31A 1JHZA 2EGHA 2QA5A 1N9GA 2YIDA 1Z6YA 3IMFA 3F9IA 4UNNA 2HGZA 5CIYA 1L4YA 3UFXA 4QA9A 3GMSA 1M76A 3AFMA 1KSFX 1LLFA 2IW1A 3G82C 3KAJA 4GX1A 5EZYA 2AW5A 3VH1A 3LBFA 1AB5A 1QV7A 3DE3X 2VN8A 4FFSA 5K0CA 2K4MA 2FPPA 2FU5C 5B36A 1CJTC 2HDHA 2OAGA 2NW6A 4EMSA 1N2CB 1Z4IA 2BM8A 3Q72A 1G8SA 1UMBA 1Q91A 1K5PA 4FFWA 2G04A 1K3TA 3HSYA 4ZODA 3N05A 5G53C 3ROEA 4DJDC 4YRNA 3TLBA 1X87A 1U0EA 3KLMX 5ARBA 5KB3A 2NUAA 4LFCB 1IY8A 3BPSA 4C0AC 3EH2A 4UXIA 1JB9A 5HFNA 3V8QA 5TPZD 1BXKA 3KXPA 4QELA 3KR9A 5TRTA 2FSPA 3I9FA 5DWDA 4YP7A 3E9RA 4YROA 2J9GA 4BWVA 1C7IA 5IAAA 3OFNA 1BMFD 2MWMA 2YFHA 5H70A 3R09A 4PXAA 4R0NA 4N0MA 2VH2A 1OTYA 3HKBA 5LZ8A 3UGTA 3IT0A 1NWHA 4WKCA 1IB0A 4OSEA 1FP7A 5KC8A 1JHQA 4X1YB 3BEDA 1ZCZA 3ND7A 4AKTA 2ID8A 3ML1A 1GWNA 5JSHA 1BQ3A 3DJYA 1SKAA 1U0JA 2NU6A 3BXFA 3HNOA 3PHCA 4G23A 1I30A 2W2LD 1W4RA 1TQ8A 2F8LA 3FYUC 1RPTA 4A8JB 4L4SA 2PNJA 3FTPA 1YDMA 4V0KA 1Z83A 1F6DA 5HF6A 1XTJA 4DVJA 5EJ6A 5JMWA 1X7ZB 1Y9JA 4JP8A 3HP1A 3W1EA 1EVZA 3VR2D 3GDWA 4FDUA 4PQRA 3LF2A 5KC9A 1I7QB 2WWRA 2XB6A 4ASUD 1T5LA 4MW2A 4N9QA 1WCXA 4A7PA 2BGNA 3A2LA 3MSXA 4KYVA 4WZAE 4Q9LA 4R9RA 5FD8A 3X3HA 4NJEB 2Y1DA 3N5KA 2XA1A 1V2GA 2P7HA 3DEZA 1RJDA 5CJJA 3RUHA 1DLIA 4ARBA 4F38A 4B6GA 2Q2NA 4RV9A 4EHDA 3MMPA 1Q7BA 1Q1NA 1ZI8A 1J56A 1VPVA 1KQPA 2WFMA 4BNJA 5BV0A 2XYRA 1IYZA 3DSRA 4JLSA 4J90A 4JYCA 5KJ1A 4CMIA 1NM5C 1A77A 1U3WA 1W4BA 3VJMA 1PAUA 1R4MA 4KW7A 2IA5A 2OLJA 4M22A 4XXHA 2XCOA 4KWHA 3SQOA 2A0FA 3SOZA 1OH6A 3BWCA 4L0DA 4AS3A 4HC4A 3QLUC 4B47A 4G5YA 4H4DA 5B3JA 1T8UA 3CCFA 1FW6A 3B3QA 4YRAA 3IP5A 3J81A 4EF6A 1U2GC 3UUFA 4PG4A 4HNRA 2EFDB 4XUGB 4R3NA 3EY4A 2HD4A 4ND5A 3ZUPA 3SFZA 4BX2A 3O8DA 5LQNA 1U94A 4KXVA 4X6UA 2AWNA 5A6VA 1G21E 5B1YA 5K9ZA 4E2XA 4UUPA 3SKVA 4AZ0B 4Y2HA 2IU6A 3KT0A 3C4VA 1DC3A 1SPXA 3WGJA 4AQYB 1T8WA 3NBYC 4PC3A 5L3VA 1O95C 1WOYA 2OO3A 3HLYA 4QGHA 4DANA 3L2OB 1J7KA 1NQOA 2G08A 4W5JA 2P9BA 1GQOA 2VWHA 1EWTA 2WSSA 4WAUA 1FE8A 3MAAC 4BV3A 1H2RS 1SH7A 1ZA1A 4DN6A 4ZOLB 5MN4A 4K9PA 2W9XA 2VDJA 2O57A 3OZWA 4Q1AA 5KTKA 3I28A 1D7OA 2AXQA 2WK1A 4Q21A 1H2ZA 1A4XA 4Q1FA 4ZIRA 2OFWA 1IN1A 5CBPA 4D3SA 4TLBA 1E3QA 1B73A 1IUKA 1TQ6A 2OYRA 4E0BA 1EK5A 3BZWA 3C5HA 3PUZA 1A50B 3KLOA 1L5HA 3AM5A 5LZ7A 1Z3IX 1KI6B 4N0EA 1QH0A 1T1JA 1KPHA 1YD7A 4TV9A 4IAOA 4BLTA 5MGNA 1ZJ6A 2JIQA 4JI0B 1G5FA 1U9ZA 3A1TA 2F9LA 3VZSA 3IOEA 2B3TA 2R11A 3P94A 1UK7A 3AR9A 5E7IA 3ASZA 2AF3C 1Y5MA 5KREA 4MROA 1DT5A 5JZVA 3NDRA 3EMVA 3X1JA 1LWNA 2I7XA 2JATA 5BNWA 1FMFA 1XNGA 1SFRA 4AQ7A 2B7BA 3RT1A 4PSUA 3D4PA 5FL7A 1PVVA 3LDGA 2V7BA 2DWCA 2FP3A 1ADFA 2FMFA 3NOXA 1KO5A 2HPVA 1YNSA 4TQUS 3U40A 1P5RA 2AJBA 2Y99A 2EZ9A 3RLIA 3VNAA 1G18A 3W4JA 5ITZB 3LPLA 4WNYA 1OIXA 4YMGA 3A9VA 1QF6A 4PZCA 1WPQA 3TGLA 3KTOA 1GDHA 2I6QA 1C81A 5EFOA 2P1ZA 3DR3A 2YIJA 3Q9NA 5LA6B 3EPLA 1KSGA 1KI8A 3LUJA 1K9SA 3U13A 4R51A 1FFXB 3E3MA 4U6NA 1UJ5A 1SHTX 3OU2A 3O5AA 2YJZA 4FDVA 4NOLA 2K2QB 4C5AA 4KMMA 1IH8A 2V6JA 1U9CA 4AM8A 1PK7A 4AUMA 2QRGA 4AX4A 2PBFA 4PYNA 3CUEF 2WF9A 4HNAB 4KO8A 2HTFA 4PX2A 4MA5A 4DLXA 2XR1A 3OCZA 5AO9A 5FORA 2HWWA 3E18A 4P98A 3IAEA 3AOEC 2VYNA 4B33A 4YJ2F 1CS0A 2RCYA 2BFCB 4O4HA 4X1KA 4QDTA 5HE8A 2QNBA 1I1OA 5TLSA 2CLOB 2OSVA 5EEGA 5AVVA 3EEBA 4D02A 4PS0A 3UB4A 1XDGA 3ZWXA 1HY3A 1QIFA 1NBHA 2Q07A 4XE5A 1OMOA 1W4LA 1YS4A 2P65A 4QQNA 1IBKB 1SVIA 5FWXB 1YONA 3BH7A 1FZTA 1F17A 1IBRA 3SS7X 5JSUA 1WF6A 2EBHX 3MT8A 4HR7A 3H86A 4YV0A 3LFHA 4OXRA 1DJQA 1PBTA 4UPDA 5KTOA 4YUYA 3OJEA 3E2MA 2XCIA 3MCZA 2W00A 1KSHA 4KQ1A 2EGUA 4LXTA 3VYTB 5IVKA 4DTCA 5KQLA 3N39C 1CRPA 1X13A 2NO1A 1PT7A 4FGZA 1M5UA 2QP4A 3RU9A 1IQUA 2DSTA 3HVJA 4FR0A 5KQSA 4IV5A 3TW8A 1NJ1A 4AURA 5B7GA 2P2SA 2W90A 4II2A 4R8SA 1GILA 1VP9A 1T29A 3NTVA 2MIIA 5D5PA 3PUVA 2IPXA 1YK0A 1WLSA 3K09C 4G5QA 1EP2B 5JAMA 3PEUA 4MR7A 2VF4X 5L3ZA 1XQ1A 2JLRA 4RLQA 1RXUA 4J91A 1B8PA 2NGRA 4S0ZA 5JH7A 2VTBB 3WWZA 1KZ4A 2ZTVA 2H2DA 4KOAA 3L84A 4MS3A 5DXAA 1NUPA 3CJTA 1WMSA 3RKUA 2HZ7A 3JQBC 3RO7A 3NP7A 5SZKB 3ACBA 3RS7A 3H2GA 2GSWA 2I55A 1Q0ZA 3O8RA 4FD3A 1OW3B 1YJQA 1TC1A 3K35A 4DCTA 4HDRA 4I4CA 4LA4A 2ECFA 3B3JA 2BMWA 4GR9A 3KD2A 4NLLA 3P32A 4ZVLA 1CX9B 4TVKA 4PG7A 1A72A 4J4HA 1S0UA 2PGXA 5I4KA 4DR7B 2SHKA 1QGUB 2D3WA 3DMGA 1R9JA 3DTVD 3LWBA 4QPJC 2H4XA 2YNMA 1E7RA 3TQIA 1TTPB 1JEQA 3BWYA 3DXFA 1NMSA 1FTNA 3OMLA 4M98A 1PWYE 3A06A 3P2MA 1QAQA 3NDPA 1N5DA 1TXGA 2ZM5A 1SHUX 4UARA 4YBZA 4M1ZA 2RB4A 2VBFA 1CP3A 3LCVB 4II7A 2FGJA 3FVTA 3FHLA 1IZ0A 4HDNA 5DGTA 4CM1A 3AP3A 4GSLA 3KALA 2GVNA 1CUYA 4TTRA 4AECA 3SZGA 1AGRA 2C5SA 4Q6BA 4B43A 4R1UA 5G2OA 3K9GA 1Z26A 1Z75A 5CA1A 3P4UA 2FA9A 1W4ZA 1HFJA 2XCLA 3R3YA 1H0HA 1YAHA 2ZPTX 3C4QA 3HJHA 4EI9A 2XX3A 2NM0A 1I6KA 4RGQA 4K6CA 1Q5PA 4FOSA 4AY4A 4NENB 2WINI 1NE7A 1CDDA 2PMEA 2C7RA 2POQX 3IJEB 2Q5HA 4CPDA 2C9BA 3SDSA 3STYA 3GVCA 3SFTA 4WE3A 5KNBD 4BZPA 3UB3A 4R2KA 3LUDA 2E4AA 1SCAA 3FVQA 3HA7A 2PK3A 1EUQA 2EJBA 1KH2A 5FPTA 3NHZA 3RGWS 4PGAA 3QOYA 4W9NC 4HNSA 4XPIB 3L4KA 2GBLA 4EARA 5E1OA 5FIUA 2GRAA 4WESB 1XL0A 1DZ3A 3AIOA 3I01A 3O0TA 1WDMA 1O8CA 5CMLA 4G8DA 3V4LA 4JOQA 3KNZA 4NYMQ 4G1FA 2GILA 1DKOA 1BSVA 1JG2A 3QU9A 4ZRMA 3E5HA 5F1KA 1E0SA 2CEKA 1BW9B 3JYOA 3WLQA 3HKEB 1ZIDA 1E3JA 4E30A 2BMVA 3K6JA 3QX7A 4OOEA 3E9CA 3WO1A 1F2VA 5TQJA 1CRWG 2B3DA 3W78A 4GI1A 5JAIA 3CF0A 3EG5A 3WX0A 1B93A 2H2WA 4ARZA 4LJKA 3MWJA 2VK2A 3DWFA 2Q2WA 3M4JA 4DYVA 4Z1MA 3ZWNA 1V41E 4O4LB 3I6YA 3NBQA 1X3LA 3PV0A 1ONBA 2AOXA 4MEAA 4NBUA 1KVSA 4ZAYA 1NR5A 3N2LA 3RABA 1GYPA 3RWMB 5IBCA 1AQ6A 1CUFA 2C5FA 1JG6A 2QU8A 3JTMA 3QBVA 2DM6A 2BEVB 3C7TA 3K9BA 4PGMA 3ZE9A 3BGVA 3OA0A 1LVGA 1JR3D 5EE3A 1NF8A 2D2EA 2Y0DA 3V80A 1W48A 2XTNA 1POXA 2I33A 3I34X 3JAWB 3MPOA 4LBZA 1JQJC 4UVEA 5T41A 3TQSA 1C5KA 1TMOA 3GRVA 2XEXA 3LW8A 5C5CA 3GLHB 4PBSA 2ZIXA 2P2GA 2K6GA 3LCMA 4GYKA 4RZUA 2ODTX 2X58A 3TEJA 3BFJA 1KDYA 4OFXA 1L0BA 5BRNA 1Y3HA 4LHSA 2GAAA 1PDWA 1MQSA 3BCHA 3GHYA 3HCWA 4I6EA 2UAGA 4AU1A 2SKEA 4R4JA 2BFFA 4BGVA 2JK0A 2X0NA 3ST7A 5FBWB 1UH5A 1JRLA 5IT9A 1PJAA 2IHNA 3WK5A 4ZVVA 1C9NA 1CEQA 2XB9A 1P5FA 5FPSA 4G85A 4U2BA 1NG9A 1O54A 4ZZ0A 2JFXA 1Z29A 4LXGA 2YZKA 4WY2A 4CL8A 3KDSE 1ODJA 1H5NA 1Y3DE 3H1TA 3NORA 4TUYB 2QK4A 1RLOA 4TZTA 3TLJA 3ILSA 3KZKA 2GD6A 3G8CA 3LF1A 5JWHA 4MPPA 5TDHA 3WNQA 4NPAA 2CNBA 3CH5A 4QIHA 4ADSG 2O6LA 3K0AB 1QIEA 3FWHA 3I6MA 4DAOA 4F5WA 2ZJOA 1P4GA 2V7UA 4UQOA 3QE0A 4NAUA 3HXKA 1MTOA 3C5WP 1FS4A 4URZR 1VKJA 1ZKDA 2IV7A 2ZYHA 2BFEA 1NU6A 1ZRMA 3EPPA 3HA5A 2AEEA 1FTQA 3ONNA 3R23A 4FYHA 3PC6A 1RYZA 3MOSA 3OKFA 2ZANA 4HUJA 3PUKA 1AN0A 1XQWA 1KNQA 4CCYA 3JD2A 2D0DA 2NNLD 3GMIA 5HDQA 5DYTA 4AS1A 1K4KA 4N48A 2ZE8A 4HAXA 2WUWE 1UC9A 4F9FA 1PF7E 3ONWA 5JYBA 5D3ZA 2GM3A 3PRKE 3FGZA 4PFSA 1E9CA 1ZM2A 3OH8A 1K7XB 3CUVA 3O92A 1XTSA 3H65A 4N6GA 1WA5A 1H3NA 2C98A 4MS1A 1F3LA 4LBVA 5LLSA 1E3TA 1TADA 1FSPA 2O07A 2PA0A 2Z1NA 3KV1A 1MZPA 2REOA 3GFGA 4RIEA 2YWRA 3E3AA 2G6BA 4C4YA 2OV6A 2D59A 2NXNA 1U4OA 2VWPA 2NQ2C 2Q8NA 3IPLA 3UUWA 1N57A 1XLTA 4B4VA 1D1TA 3P9PA 1SMKA 2CXQA 3ZNPA 1XYGA 4MGIR 4MCHA 4I0WB 3FCCA 4X9XA 4BFCA 2BFAA 4JLAA 4HHEA 4HWOA 1L4LA 1HA3A 2EARA 1Y82A 3W5HA 2G9NA 4YV1A 1T4CA 3AV3A 3F1KA 4RPIA 4B8WA 1WXFA 2QR5A 5HJ7A 1W5BA 1BGVA 4Z4IA 3OJXA 4ZK2A 3T9CA 2CLKB 1DCTA 2QUAA 1NBAA 1V16A 2JANA 2FZ4A 2B83A 4WI1A 3L4EA 2XTMA 4ZVNA 4B45A 5FTMA 3S2IA 2O8EA 3L6UA 2EWWA 4Q03A 1H66A 4RUKA 3A37A 2HFKA 4BUZA 3ZLTA 3OCJA 4NBLA 4OQXA 1HGXA 3L8HA 4B48A 4FEGA 5CX4A 1RVV1 1EA5A 1HYHA 2OK8A 3PL1A 4TSKA 2F4VB 3RYIA 1JJAA 5CFNA 2AJTA 1R5JA 1AUQA 2QSYA 3ZIUA 1NW9B 3W0LB 3LGAA 4O59O 2XUOA 1VRVA 1ENYA 4HNQA 3RQSA 4TYNA 3IV9A 3U49A 1TKRA 4U2KA 4DC9A 3FSGD 3NVMB 4OB6A 5JAOA 4ZDJA 1UPBA 2HLDA 2RHLA 2GPNA 1QAMA 4X20A 1EYZA 1Z15A 1AO3A 3A1CA 3SJCA 5AR1A 4HH0A 3M9LA 5A7GA 5B3JC 1KA9H 5KNDD 3WLPA 1F9AA 1YR3A 2GESA 2O8CA 5CT4A 4EENA 4CEIA 1II8B 5BSRA 2ORED 4D9EA 3HXQA 2R5NA 1NRXA 4ILEA 4UM5A 5F64A 2PJUA 1CY4A 1BWQA 3KK0A 3M6FA 3MB5A 1I4TD 2OD9A 3B1XA 4FDTA 2D1QA 2OM2A 3ELYA 3TTTA 1WRBA 4YJGB 2GEKA 4CDNA 4D3FA 1X86B 4GVPA 4H59A 3RKSA 2WG0A 2J3MA 3OLXA 5DM2A 2ZKLA 1B8NA 1ENPA 1XEXA 1ESMA 1HLGA 1Q1GA 4FFDA 5ELLA 2C7PA 4OGWA 4K03A 4MMXB 1O4WA 1GT91 2HU7A 4LQLA 3OJ0A 3RSHA 3NTXA 3Q0IA 4DFDA 2GHIA 2CV2A 2FJ0A 1T5IA 2AFIB 4B3SB 4WN9A 4JYAB 5I01A 1F60A 1PW7A 1Y8RB 1W36D 2RHHA 3GP5A 3ZV4A 2ZUWA 3H16A 1CY6A 2IIQA 1V35A 2WF7A 3GP3A 3N8IA 5A6SB 2NU9A 2QVLA 2GN4A 4L5JA 2NPOA 1FNNA 2WC1A 3TI7A 5ERGB 3GJ5A 3PC4A 2QAIA 4N5IX 3SXPA 3VJLA 2JLWA 2PZ8A 1D4FA 4NYIQ 5JBQA 1LDYA 5KJFA 4MARA 2DPXA 4ENPA 2O7RA 1YZHA 1PLKA 1N5MA 1Q7GA 2L2QA 2VP5A 2Y1CA 1L7MA 1SOUA 3AKEA 3JU3A 3J7TA 3S81A 3BTUA 4IWYA 1TC2A 2AMFA 2IX9A 5CVCA 2A92A 2V1XA 2YL2A 3UQYS 1Y42X 3W5CA 1KJIA 1IIRA 1KFCB 4RMNA 4ZOEA 4UMDA 5AOBA 2CHVA 2FZGA 1C7RA 1I4DD 3PVSA 5CX1A 3ZWMA 3LGSA 2IOQA 2EZTA 1DUIA 4V0QA 1SHKA 1NA5A 4L4UA 3ZBUA 4BUJA 5DI9A 1G1AA 2QQFA 4HXYA 3AVQA 4RAQA 3IXLA 2KX7A 1XLVA 3E7WA 4EHIA 2IUTA 5EJ7A 1E9DA 4L74A 5K45A 3ZCUA 4YAIA 2CJWA 3LBIA 1ADCA 1Z5WA 1GFWA 3OZGA 4X3OA 3WAGA 2F43B 1M54A 4P4UA 5CT8A 3CCCA 3UPUA 4DEYA 3PJFA 5IK2D 1X7XB 4NE7A 3R7WA 2CMHA 4JQCA 2HH9A 2QLBA 3GPBA 4I2VA 4RDCA 3ESZA 4PZLA 1D09A 4QBTA 2DECA 1KE1A 1WQ4A 3OEEA 4MUAA 1U0TA 4GOND 4UDNA 4PICA 2DERA 3G17A 4KR9A 5C51B 2A59A 1MORA 2EXXA 3D0RA 4R2XA 1L7AA 3WHIA 2BWJA 5LB4A 1UMDA 3BE4A 3LRPA 3ZBPA 1SKYB 3DB2A 4IIHA 1B1CA 2BI8A 3FY4A 1JHAA 2RJOA 2VRNA 3GGPA 3V4ZA 3V2IA 4HNHA 3F6YA 2AN5A 1Y7LA 1GL7A 1GQFA 1X70A 2IL1A 4G0YA 1DKNA 4G37A 4HDKB 4U63A 5CTJA 3ZCVA 2Q99A 4GKKB 2VZ0A 2GCNA 2IZ5A 3PXDA 1ECGA 3ESAA 2VHVA 2WAMA 3RT7A 1JHOA 1ACMA 4RQUA 3A04A 4DHWA 4DJAA 2VNJA 4EB8A 2GBGA 3C5VA 4U7GA 2WIDA 1V7ZA 3DBRA 4YJHB 2PT9A 1D8AA 3GJ8A 3JQ6A 2NACA 4RK4A 2UUAB 1C1HA 2G7ZA 3NKLA 3WVNA 4ABTA 3DVAA 3Q10A 3QK7A 1AKWA 4HQ6A 4KXYA 3G2PA 3TPZA 3X2SA 5F7XA 3LUCA 5HZKA 3BJZA 2GAJA 3L79A 4FLFA 4DQLA 5PNTA 1BFKA 2IUUA 1GSIA 5KX5B 4MYUA 4BO5A 2NTNA 4Q7LA 3X2EA 3TB4A 4EMTA 3F8TA 2FV8A 2P9QA 5IC4A 4NS1A 2HC9A 1NQUA 3MT0A 3OKCA 2JRLA 2QL6A 3H1FA 5FJIA 4MHOA 4MKFA 3SQNA 2VXBA 1V5WA 5C2JB 4KAAA 3DE6X 1TJPB 1NQWA 1UMCA 3H7AA 5EMJA 3S7TA 1MENA 3DOFA 4YGYA 1DDGA 4CQLA 4HEHA 4ZGBA 5JVDF 3G1UA 5SZIA 1A2OA 2R6AA 3RRNA 2Z57A 2J30A 2QOEA 2RK4A 1YV9A 3K96A 4HB4A 1AK2A 3QVSA 5DGXA 3PQ4A 2ESRA 3QFFA 5I45A 3N2KA 5AM5A 5CT6A 5IABA 4OHOA 1H2AS 4EG4A 4EM6A 5BR8B 1QANA 2OG2A 2XSZD 5A62A 4MRVA 3PDUA 5C1IA 1K6JA 2ES4A 2YNMC 2OBXA 4J94A 4PEVA 4OLJA 3PX3A 3ZI7A 3L8FA 5HHTA 1XQ6A 3C7CB 4IO1A 1ND5A 3SC2B 1JIIA 1P2SA 3L1KA 2HPAA 4E31A 4UD2A 4F6RB 2G0NA 3S2EA 4BN4A 1MFPA 3RS8A 1Z0JA 5AW2A 1BKSB 3T4UA 2MU1A 3E9QA 3HCRA 1QG4A 5JVDB 2AFRA 3UEOA 1SUBA 1XPOA 3EXHB 3NPMA 4RABA 1EHIA 4DDHA 1RJEA 3A0RB 1MLDA 4GX5A 5JQGF 1GDTA 1N7JA 5EE9A 4RVUA 1M1ZA 4P58A 1X1AA 3O4JA 2ECPA 1OBCA 5AQ1A 1M6HA 3EZ6A 5B7QA 3CUKA 4D99A 1QJ4A 1QWOA 1G63A 2QN8A 3BHJA 4RJ2A 2JRCA 3FLMA 4A36A 1XD8A 4DLUA 4BNLA 3RF7A 2CLCX 3QE3A 5MHTA 2JW5A 1H1LA 1L9KA 4MLPA 4GZ6A 4B1FA 4OQFA 6ADHA 4BFVA 2GBLC 5F4ZA 4WADA 4Z51A 2R6GA 2I2XB 5F4BA 3E61A 4CIXA 4LDAA 2GLXA 4ODIA 4AJEA 2FW0A 1DX6A 4BE9A 2I78A 1DOZA 4R1OA 1V45E 1RP1A 1O5OA 4B9AA 4HDMB 5KNBH 2E4UA 2ZVQX 1VSVA 3VO9A 4C05A 4CMAA 3OQ6A 4PQYA 4UUBA 2JJ8A 2P3LA 1GPDG 1EWRA 1U7OA 1Z2CA 4NG5A 1JDZA 4P3OA 3LC7O 4CUJA 3I30X 3P2YA 1JDVA 1H9AA 2PO7A 3QKUA 4RLSA 3V1TC 3HK2A 1GG8A 4J2HA 3AHIA 4RULA 1CR6A 1EUCB 1U7WA 1EUZA 4MDHA 3TBHA 1JHDA 4IGFA 3HBMA 2ZRMA 3AX6A 4PBTA 3I2HA 4HMQA 2QP9X 2J6IA 3ETHA 5DKFA 5AUNB 2C78A 2YYSA 5D6OA 4I1RA 1M72A 3NCTA 3SR3A 1YIOA 2FF5A 1CR4A 2C5EA 1CZRA 1FMLA 1X7WA 2E82A 1REQB 3OLWA 4FPXA 4JY7A 4MVJG 2H31A 1WEHA 2NWQA 3P97A 4UEQA 5ALWA 2CYAA 3P9RA 3Q6IA 3VU3A 4NV3A 2Z3VA 521PA 3X1YA 5GVSA 1AN9A 1TU0A 5H0IA 5A02A 1A9XA 1K2WA 3IEPA 2R6HA 3W5AA 2Y66A 5J5VA 1TD9A 2QZJA 2XAUA 2C57A 3ICCA 3B85A 3GK3A 1BXRA 2XCUA 4KI0A 5AM0A 3THYA 1IXYA 1USKA 3KTFA 4PHGA 5T8KA 1T6XA 3B1KA 4QECA 4QZVA 4HNTA 4FIZA 2UU9B 1SG6A 2LV8A 4DCSA 1G8YA 1JW9B 2V3VA 1OAKA 4AKIA 1O87A 3DEKA 4JKIA 4BP9A 4GBED 1X8XA 4EYGA 2XCQA 3GW8A 3KJEA 5I5EA 2HUPA 3SEFA 4QUHA 2Z4TA 2XZTA 4ENUA 3FTCA 3P52A 1S9HA 2N3ZA 4JCOA 1OWOA 3JARA 4UM9B 4N5MA 2Q5IA 3ZW8A 1YJXA 4M0PA 5BOSA 3U1BA 1OGIA 3E35A 5JZMA 5HTOA 1W5SA 3AW9A 3DG9A 5AVRA 1W1UA 1JQLB 2N9UA 3O84A 2Q9UA 1RWNA 1L7XA 3D6NB 3HZZA 4HYQA 3U4GA 1QK5A 1K4MA 1XYYA 3D6VA 3IPRA 3PQ8A 4ENSA 1PQUA 4F3CA 3Q0TA 3KJZA 1DXYA 1X1BA 5CLGA 4D43A 2PUGA 2YWGA 3V34A 4C4OA 1JNXX 3TNJA 1R9NA 2NVOA 3FNFA 5IJ9B 4NRDA 3F98A 3DL7A 3G2OA 3N8KA 3Q5DA 2B34A 2W6JD 1I1HA 4JI4B 3GMDA 4EJSA 2O5CA 3U3KA 3BDIA 3DMNA 3L7LA 3OPQA 1NVGA 3N07A 1Z7WA 4IXWA 3W05A 2VJNA 4IIJA 2GNAA 4QBIA 1OBOA 1ZQ1A 1XMQB 3NHUA 4PYMA 4LJ5A 4MW4A 2KQUA 1NONA 4TKMA 3IRUA 4LXUA 3RVPA 4CM3A 4KH1A 2QV7A 2YQ4A 5ESWA 3FYSA 2Q27A 4KGXA 3T54A 1SQ6A 4WDQA 4CTKA 4UOZA 3K16A 3MTGA 4OP1A 3U5ZB 2CJPA 2HV9A 2JHFA 4B4DA 3VHQA 3ZCSA 4J7CA 1Y5IA 4BO3A 4F3YA 3C8ZA 5AKHA 2VA9A 5EUCA 4IILA 1Z5GA 3SWWA 3E05A 3GHHA 1U1DA 4OREX 4YT4A 1CUGA 4XSVA 4ES6A 5BYAA 4KDCA 1T9ZA 3DZCA 3KKOA 4O8CA 2PRKA 2XYGA 3G9UA 4EGCB 3TE7A 3TH5A 4BJ1A 3R0JA 1T8YA 1T26A 2AMYA 2XUZA 3EXEA 2HF8A 2VHXA 3I8XA 4JR2A 1Y1SA 4LSWA 5AH0A 3O7MA 5HKLA 4ZCRA 3DBOB 1YR2A 2XZLA 2W8ZA 4LUCA 5IYZA 1A5TA 2HEIA 4LRWA 4IV8A 4I46A 2G80A 5FADA 5GAJA 1KJZA 4GDMA 4JMLA 3LT1A 2IS2A 4INJA 3ILXA 2AZDA 4Z7JA 1N2EA 1XRMA 3LVFO 4Z3KA 2IUYA 5CGZA 2P6MA 5DYGA 2W2PA 4MPRA 4JLKA 2VEDA 5EUMA 2VT6A 4RWEA 1T25A 4LZLA 4D4IA 3EZ2A 4DB4A 4C0WA 4RVSA 5BWLA 3PICA 1Q1ZA 4OIFA 4E14A 1ECCA 2PS9A 1IHYA 4S1PA 3F4KA 4U7TB 1K8ZB 2WT9A 4B3DA 4B80A 4CM9D 3D2CA 3C0KA 5B37A 3LC1O 1S2LA 3L1VA 2QD2A 3V7FA 4DILA 1HYQA 4OXQA 2OENG 2VDQB 3H1PA 3OBBA 4MQEB 5HZGA 5HMMA 2PH3A 5LZ9A 1CCWA 3EWIA 4B4OA 5J4YA 2DBRA 5JV5A 2WWTA 2BPOA 4CXMA 2X0RA 2PXAA 1ISGA 1SBQA 1I0IA 5IBPA 3QE9Y 2BBSA 3RYCB 1EVJA 1PZMA 1UDCA 1W44A 4YIHA 1YL5A 4A2CA 4QG3A 2DUUA 1L5SA 2HUNA 3VU8A 3LOUA 4CBVA 3D1VA 4COOA 4CFSA 4YCAA 2BFDA 5KNDH 1ECFA 3H83A 3W2IA 4C78A 5HRUA 3OCYA 2VAWA 4L78A 2E3JA 1JHVA 4R2LA 3HXMA 3F5SA 2QTHA 1CV2A 1PTJA 1TTQB 2BEUA 4YJFB 4D97A 3TG8A 3IIIA 4XYBA 1T0JB 1WD7A 1PI3A 5ESDA 3V4SA 1JH9A 1NW3A 4WASA 1R4ZA 2ZSBA 2Y8EA 3HY4A 3K9WA 1QIHA 3COWA 3DGEC 4JI5B 1OH8A 1QQBA 5DSZA 1OYYA 4HX5A 3WNDA 4DRXB 5LL6P 2B8TA 3BTVA 4O4JF 5DN9A 2FRXA 1N0WA 1VIYA 1WMAA 2QRVB 4D6PA 2D6FA 2GVZC 1A9TA 1V9SA 3DP7A 2BKXA 1QE0A 3QTBA 3D3JA 1JMKC 5BN4B 5IH7A 2EW1A 2HRZA 3WWEA 3OKPA 1NF9A 2WM8A 3K92A 3QPVA 3TBKA 4WBSA 5JO9A 4EY3A 2XIQA 4ONEA 1TW3A 1AH2A 4OBBA 3PEFA 1VLVA 1Z7GA 4NPHA 3S2SA 1ZINA 4K3UA 2OR3A 2BFBB 2PGIA 4C43A 1NASA 1FB5A 3CH4B 4J0GA 4UBLA 1DBWA 4B83A 1UJ4A 2RC6A 3JQ8A 4O2AA 4LF4B 2AN9A 1JQAA 4C3UA 4D5EA 1GLVA 4EPWA 4K40A 2ZBDA 1QH1A 3R0VA 4PSDA 2O4UX 1WBJB 3WJ2A 4M1EA 5CB6A 1CJUC 1EAMA 2E87A 2V4MA 4U7PB 3SQMA 1PZXA 2QRJA 4TLAA 2WU0A 2YDXA 5KHAA 2NQ8A 3DV0B 5WRFA 1OJ7A 1NR1A 5G41A 3P19A 4BNXA 1Z8NA 4C7BA 1P1IA 4HWTA 5DHFA 2HIMA 3GQBB 3FVWA 2O8DB 1QNFA 2C4MA 3GBVA 5DGHA 2DZDA 2GXQA 2YZ2A 3GCZA 3HWSA 1BMDA 1O77A 1PR1A 1PHRA 3ITEA 4HYEA 4YK7A 3EZGA 4DBZA 2X42A 5JCZA 3M33A 1R15A 3OOWA 2X6TA 4UVHA 5H7XA 8ATCA 4ZCTA 3FCAA 1Z0IA 1GUDA 2G40A 1E96A 5GP1A 4X64B 4BMVA 3EF0A 3T4EA 4HBGA 3KJHA 2Z8ZA 1C1XB 4IRUB 2FEOA 1X1QA 5DNDA 1IULA 3H0EA 4XYGA 2RGNA 1WW2A 4RMIA 4MGEA 1SN7A 1W7AA 5ALVA 1OH5A 2MHCA 3P2JA 3ANNA 4XD7A 5K4AA 1A9OA 1H5QA 1TECE 2JLQA 4M38A 2OD2A 1OX4A 1YFLA 3GFRA 4O1MA 3EW7A 4ZYTA 3EC1A 3FJ1A 3WNVA 3VZQA 1MAVA 1RXVA 3K70B 4ZCPA 4ALIA 2XMZA 1KGSA 3AUTA 1I3OA 4HB0A 3DFUA 4Q7MB 4AO6A 3ZDAA 3U3XA 3Q8KA 1KJQA 3AI2A 4PLYA 1KBZA 2ONCA 4NDZA 4H18A 4RA6B 4TT3D 2EBWA 1DBQA 4WZZA 5HRCA 3HDJA 3K72B 3MTAA 1ZD4A 1JB1A 1GZHB 5JNRA 2IXGA 1KH1A 3BWBA 2OXIA 5DISB 5DRYA 1FTGA 3WO0A 1Z63A 3EXFA 3HYRA 3L7JA 1QH8A 4H1WA 3EWNA 3BMNB 2J0UA 2R6CA 1PN3A 4JYPA 1KRHA 1SNYA 2ZZNA 3ZLUA 2CHEA 2HJSA 1AQIA 2ZR0A 3ORHA 4Y0VA 2HMSA 4DVGA 3S1AA 4F4UA 4ZV4A 2K7FA 4ARIA 3FYHA 1U8AA 4QBHA 7MHTA 1AXRA 1P72A 1V6AA 2C61A 2CMGA 2HLNA 2IY8A 3BHMA 4FGJA 4DLAA 2O8FB 5JAPA 3N86A 3S0JA 1Y4SA 4BFXA 1A9RA 2PGLA 4V3CA 5FPHA 1RHUA 1GPJA 1AV6A 2W58A 2I9PA 4RXUA 2A0XA 1CQZA 3FG9A 4UJ3A 3T3HA 1ZLYA 1I6WA 3CUWA 1TO1E 5CJPA 3WGHA 2PZBA 3ELDA 3BREA 3L4BC 4FN5A 1LW6E 4YUZA 3QOWA 1R00A 5IUJC 4TKVB 5IC6A 4CLEA 3ADBA 1UBCA 1ONOA 4L4YA 3UGJA 3VNBA 4DNOA 4QO8A 4MAAA 2FPKA 4MVJI 3DE1X 1DWQA 1KXZA 4I8IA 3FNQA 4ND3A 3NKVA 2FUCA 2BHSA 4FR2A 5CTAA 3TG2A 1P73A 1DG3A 1K0UA 2V0NA 3MT9A 3Q3JB 2H7XA 3HVIA 5GQSA 1G17A 1PL8A 1KEVA 2XUJA 3N2EA 5HCNA 3UFXB 3FBWA 3IBYA 2AKYA 2O2SA 4KXXA 5DYWA 5EZYB 2XE6A 2PRSA 2RB5A 4ZHQA 3UKDA 4C08A 2C9DA 2EWVA 3WRXA 1O2DA 2Q2VA 1YFZA 2FPPB 2G1UA 2WMYA 3KAPA 3L06A 4MEJA 3TTUA 2XBLA 1UPTA 2SNIE 2ZBVA 2AD5A 3M70A 3QBDA 5ARCA 5SY4A 2AHRA 4YT5A 3U3MA 1UMBB 2QLMA 1T0PA 2ZRHA 4N3CA 4YP1A 3NIWA 4BLPA 5I9LA 1T9HA 2W48A 5L51A 1NXXA 2J59A 3DLCA 4K9RA 2NUAB 3VYUB 2QLNA 3ZKWA 3QE2A 3TUIC 4YHHB 3BCUA 1KEUA 1P2BA 3VPBA 2QUIA 3HI4A 2BD0A 3PE6A 1ZRHA 4JCCA 3WLLA 2BVNA 5IM4F 2H6EA 1MC8A 4RGBA 1G5QA 1GRNA 5DJ5A 4RDIA 3H1EA 2XVYA 4WHMA 5K0NA 3L7KA 4RPCA 4LWQA 1C3LA 1JLLA 2CLFB 1RYDA 4HWSA 1BMFA 4D3YA 1N32B 1QO9A 2I4LA 3HKBB 4PN3A 2ZYSA 5E38A 5ECYA 4RPKA 2GCOA 2O7QA 4CMBA 1E6LA 3ZK7A 3DVRX 1IQRA 1RFLA 1RYMA 5TGDA 1QXSA 4KUEA 4EPYA 3O94A 5HPYB 2WJJA 3KAKA 1L1EA 4FR5A 5EIFA 4HH1A 2XUHA 4QM7A 3OWHA 1JHXA 2JGFA 2W2LA 4FSXA 3W9UA 1NP7A 4XWYA 2YBDA 5ALFA 2NUTA 4QU8A 3R5SA 3KQOA 3MMSA 3JWJA 2XMRA 2O7VA 2PFGA 3DNPA 2BMFA 3IURA 2QYTA 4KP7A 4O25A 1HV8A 1NUTA 1Z7YA 4AWXA 2WFLA 4GIBA 4LMAA 5IDXA 1Q0RA 2VRCD 2GYYA 1C0LA 1WMFA 2ODWA 3VR2A 4D96A 5CDYA 3KSZO 3V4PB 1FXWF 1L3BA 3I76A 3SZLA 4AG6A 3LY5A 1SCUA 4MMYB 4Y9SA 3S8EA 3SP1A 1J4AA 1J23A 3D4IA 3HABA 1CZUA 1K8YB 3IDQA 1P3DA 3LNCA 4JZYA 4BRZA 4CKXA 4CU2A 2B8EA 4ENWA 1IHDA 4BPRA 5I7FA 5IUNC 2C97A 3EEIA 3HVKA 1F8GA 1T13A 2DT5A 2O05A 4JBGA 4WK2B 1TAUA 1E2JA 1HDIA 4CMIB 4IQ4A 3K2QA 1R4MB 3PCTA 1I33A 4LDZA 3TZHA 1XDWA 2AFHA 3CZ5A 4Z4FA 1E6UA 1WVIA 2F64A 3QVUA 4CVNA 4MAMA 3ETNA 3IQFA 1JFRA 4IVRA 1GN8A 4D81A 1J25A 1QFSA 1Z2DA 2JI4A 4BATA 3MILA 1YXMA 2IYWA 3EQ9A 1EDOA 1ZONA 4PQEA 3IAS6 4QQFA 4C04A 1LDBA 2QRKA 4XVQA 5D6NA 4NVRA 3T9AA 3VSDA 3IP7A 4IGIA 4P81A 4PNZA 4BMDA 4YV7A 2WM3A 3EIXA 1L7OA 4CQMB 5KTSA 3I0NA 2RJ3A 3VPXA 3CX7A 2ZS9A 2HCJB 3D6TB 3LA6A 4ZQIA 5ILOA 4ETWA 5CXQA 2P6NA 3D6JA 3I0MA 3FFAA 1S2NA 2OPBA 2JHGA 3H8VA 4MV7A 4A0SA 2FN8A 2X6QA 4Y30A 4AMGA 3T1OA 2ZJZA 3AVOA 3NJRA 3C7KA 1ABFA 3WIVA 2F2TA 1AY0A 1E92A 2CVHA 1VOTA 5F52A 3ZHTA 2Q8PA 3BXXA 3VYWA 5C18A 4DB2A 5JEEA 2PCLA 2WQ6A 4KEAA 5A5VA 4EJSC 1N6RA 1AUVA 3RW9A 4FEEA 2IIPA 4HT3B 5HSGA 2W6ID 2ZWVA 3ES9A 3IYLW 1F0PA 1P2VA 2H51A 2I3GA 3A70A 5DH9A 1RYBA 5CBPB 5KYXA 5IPFA 4MSUA 2ZBFA 1PWHA 2J48A 4XWOA 1HTWA 1L5HB 4Z9YA 2CW5A 4EELA 4TV9B 1B8VA 1N1GA 1ZD2P 4QDZA 1ZSNA 1SVNA 1UT8A 4WFQA 1RC8A 3LW7A 2D5IA 4KQWA 1Z7BA 4KB5A 3VPDA 5HIAA 2BJHA 4ENTA 1P4AA 2OCYC 3S28A 4TWIA 1CZNA 3K3PA 4QU9A 1YB7A 5LR6A 5LOVA 1DC6A 3A4MA 5EJIA 2WD7A 4UQLA 1GPH1 1VL1A 5EJ4A 3ER9A 4WLVA 3G5MA 5JFOA 3B2NA 5IDQA 4RFLA 3U60B 2BY4A 1OFGA 3EE6A 4HLUA 2GCEA 3MFQA 2WNSA 3PB3A 1NMYA 1GCAA 2B21A 3BOSA 4J3FA 5IM5A 3BTSA 4N03A 1LU9A 3HJFA 5AW5A 4RD1A 1UAAA 3FMIA 2CDCA 3D5QA 2JGRA 3D3QA 3IAS1 3TRJA 2P3QA 4P3YA 5EUQB 1KYQA 3E1SA 2EW8A 4FYKA 5JS6A 2QN9A 1U8FO 2PD4A 3JTEA 4M76B 4CHTA 1DAEA 4MJ3A 3SIXA 5AVQA 2C5HA 4K46A 3DNFA 2QENA 4EGSA 2H4WA 4R1MA 2WSLA 5F77A 4ZYUA 5A3QA 1C4KA 1P17A 3HCAA 3QXHA 4IIXA 5BPHA 1H85A 2Q3HA 1WUKS 1CS0B 4O4HB 4X1KB 1MX3A 1TK2A 2FCRA 4MWDA 1RWPA 2ZIGA 4H7DA 3JV7A 3PT9A 4QOJA 2PD6A 4F2WA 4UHHA 5E95A 4D9BA 4E1VA 1AQJA 4TL6A 2NIPA 4Y6PA 3REGA 2P62A 3GCWA 3H05A 4Q1EA 5HUQA 3OZRA 3UA3A 1FYEA 1Q1AA 1XEFA 4W6ZA 2FMTA 1DZIA 5L45A 3IP1A 4BGIA 1KDZA 4WLNA 2Y9PB 2YVAA 2X1VA 3AUFA 2V3CC 3AY7A 2E6KA 3CN7A 3D7RA 5FWAA 1KZYC 1ZBDA 1U6JA 2NZWA 3EXIA 5JCJA 4EHNA 4JITA 3ROFA 3UPTA 3SJBA 3JQAA 1KFBB 1DNPA 2G28A 2OPHA 2FWAA 3HWWA 4TQAA 4UC0A 4YGXB 3BJIC 4GM1A 3FPHA 4Q9HA 4O63O 3TW8B 2CVQA 4AKHA 3ABIA 3X1KA 1KZ6A 1QE3A 1RMTA 2I6FA 4CMEA 5JPDA 1LBHA 2BONA 3R6LA 3DLTA 4PTZA 3SHQA 1PR3A 2WHQA 2ZBEA 4MR7B 3H2HA 5JXWA 1ZH8A 2I6XA 5JPCA 1G8MA 1P9WA 5CVDA 3KQUA 5F2KA 2OB2A 5JH7B 1MH9A 5LLDA 1MX5A 1T1SA 1SG9A 2Z4RA 1E69A 2ENWA 3A6FA 3DKVA 3F2VA 4FTWA 4MS3B 3B51X 3S7ZA 5C8ZA 3G3EA 3W3AD 4Z5XA 5E6RB 4LDNA 2V7XA 3R6TA 4ZXFA 4IDPA 1HFWA 2UYHA 4UTXA 1XCJA 2BRUA 2V7TA 3TX6A 4ENVA 2TMGA 1VLJA 4HDRB 4PTYA 5LDHA 1DADA 1E60A 5ELXA 2VLBA 4OLBA 1OIWA 2XUDA 4A10A 5A4KA 1AKVA 1DC7A 1RWOA 2VYQA 3KLPX 4FBGA 2R4UA 3FTNA 121PA 1CG6A 3HRKA 5E9JA 4KMOA 3UJHA 4KLAA 5HF8A 2R86A 1JIVA 4RELA 1U1IA 3KZ1E 5IH3A 2V9PA 1QPGA 1WUJS 5AXCA 1JN0A 3LCUA 4ZVUA 1M7GA 2RG1A 4MH0R 5BNFA 1D07A 3G2MA 3ZOKA 4A0FA 4D44A 2D5BA 5K51A 1H6AA 1PR0A 1Y48E 1J06A 1JEQB 2ZR9A 3QITA 4FX5A 4O4LF 4ESVA 4F8YA 3GYBA 4MX8A 3VVMA 4JSRA 3O9MA 5NULA 1IOLA 4A6DA 2DE0X 3WIBA 3NFYA 3GLGA 4NX2A 3JQ9A 2W2KA 3EARA 4N82A 3U7HB 2F1HA 1XXHA 2WIFA 2FTKE 4MJXA 4HDNB 3M3DA 4WBXC 1DBIA 3QV2A 4YRTA 4NFSA 3PUYA 1SVMA 4ZKEA 5D3QA 1VB3A 1E8NA 5AVKA 4CM6A 1S3FA 3IBCA 4R84A 2GYWA 5F1PA 4E2FA 3RUFA 2Z56A 1P6XA 4IY1A 5CA1B 1ZMRA 1CR0A 1ESZA 2H2FA 4I9NA 1IOVA 4UZEA 3I04M 1TZCA 3VU1A 1NI4A 4B09A 2UZ0A 5FA6A 1C7EA 2AWOA 2XUAA 4NMMA 2C2MA 2RH5A 4Q9NA 4AY5A 3E48A 4OGFA 2ONZA 3W6ZA 4I3HA 2ZM6B 4C5BA 3PYXA 1I2AA 1A5BB 1UWVA 4TPKA 2PYZA 3QI2A 1XCLA 3E27A 3W6PA 3BSYA 1W88A 5KNBA 1D6MA 4Q34A 3GGSA 3NIFB 1UFRA 1VMEA 1KY5A 1UZUA 2BMJA 4FZJA 4NU8X 5AJHA 3SKXA 3JQGA 3MGCA 4FYWA 1E9FA 3I4FA 4BQPA 5GM1A 3H3JA 3D8SA 4P0TA 1VSUA 4TUYF 5EXTA 4WRRA 3NC0C 5EIXA 1FVHA 4G56A 4I9FA 5CHYA 3UATA 1FXUA 3CG4A 4R31A 3ESRA 2RGNC 4DMRA 3GFSA 3GMTA 1E9EA 1EUDA 2QI9F 3N8GA 1XZQA 3VXKA 4PLTA 4CDMA 1TM2A 1Y34E 2RKBA 2W0SA 4NH0A 1I4EB 5HRAA 4TMYA 2R5FA 4TRRA 5KAMA 4P0QB 1MMFB 3WB2A 4EDFA 1G19A 1DIAA 5JMOA 3ZWAA 4PLFA 2E1RA 1PCXA 1N0UA 5FFFA 1HOTA 4HAYA 4L4XA 1PT5A 3LY8A 2F9FA 5T3YA 4NH4A 1IK4A 2W2NA 2R3SA 3H9UA 3R3JA 2JFHA 5K3SA 4FOTA 3E82A 4EPRA 1N7IA 2GM5A 2GA8A 3Q15C 3T15A 2EWMA 2HNKA 4ARZB 4OCZA 3TNFA 3NXKA 3AIKA 1JIUA 3S2ZA 4OP2A 4EA6A 2CD9A 1LK0A 4UCWA 4UU7A 3L40A 3D0KA 2Y71A 1UEJA 1N5LA 4NSNA 3B2QA 3NPAA 5UKDA 3ADCA 3OE4A 4MYRA 5HR5A 1G6OA 1L5OA 1R0BA 2C4KA 3JVIA 5JJCA 3D64A 1SQ0A 3KSBC 1PJTA 1X2BA 4F4JA 3ZXSA 1EM8A 3ROQA 1Z0AA 2QT0A 1JR3A 2QZSA 3LBYA 1FNMA 4KU4A 1OH7A 1EXWA 2E6UX 3CNLA 4Q9AA 5DNWA 3ZHUA 2HSGA 1TT7A 3BZUA 2XI4A 5FNVA 1ATZA 1U3DA 2X7HA 2ZIXB 1XZPA 2O3RA 1SIOA 3H2BA 1Z36A 2Y1EA 1I24A 1P7YA 2CDBA 2YRFA 1N8SA 1F6WA 3LV8A 1P2DA 1C9JA 3FYTA 4TTVA 1DIRA 4QDUA 2IHJA 5ALMA 5GGYA 3O8CA 3UC5A 2BFFB 2XA2A 1XZMA 2QN2A 3OFJA 2PVSA 2FFJA 3ITKA 4LF7B 4G1VA 4YLEA 5P21A 1PV4A 4D9MA 1HE4A 1ZUHA 3NRBA 3UXEA 4X54A 1U2DC 4KLZA 4M49A 5DN6A 2ZPUA 3D4BA 3WRWA 4EH1A 2E2WA 2EERA 3C5CA 3HCCA 1GNVA 2R62A 2IYLD 3MERA 4MGYR 1NBMD 1VJGA 3AMVA 5DMXA 3SR0A 3L8DA 2E4YA 1BWPA 3WRXC 1ORRA 1OFVA 3NHSA 4G26A 3TIXB 2X1MA 3ZVLA 1KEPA 1RLJA 2O2JA 5D3MA 2BFEB 2RHMA 4BJ3A 1YKSA 2NTYC 2QF7A 3PLNA 1GZUA 5CYGA 1Q74A 1ZK4A 2VHWA 3O4RA 5DGCA 3UCFA 3OIFA 1YBFA 3LXMA 1D03A 4UFOA 3ZWVA 3TR0A 4CCYB 1TYDE 1UJBA 1FIUA 5JY1A 1YQDA 2RIPA 5ALTA 3NYWA 2YINC 4JB3A 1YBHA 1WUHS 3MGAA 3IODA 2XUPA 2JAPA 2R2AA 3MC1A 4FW9A 4YCSA 2HXYA 3P9ZA 2Q5CA 4CIBA 3NUQA 4CKWA 2NU8A 1YCDA 2W43A 1ZGCA 3KPYA 2ZTSA 3MXTA 4MS1B 3SK0A 3F7NA 3ZE8A 4CT0A 2IEDA 3DBHA 3KPWA 3IIKA 2BMAA 3B1ZA 3U0BA 2PIDA 1JR6A 3M6AA 3P27A 2PSHA 3H4VA 2FLKA 1SUIA 1UBMS 3K9NA 3V6LA 4R8RA 1YZVA 1Z5NA 1LS6A 3IOMA 5A0FA 3M6MD 3AVYA 1E61A 2PX6A 1PFGA 4L9WA 1O97D 5FI1B 1H0RA 1Y6RA 5L40A 3WMRA 1QTNA 1NNLA 4IW3B 5ER9A 3DYVA 4GOOD 5FOSA 2QXTA 4BLOA 4MUIA 1CF4A 1T4CB 4W6QA 1FA9A 4A23A 2V7GA 3GZNA 5GJWC 4BKOA 4RCVA 2QORA 4IINA 2YWFA 5EN4A 2H08A 5K2OA 1G8JA 1V16B 3B6EA 4IDEA 5C32A 2XLBA 1JYFA 2O8EB 3PGLA 5C53B 4PQFA 4N01A 3SR4A 5L53A 4LDJA 3R9WA 2V8OA 1GQYA 3UB2A 1J5EB 4EZEA 3WWDA 2ZR7A 3HBLA 2Y27A 1KORA 1J0BA 1E5XA 3OOYA 3KQLA 1JH8A 1E4EA 2R8PA 3RYIB 2QVYX 4WECA 4C29A 1WLYA 2GUGA 1DXHA 2H85A 2X13A 4X91A 3RSCA 3TTYA 3WGGA 1NKSA 2GCPA 4F9GA 4CEJA 3AUKA 1QRAA 3E7DA 2D5CA 1K7SN 1K7CA 1NC1A 2H06A 2Q0QA 3IC5A 4HFJA 4PFQA 3WB9A 4ACBA 5T64A 1HI9A 1WBBA 3BF8A 3RC1A 3TNDA 3ZGOA 5M2QA 1TKBA 2A3NA 1P0PA 3I5XA 5LP6A 2CMKA 1OC2A 1IN6A 1B14A 2FQWA 2HF7A 3MTJA 2OAEA 3OE7D 3QEJA 3OP1A 4N7MA 3RFUA 4DCOA 1NQTA 1RWKA 4FP9A 1I4LD 4TWZA 5KNDA 5BWMA 4XGKA 3OE1A 4UM7A 1M2FA 1QHGA 2GFQA 3BJEA 4PCAA 1XWWA 1CB7A 4JX9A 3UMCA 4CEIB 2QP3A 4IZHA 4FZRA 3LK7A 1FMCA 4L0MA 2IZ1A 1DWOA 3AV0B 1F38A 3ECCA 3QMMA 2BAGA 4WEOA 2G06A 5EQTA 2DVMA 3D81A 4A1FA 4CCAA 4P4SA 2X0EA 1NVTA 3KQWA 2CV0A 1GSHA 1HDCA 1XEXB 2O59A 3F7TA 3GAMA 1TIBA 2J3KA 2XRFA 4QHSA 3V7YA 1L8QA 4ZJZA 4PO1A 3UJPA 4I14A 1J97A 1G3UA 4HKTA 4YDHB 4WCDA 2JAQA 2QBYA 5DF1A 3HVHA 2X9LA 4D57A 4BLVA 3TOXA 1WNFA 3UWDA 4BNHA 4GM0A 1MEOA 4WN9B 2XDQA 2DKNA 1X1CA 3GRZA 3KUUA 4RU1A 5BSTA 1XVAA 2I87A 1JAZA 1NDUA 3NWOA 3Q88A 1VXOA 3ANLA 4F72A 3PA6A 3BQNB 2NU9B 3WLOA 3N2GA 1SVKA 4RYDA 3NEYA 4FMDB 1IPEA 2EHJA 4KXLA 1ZZGA 3JWIA 3STTA 4EAQA 2CDAA 3KG2A 4P5EA 1AKMA 4RHUA 4UBMA 4TS9A 3S4YA 2Q4OA 5HS4A 1ZGBA 1Y8CA 4KXWA 1V48A 4LSMA 4QEKA 4TV8A 3ZGNA 3KEQA 3P0RA 2BGGA 3DTNA 4U5QA 1K5GA 2YDYA 4KQXA 1JILA 2Y1XA 4V39A 1Y3BE 2DYKA 3I2YX 4X6YA 5FOXA 2CV1A 4IDNA 1M74A 2X9QA 1LPOA 1AKTA 1QLHA 5CX1B 3WGKA 1NP3A 1ABEA 2C5AA 4DJTA 5JAHA 3EFBA 4RGVA 1TLFA 2XWSA 1L8AA 4D3DA 1IZ9A 1NTRA 1ZZEA 1PQPA 1TUIA 5JARA 4TRMA 2BCJQ 3WGUA 5K0GA 5TNXA 1MJGA 1NTOA 2R97A 3MUOA 5K3BA 5LUAA 2CJWB 3JAMA 2G63A 1IN5A 2JFUA 2PJZA 1NXPA 2ZJ6A 3FPKA 4XQCA 1FFDA 5AUPB 5C80A 1DJPA 1Q0LA 1RRVA 4IJMA 4Q0MA 4YJ3F 2SCUA 3U1VA 3VX3A 3R7WB 5IK2A 4BLRA 3DBIA 3Q11A 3FH0A 4J0FA 5B30A 1USVA 4J0KA 4FS8A 3WLHA 5H4GA 1U7ZA 1GUYA 1H22A 2CXNA 3R77A 2ZW9A 1P81A 4M83A 1BGXT 1KFEB 3UHPA 4EI7A 5KIAA 4KTVE 1NGSA 1FFWA 2AVNA 4PZPA 2J0EA 1UMDB 1ST2A 2OTCA 2IEGA 3ASVA 5KEIA 4OKSA 3QIAA 5E4YA 1BVYF 1UK6A 1GFZA 4GWKA 1Y7TA 5BVHA 3UAVA 5JSYA 4YUAA 3GFPA 2F3SA 2H5IA 1STOA 3GJYA 4PPQA 3EVCA 4OQPA 1BDIA 1Z6QA 4R1SA 1Q50A 4QTXA 4DLZA 2UZ4A 4BMYA 1J0AA 2ZVDA 1QIMA 4GBMA 3L6DA 4CGZA 1VJ1A 4NY1A 2EZ4A 4QJIA 4AZSA 4I50A 1ZIOA 2ID7A 4FBMA 4WCVA 1IAQA 1R5NA 4YECA 4F71A 3ZLJA 4HZUA 2EJVA 1FC0A 2AN4A 4ZT6A 5DK6A 3DBRB 1GEEA 1YQWA 3IOCA 3QKTA 2JVJA 3HZRA 1DJOA 4HXFB 3TNYA 3TOVA 3THXA 2Q41A 3DVAB 4G1BA 4UNPA 2ZI7A 4LGMA 4I1VA 5T4HA 1MOZA 1LTHR 3QOFA 4Y6LA 2I3ZA 5I4CA 5JLJA 4XIFA 4RZHA 1FTSA 1W52X 2WDPA 1O9GA 3FPJA 4MQ6A 5HZHA 2Q45A 1K63A 3Q3EA 3SYNA 2IDZA 1KP9A 4HQNA 3ZY6A 4CMEC 4AS2A 4QT0A 5HXAA 3OCWA 1L1FA 4ITVA 3P0IA 5KVQA 3TR5A 3OE5A 3FHCB 3HU3A 1FZQA 4JJEA 4IKOA 1P1KA 3EA0A 4JYZA 3SJZA 1LBSA 1I3LA 4C0HA 2I6TA 4J2OA 2GFHA 4W1SA 3T7IA 4BVGA 2BSXA 3IAXA 1SUWA 3GRPA 1UMCB 3EASA 4XUDA 2ETVA 3WTCA 1EBFA 1Y33E 2LCIA 3NT4A 4IM7A 2C3YA 1ETUA 1ENOA 4CQLB 4LY3A 4OXIA 2B78A 3VO2A 3VTKA 5KS2A 4INPA 4ZZ3A 2BRUC 5JXHA 1BQ4A 1RR6A 4BX9A 2I8AA 3ZQJA 1NYRA 4HGZA 1RLTA 2QROA 2Z2XA 2ZWMA 2ZBGA 2I65A 5CW2A 4FZ5A 3P4YA 3IQEA 4RXTA 3CLVA 1DV2A 4JLWA 4C30A 2BL4A 1DFIA 3FVRA 3N2KB 3RAGA 2EKDA 3K15A 4ZHSA 3REQA 2P8SA 3WNCA 3H6HA 3CR7A 3OLCX 1E1LA 3GLKA 4X1OA 2B25A 2ODEA 3QNWA 5I4IA 1QMGA 1IONA 1N6OA 1YR7A 3DZGA 3RS5A 3W3AH 1DRWA 2QSUA 1V11B 4M1YA 1MB0A 1SHLA 2Y1GA 1A27A 3KTDA 1SK9A 2AQIA 4ZT2A 1ZN8A 2QN3A 3L01A 4QGGA 1GTZA 4KI7A 3PRYA 4Q3NA 3R9KA 4BMNA 1HZJA 4CETA 5HKKA 1NFFA 5G40A 2XRZA 3R3WA 1XDZA 2C2KA 1B8UA 3ODGA 1HL3A 3Q7TA 1KO4A 2WG2A 4Z4HA 2IRWA 3GDHA 3O1HB 3UN1A 3AHCA 4HWRA 4AMZA 3WGTA 1RAFA 4HLNA 3K0CC 1CPYA 1BX3A 1MAUA 3RRBA 2EKQA 2XADA 3IT2A 4JJIA 4B17A 2V7QA 2ONKA 4B31A 1UCFA 4XCQA 4B6OA 4OMDA 2E1PA 1ODLA 4UREA 2E89A 3WGVA 1P80A 3WNBA 1SC3A 2CNWD 1XROA 3KSAC 5JWOA 2HGSA 1N77A 1U99A 1YZTA 1SUPA 1WTAA 2TMKA 3MEQA 4HOYA 4JJFA 5F12A 1V4BA 4A6XA 2ZYIA 4MUNA 4BVFA 1H1LB 3VVCA 3OLYA 3EXG1 5LQSA 3M6XA 3K8YA 3Q98A 4Q7QA 4I1IA 2A0KA 3MUEA 2QM3A 4OJTA 1HG0A 4W5HA 2X7XA 5ESRA 4EB0A 5JRJA 1Y3CE 2VYVA 1PSZA 2JJQA 3KP1A 4JXJA 3I45A 3W79A 2FK8A 5L4LA 3PSAA 4AAYA 1JEYA 2X2FA 5DCUA 5KYGA 3L0YA 1X7DA 3IUQA 4GWLA 2YMQA 4OUKX 1JDSA 3D54D 3H75A 3SF0A 2PRYA 1BEEA 1EX6A 1UBUS 1U7XA 1V1MA 1Y98A 3DQZA 1KE2A 4XFDA 1BWRA 4QU5A 5FOVA 1U0SY 2WQZA 5K09A 1E7YA 4FDLA 1FLVA 4KGVA 2G67A 4P53A 4Z86A 2X3YA 3LTEA 4BVBA 4C1BA 2PL5A 5BNTA 3TWOA 3HXOA 4Y6SA 3OMWA 2EVWX 3IA2A 3TDMA 4FHDA 4EBFA 2ZAIA 4PINA 2O5RA 2CFCA 2MYTA 1J1ZA 1CUJA 3QM1A 3AVPA 5CNJA 4M9ZA 1R8QA 1YZYA 1X7WB 3FUWA 5TXGA 3TMYA 2DT8A 3IGFA 2Y6VA 3ISJA 3T5GA 3N0VA 2BJWA 3U31A 3O1JC 1G6Q1 1PT8A 3AY3A 1A9XB 1EVEA 2C58A 2GDZA 2DR2A 4OLFA 4RD0A 3MA0A 1G3MA 3AFGA 1PVDA 1POWA 3K5WA 3T1YB 2AK3A 2F1JA 1BXRB 3THYB 3UF0A 3UGKA 1DAMA 1IOZA 1DAOA 1SOAA 2ZIEA 3E81A 3FPBA 3PTZA 3R3ZA 2ACVA 2QD5A 4O33A 4X8HA 3X1MA 4EFMA 4OAPA 3PDJA 1H8EA 1ZOOA 4WT7A 1J2EA 1DAIA 1JG1A 1N1EA 3JQEA 3O1LA 4FXPA 4GE3A 4HMPA 4D9FA 4DDMA 1KWKA 2IYXA 1N0VC 1JKMA 2O2CA 3G2IA 4HP8A 4D6YA 4BNYA 1EB8A 2YV3A 4YCCA 4ZI3A 1V5GA 5DX8A 4ED9A 4IVQA 4L95C 4MRNA 4QRDA 1NMZA 3NM4A 5KQRA 3JARB 5JMTA 5JZ9A 3VC3A 5JR3A 6AT1A 2GN0A 3RTAA 4I4IA 2J4DA 3JRXA 2NO9A 9ABPA 5AYVA 4ETMA 1RM3A 3WQSB 1HC7A 2Z9CA 3V9AA 5C7LO 4WNAA 5B1SA 3A4LA 1VYUA 2NXEA 1RPZA 3NDJA 5AOCA 1OV6A 1UP7A 3EB9A 4KMSA 2G3YA 3G8YA 4B74A 4BBZA 1ZVMA 1MZVA 4X8OA 1LXCA 3IP6A 4F21A 1GLGA 3T7RA 1AMUA 1L7DA 1PUXA 3FKSD 2BEWA 1OVMA 3ITDA 2ZBQA 4YV2A 1UDRA 1Y81A 1FPQA 1UFOA 5HQ3B 3TQRA 1A9YA 3B52X 4EJSB 2W6JA 4BN5A 3KVYA 3R0IA 1VIMA 621PA 3AUJB 1VZ2A 2I76A 5EUBA 3P20A 4EQ6A 4IIJB 3QI7A 2W42A 3OECA 1UJ6A 2BJVA 2PQ0A 3E5MA 2XRMA 3K6KA 1SOVA 1XBTA 4LBWA 2YZGA 5JO0A 2WA2A 4BMOB 1L5NA 5G4KA 3N7TA 4NZNA 2Y1OA 4YCBA 3ZE7A 4BE7B 3WIDA 2GEJA 1XEWX 5LQUA 3JATA 3GRYA 4MW1A 2FQXA 3VI3B 1ZISA 5F2OA 4ER6A 4ZT7A 1U9JA 3E9EA 3JQ7B 2FG7C 2V6BA 2FP4A 2FZ5A 1K6XA 3GDFA 3Q0EA 3M3PA 1CUZA 3QH4A 1E58A 1ZIYA 4LS3A 2JAWA 4QD3A 4R1TA 2FR8A 1SVSA 3L0ZA 2QAJA 1E99A 4OHWA 4I4NA 1EA7A 2GZRA 3UCEA 1WDLA 4X93A 3R8CA 4MYTA 1NXSA 2Z6UA 4AJHA 4IP0A 5FR1A 3AR3A 3GIDA 4G5GA 2I2FA 2QW0X 1N3LA 3JASA 1NLUA 4TYPA 3EXEB 1TEHA 2G09A 3O9ZA 5JHGB 3MJHA 5LQMA 5B53A 4YAUA 3NHFA 4K5QA 4X00A 5BQ3A 1WZUA 1DEKA