2A5CA

Structure of avidin in complex with the ligand 8-oxodeoxyadenosine
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
123
structure length
123
Chain Sequence
b'ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avidin
publication title Recognition of oxidatively modified bases within the biotin-binding site of avidin.
pubmed doi rcsb
molecule tags Unknown function
total genus 25
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2a5cA00
1KL5A 1VWHB 1SLGB 3X00A 2IZKA 1HQQA 1MM9A 1SWGA 3RY1A 4CPHA 1VWQB 3FDCA 4Z6JA 1AVEA 1SWJA 2RTJA 1HXLA 2UYWA 4JO6A 5CSEA 2IZEB 4BX6B 3WZPA 2C1SA 2MF6A 1I9HA 1VYOA 2C4IA 3WZQA 2OFAA 5IRUA 2RTFB 4GGTA 1DF8A 1STSB 4BX5A 4CPHB 1LDQA 1SLFB 5JD2A 4U46A 4BX7A 1RSTB 2GH7A 2RTDB 1LUQA 1N4JA 2A8GA 2IZBA 2Y3EA 5IRAA 3RDXA 4BX5B 2RTKA 1RAVA 3RDSA 1Y53X 3RDQA 4BCSA 2G5LA 4JNJA 4BX7B 3RDOA 4Z2OA 1SRJA 1VWDB 4GD9A 1Y52X 4GJSA 3RDUA 1SWEA 1SLEB 4JHQA 2OF8A 2Y3FA 4GDAA 1VWLB 1IJ8A 1SWDA 5L3YA 4GGZA 1SWFA 3T2XA 2BC3A 1SRGA 1SWUA 1VWRB 4CPEA 1SRFA 1SWBA 1N43A 1SWAA 2ZSCA 5K67A 5B5FA 2IZHB 1VWOB 1LCVA 1SLDB 4Z28A 1SRIA 1KFFA 2RTLA 1MEPA 1VWMB 2Y32A 2JGSA 1LELA 1LDOA 4BJ8A 1VWAB 2RTGB 4GGRA 3EW2A 3RDMA 3MM0A 3T6LA 1STPA 1WBIA 1Y55X 1SWSA 2RTMA 4Z2PA 1N7YA 1VWPB 1LCZA 3RE5A 1N9YA 2IZDB 3WYPA 2IZCB 3T2WA 4Y59A 2A5BA 1SWHA 2RTIB 4Z27A 2RTCB 3EW1A 2OF9A 1KL4A 1SWRA 4EKVA 4OKAA 1HXZA 2IZIA 3VHMA 1STRB 2IZGB 2WPUA 4IRWA 1RXHA 1VWBB 2RTHB 2RTBB 3VHIA 4YVBA 1VWIB 2RTRB 2QCBA 5F2BA 3RE6A 5IRWA 1VWJB 2A5CA 4GJVA 1HY2A 1NQNA 1MOYA 1RXJA 1SREA 3WZOA 4DNEA 3T6FA 1MK5A 1VWFB 2FHLA 2RTAA 1N9MA 4Y5DA 1SWPA 4Z2VA 3WYQA 2AVIA 3PK2A 5B5GA 2OFBA 1NQMA 1SWCA 1VWGB 1SWOA 5CHKA 1SWQA 2IZFB 3SZJA 1VWKB 2RTQB 3SZIA 1KL3A 3SZHA 1NDJA 1SRHA 3VHHA 2FHNX 1SWKA 1NBXA 2IZAA 1NC9A 4I60A 1AVDA 2RTPB 3WZNA 1VWCB 1RXKA 2CAMA 1SWNA 1LCWA 1SWLA 2IZJA 2IZLB 5K68A 2RTEB 2RTNB 3MG5A 3VGWA 2UZ2A 4CPFA 2RTOB 4BBOA 2F01A 1VWNB 1RSUB 1SWTA 2C1QA 1PTSA 3RY2A 4CPIA 4BX6A 1VWEB
chains in the Genus database with same CATH superfamily
1SLGB 4KCAA 1HQQA 3P6FA 1SWGA 1SA8A 4IAWA 2QOMA 4R0BA 3RY1A 4CPHA 3MVFA 5F1EA 1AVEA 1W6FA 2ACPX 5BVTA 4O3YA 1QABE 3G7XA 2FLJA 4TKJA 3WZPA 4AZOA 4BX6B 2FWVA 1I9HA 1MX8A 1VYOA 3BY0A 3HWFA 3WZQA 3VE1A 2OVEA 2RTFB 4GGTA 1DF8A 1DZPA 2Z4HA 1BJ7A 3GAQA 1FJ1E 3VG7A 3HOLA 1BRPA 1LDQA 2CM4A 4U9CA 2FTBA 4U46A 5D48A 3EMMA 1ACDA 4Y0QA 2CZTA 1N4JA 2A8GA 2Y3EA 1ZNHA 5IRAA 1KXOA 3RDXA 2RTKA 3TZSA 2FR3A 5IO5A 1XKIA 3AEHA 4YFQA 2RD7C 3CR6A 2OVAA 2G5LA 4L1NA 2OYBO 3RDOA 1ZNKA 4CDCA 4Z2OA 1VWDB 5H9NA 1Y52X 3IFBA 4ES7A 3RDUA 3ZW2A 1SWEA 4JHQA 2OF8A 4O4OA 3WBGA 2HYSA 3Q34A 1KT6A 2BS6A 4GGZA 1I04A 2RQ0A 1T68X 3JSQA 2OY5O 1KOIA 3T2XA 4COTA 1IW2A 3HWDA 4IB8A 1SWUA 1VWRB 1PM1X 2ANSA 4U8UM 5B3MO 1DV9A 2KT4B 3JS1A 3Q6LA 5FQ7E 4ORXA 1BSQA 2ZSCA 4YCEA 1JMXA 5K67A 1WUBA 2JMBA 2JN3A 4LKPA 5AJBA 2Y32A 2RTLA 5CE4A 3VG4A 3AKMA 3V8UA 2X8FA 1HMSA 1ZRYA 2JW1A 5LJKA 2A2GA 4YFPA 2NNQA 1LIBA 4N7DA 4YKOA 2MO5A 3D95A 1LDOA 1UYOX 1KT4A 4O3XB 2GTFX 1G85A 1JYJA 1KT7A 1SY1A 2IFBA 1BBPA 1GX9A 4OEMA 2O62A 4KIIA 3D97A 2LFOA 3RSWA 1SWSA 1OSPO 2K62A 1E06A 1LCZA 1LNMA 1PMPA 4YCHA 1TOWA 2FT9A 4GU8A 2A5BA 1SWHA 3E3CA 3HOEA 3STKA 4HPCA 4ZGUA 2LA7A 5C0NA 4QAEA 1OPAA 3S5XA 2OF9A 1KL4A 4CK4A 1EALA 2AT0X 5DG4A 4ALOA 4DCBA 1EIOA 5CYBA 3BX8A 4ZHGA 2HLVA 4MEEA 3RZYA 3RKGA 2RTHB 4OS8A 3EBWA 1EQDA 4NLIA 4ZHDA 2POAA 1U17A 2X34A 4AYHA 2HNXA 1VWIB 1PBOA 1RBPA 2WSJA 2OL8O 2W2BA 4KH8A 5F2BA 3RE6A 3FYFA 1T0VA 3B2HA 3BSZE 3KFFA 4DNEA 1VWFB 4I3CA 1TOUA 2FHLA 1N9MA 4LZVA 4Y5DA 4ZCBA 4ZHHA 3FA6A 1SWPA 4TJZA 2AVIA 4HPDA 3SLOA 3KQ0A 2GTLN 5EPQA 1VWGB 1JMZA 2ASNX 3FIDA 3WJBA 1SWOA 1FE3A 2RTQB 5HBSA 1KL3A 1U0XA 3C76X 4QGXA 1NDJA 4QYPA 3BU9A 3KZAA 3SZHA 1Z24A 3CKFA 1GT3A 4MISA 1SWKA 4FBRA 3HK1A 3QKGA 3ZZVA 2IZAA 4GNWA 2G8CO 2BT9A 1AVDA 3FA7A 1JZUA 5IO6A 2IZJA 2M4LA 4D6AA 4ID2A 1B4MA 1HBQA 3WJDA 1A2DA 3VGWA 1BSYA 4CDFA 4KT5A 3D96A 3FLLA 5H9KA 4QZTA 3TGAA 4BBOA 2G78A 4B55A 4CPFA 3U03A 2X32A 3S26A 4DQ3A 2L9CA 4ORUA 1X8NA 2NP1A 5H9AA 3MX7A 4CPIA 5B2AO 1CBQA 4IB7A 2CZUA 2Q2PA 2WEWA 4AW8A 3UEXA 2W2FA 3WOVA 3FDCA 5LJDA 1SWJA 2KTDA 2X8SA 1VYFA 1X89A 3PECA 3PH5A 2AL0X 1LKEA 2G7BA 2MF6A 2N93A 1JYDA 2GC9A 3KFGA 5IRUA 1W5RA 1CRBA 4CPHB 3HTYA 1KQXA 3UEVA 1H91A 1UYNX 5IXGA 1SLFB 4TQ2A 1BLRA 4BX7A 2BHVA 4PJ2A 2K23A 4XMDA 3QQ2A 4NV8A 1LUQA 3SOTA 5F7GA 4NNTA 4FQBB 1PEEA 1T8VA 3PEDA 1GT5A 3N91A 3RDSA 2LBVA 4JNJA 4ZGFA 2VFCA 5JR8A 2VDFA 1E5PA 2RN4A 4GD9A 4CV7A 1LICA 1EXSA 1QQSA 3NR3A 4GJSA 1ERBA 4GDAA 4O9SA 2BSZA 1VWLB 2E4JA 1X71A 4I95A 1IJ8A 4C5PA 4EEJA 5HCCC 1SWFA 3I17A 2BC3A 1HQPA 4K19A 4CSBA 1A3YA 2OL7A 1IKJA 4ORYA 3WVMA 5EEDA 4CPEA 4MVIA 1SWBA 3HWEA 1AELA 4ORSA 5B5FA 4I3BA 5KHPA 3JQOA 4A1HA 3P6HA 3O22A 4ZR2A 1S44A 1FTPA 3APWA 3P02A 4GETA 2WQ9A 4MVLA 4CDDA 2OVDA 1I4UA 3FR2A 1VWMB 2A3FX 4JGLA 1EUOA 3EBKA 4TKBA 1AQBA 4YMYA 4OELA 3ZI8A 1DC9A 1K24A 1A18A 4HPBA 3RWXA 2Q4NA 1VWAB 1EIIA 4TLJA 4Y0SA 4GGRA 3RDMA 1YIVA 2JOZA 3MM0A 4O4XA 5FQ6E 2OFMX 3T6LA 5F58A 1KT3A 2RTMA 4FBVA 3F6ZB 5EZ2A 1BRQA 1DZJA 1VWPB 4FGIB 1N9YA 3WYPA 1HBPA 4IMNA 1TVQA 2IZCB 2QO6A 2X8TA 3IA8A 2GTLO 2RTIB 4Y59A 1QY1A 4AZQA 3CKGA 2R74A 3ZUIA 2HZRA 1SWRA 4EKVA 1G7NA 4OKAA 3TGBA 1GXAA 1Y9TA 2DM5A 2F73A 3PPTA 1Y9LA 2WPUA 1YWAA 1RXHA 2L67A 4ZHFA 2RTBB 2AMMX 4WFVA 3HWGA 1A57A 3FIQA 3EYCA 3T1DA 2OY8A 4GJVA 2A0AA 1BSOA 1HY2A 2RCTA 4YGZA 1GT4A 1LFOA 1MOYA 1RXJA 1SREA 2EU7X 2OL6O 3D4RA 3WJFA 2Q2MA 4AZPA 3NQ9A 1ZNDA 4LZUA 4Z2VA 3ZQ3A 4Y0RA 2L68A 5B5GA 2OFBA 5L8NA 1NQMA 1SWCA 2AF5A 3NQ3A 4GNYA 1GX3A 2Q9SA 5LKEA 2I5VO 5AJCA 1FDQA 1CBSA 2FGSA 1VWKB 2OVSA 4ZHCA 2A2UA 1SY0A 2LKKA 3VHHA 3VU1A 5EEEA 4KC7A 4ZH6A 4KC8A 3APUA 3LHNA 3FA8A 5F6ZA 4GE1A 3PP6A 2JU8A 3WZNA 4Y0PA 4OMWA 2IZLB 5BVSA 2OFRX 1OEEA 5L8OA 4NLJA 1BEBA 1N0SA 1SXWA 4I9SA 2RTNB 4YDAA 3U0DA 4U8UN 1YWBA 1QFTA 1OBUA 1S7DA 1SWTA 2ZAGA 1IIUA 3GE2A 4AZRA 5IO7A 3UEUA 1B0OA 5HZ5A 1KL5A 1VWHB 5LJEA 5HCEC 2IZKA 2QOSC 1MM9A 4L3RA 1L6MA 1TW4A 1QWDA 3B2IA 4Z6JA 2RTJA 1HXLA 1ZNGA 5BYPA 2LBAA 4TNNA 2AT5X 1NP1A 2C1SA 5B27A 1ICNA 2X4MA 2C4IA 4GDZA 2MWHA 3CWKA 1STSB 3CQRA 1YWDA 4BX5A 3FEKA 1GKAB 4OS0A 1AB0A 2MHDA 4TKHA 2YG2A 1RSTB 3BS2A 1LF7A 1QFVA 4IBAA 2RTDB 2VFBA 1EPAA 5D45A 5HA0A 4ORRA 1Y53X 2JU3A 2XSTA 3APVA 5LKFA 1MUPA 3RDQA 4YGGA 4BCSA 4BX7B 1GX8A 2HMBA 3P6DA 3VG5A 4QYNA 2WEXA 1FENA 3BLGA 1LIEA 4ODDA 4DQ4A 4EFGA 2BLGA 5HZ8A 2BS5A 2JU7A 1QG5A 3TGCA 4BOEA 5L3YA 3TF6A 3L4RA 1GKAA 1IKEA 4XMHA 4LKTA 1FEMA 1DZKA 2HKDA 4BVMA 4EQAC 1D3SA 1SXUA 1LPJA 5HCDC 1N43A 1SWAA 3DSZA 2W2AA 3NPOA 1X8UA 1GGLA 1VWOB 4O49A 5LJGA 5HZ6A 1SLDB 5HA1A 1SRIA 1AVGI 4Z28A 2OZQA 3C77X 4A8ZA 1KFFA 5L8IA 1JJJA 2HZQA 3B2JA 4CDEA 1SY3A 2X45A 3UEWA 4HPAA 1MX7A 4MVEA 2JGSA 3FELA 1GT1A 1LELA 1ML7A 1ALBA 4BJ8A 1HMRA 1EPBA 4IB9A 1S2PA 1KZWA 4XMEA 1X8QA 1STPA 4Z2PA 1Y55X 4ARHA 2QMIA 2CM9A 1G5WA 2A13A 3RE5A 2IZDB 4ON1A 1X8PA 3O2YA 5D4AA 4EDEA 3T2WA 3KFHA 2FKGA 2RA6A 3P6EA 3PDFA 1JV4A 4Z27A 5LJHA 1OPBA 2RTCB 4IB6A 4NP1A 5H9LA 3EW1A 2WWPA 3NP1A 2WUTA 1HXZA 1I78A 1HN2A 4WBKA 1VWBB 3SLJA 4I6SA 1DF3A 1ZNEA 1RLBE 2XKLA 1ICMA 4INNA 5D8JA 5AQ6A 3ZW0B 1OBPA 3NX2A 3APXA 2X55A 1JJUA 2Z4IA 5IRWA 3OD9A 1JJXA 2A5CA 2LB6A 4I9RA 4QNIA 2OY1O 1BM5A 5FQ8E 4U8UO 3WZOA 3T6FA 3ZW1A 4WFUA 2RTAA 4NW4A 1JBHA 3VE2A 3FR4A 4QRLA 1NGLA 1QY0A 3I0AA 1YP7A 3WYQA 3PK2A 2G79A 3PQUA 4FBOA 1I05A 1UREA 4YKMA 4A1YA 4ZFXA 3SZJA 4I3DA 1YUPA 3BDRA 3P24A 5FENA 2MJIA 3PQSA 2FS7A 3F8AA 2FHNX 1CBRA 3FEPA 1ADLA 3ZW0A 2F09A 2NNEA 5H8TA 1NC9A 5HTEA 1VWCB 3F9DA 4GKCA 4M6SA 1SWLA 3UAQA 1NP4A 1KZXA 3CBSA 2DJGA 5K68A 2RTEB 1VYGA 5FFHA 5KIDA 3B2LA 3MG5A 3ZWEA 2CBRA 2FS6A 3PH6A 2UZ2A 2GJ5A 4OMXA 2CBSA 4YGHA 3WJCA 2ACOA 2F01A 1VWNB 2DJFA 3MBTA 4GH7A 4ML7B 3CMPA 3P6CA 4OS3A 3RY2A 4MIRA 1G74A 4BX6A 3FR5A 3OBLA 3STMX 2MM3A 3X00A 4YBUA 1UZ2X 1YP6A 1O8VA 5BVQA 1VWQB 5D47A 5LJCA 4M7MA 5AEOA 2UYWA 4JO6A 5CSEA 2IZEB 3P6GA 2OFAA 1R0UA 4HFOA 3K3LA 4GRJA 1KQWA 3RBYA 2PI3O 4XMFA 1B56A 1LIFA 1ZNLA 5JD2A 4RUUA 5HZQA 2GH7A 1YWCA 3NX1A 5B11O 3VPJE 2GTLM 2RCQA 2X46A 4O4SA 3FW4A 2IZBA 4NNSA 2FRSA 2NNDA 4BX5B 1RAVA 4HWMA 1X8OA 1KGLA 1HMTA 4IMOA 2R56A 3OE3A 1SRJA 1SXYA 4GZVA 3SAOA 4O4UA 3DTQA 1SLEB 2Y3FA 4GUZA 3SLTA 1VPRA 2Q39A 3BRNA 1SWDA 2KD2A 3B2KA 4O3ZA 3AKNA 4NV7A 4ORWA 5HTDA 3VG6A 1SRGA 2YMSA 3BU1A 5F6BA 3D9WA 3EC5A 4ZH9A 4ALBA 3CQNA 4D6BA 1MDCA 1SRFA 2IZHB 1PBYA 4BGFA 1MVGA 1OEJA 1SY2A 1LCVA 3FENA 1SXXA 1D2UA 1MEPA 5FAZA 4N7CA 4EXZA 4A60A 2AT8X 4YDBA 3STNA 2ZAIA 1XCAA 3EM0A 4YFRA 2KW1A 5HAEA 2WQAE 2RTGB 4NYQA 1EI5A 3EW2A 1O1VA 1WBIA 1N7YA 4WHIA 2I5ZO 2WR6A 3WJGA 1SMPI 1LIDA 4QGWA 4YH0A 3FA9A 4BQUA 3BX7A 1O1UA 2ALLX 1TXLA 3ELXA 1B8EA 3KVNA 1Y0GA 5LJBA 1W4TA 3ELZA 2R73A 3NQKA 5DPQA 3U9PC 2IZIA 5HWZA 3VHMA 1STRB 2IZGB 4IRWA 1IFBA 1K3BA 3SZIA 2OY7A 2QM9A 3WXQA 3VHIA 1GM6A 5B10O 4YVBA 2RTRB 2QCBA 2KTSA 3KFIA 3NADA 1FELA 3LV4A 5EDBA 4AZNA 3LTWA 1VWJB 3NBXX 2AKQA 1NQNA 1OBQA 4YBPA 3VG2A 1MK5A 3HPEA 5EDCA 1EW3A 4RUNA 2QO4A 4ZJ0A 3CBCA 1BWYA 4IAXA 1I06A 1OEKA 4U3QA 3FMZA 4QQ1A 5B29A 4MVKA 4QZUA 3ZUOA 2FR2A 2PY1A 2AT3X 2AT6X 3AUMO 1DFVA 4QGVA 5CHKA 1SWQA 2IZFB 3S60A 3ZW1B 2FKJA 1P6PA 1IFCA 4NYRA 1CBIA 1U18A 1SRHA 2QO5A 3FW5A 4UU2A 1CJ5A 5K06A 4XMCA 4UU3A 2P8GA 4XMGA 1NBXA 1E2TA 4I60A 4PSQA 4AZMA 2RTPB 2AH7X 5HZ9A 1DZMA 1JQPA 1RXKA 1SWNA 1E02A 1LCWA 2CAMA 3O19A 4IABA 4LQZA 2X56A 3H3IA 3VG3A 3S5VA 1ERXA 1KT5A 3OJYC 3WJEA 3C78X 2RTOB 1E00A 4GK9A 1RSUB 1JIWI 4O3WA 2C1QA 1PTSA 2L5PA 5KICA 1QY2A 1VWEB
chains in the Genus database with same CATH topology
1KL5A 1VWHB 1SLGB 3X00A 2IZKA 1HQQA 1MM9A 1SWGA 3RY1A 4CPHA 1VWQB 3FDCA 4Z6JA 1AVEA 1SWJA 2RTJA 1HXLA 2UYWA 4JO6A 5CSEA 2IZEB 4BX6B 3WZPA 2C1SA 2MF6A 1I9HA 1VYOA 2C4IA 3WZQA 2OFAA 5IRUA 2RTFB 4GGTA 1DF8A 1STSB 4BX5A 4CPHB 1LDQA 1SLFB 5JD2A 4U46A 4BX7A 1RSTB 2GH7A 2RTDB 1LUQA 1N4JA 2A8GA 2IZBA 2Y3EA 5IRAA 3RDXA 4BX5B 2RTKA 1RAVA 3RDSA 1Y53X 3RDQA 4BCSA 2G5LA 4JNJA 4BX7B 3RDOA 4Z2OA 1SRJA 1VWDB 4GD9A 1Y52X 4GJSA 3RDUA 1SWEA 1SLEB 4JHQA 2OF8A 2Y3FA 4GDAA 1VWLB 1IJ8A 1SWDA 5L3YA 4GGZA 1SWFA 3T2XA 2BC3A 1SRGA 1SWUA 1VWRB 4CPEA 1SRFA 1SWBA 1N43A 1SWAA 2ZSCA 5K67A 5B5FA 2IZHB 1VWOB 1LCVA 1SLDB 4Z28A 1SRIA 1KFFA 2RTLA 1MEPA 1VWMB 2Y32A 2JGSA 1LELA 1LDOA 4BJ8A 1VWAB 2RTGB 4GGRA 3EW2A 3RDMA 3MM0A 3T6LA 1STPA 1WBIA 1Y55X 1SWSA 2RTMA 4Z2PA 1N7YA 1VWPB 1LCZA 3RE5A 1N9YA 2IZDB 3WYPA 2IZCB 3T2WA 4Y59A 2A5BA 1SWHA 2RTIB 4Z27A 2RTCB 3EW1A 2OF9A 1KL4A 1SWRA 4EKVA 4OKAA 1HXZA 2IZIA 3VHMA 1STRB 2IZGB 2WPUA 4IRWA 1RXHA 1VWBB 2RTHB 2RTBB 3VHIA 4YVBA 1VWIB 2RTRB 2QCBA 5F2BA 3RE6A 5IRWA 1VWJB 2A5CA 4GJVA 1HY2A 1NQNA 1MOYA 1RXJA 1SREA 3WZOA 4DNEA 3T6FA 1MK5A 1VWFB 2FHLA 2RTAA 1N9MA 4Y5DA 1SWPA 4Z2VA 3WYQA 2AVIA 3PK2A 5B5GA 2OFBA 1NQMA 1SWCA 1VWGB 1SWOA 5CHKA 1SWQA 2IZFB 3SZJA 1VWKB 2RTQB 3SZIA 1KL3A 3SZHA 1NDJA 1SRHA 3VHHA 2FHNX 1SWKA 1NBXA 2IZAA 1NC9A 4I60A 1AVDA 2RTPB 3WZNA 1VWCB 1RXKA 2CAMA 1SWNA 1LCWA 1SWLA 2IZJA 2IZLB 5K68A 2RTEB 2RTNB 3MG5A 3VGWA 2UZ2A 4CPFA 2RTOB 4BBOA 2F01A 1VWNB 1RSUB 1SWTA 2C1QA 1PTSA 3RY2A 4CPIA 4BX6A 1VWEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL5 A;  1VWH B;  1SLG B;  3X00 A;  2IZK A;  1HQQ A;  1MM9 A;  1SWG A;  3RY1 A;  4CPH A;  1VWQ B;  3FDC A;  4Z6J A;  1AVE A;  1SWJ A;  2RTJ A;  1HXL A;  2UYW A;  4JO6 A;  5CSE A;  2IZE B;  4BX6 B;  3WZP A;  2C1S A;  2MF6 A;  1I9H A;  1VYO A;  2C4I A;  3WZQ A;  2OFA A;  5IRU A;  2RTF B;  4GGT A;  1DF8 A;  1STS B;  4BX5 A;  4CPH B;  1LDQ A;  1SLF B;  5JD2 A;  4U46 A;  4BX7 A;  1RST B;  2GH7 A;  2RTD B;  1LUQ A;  1N4J A;  2A8G A;  2IZB A;  2Y3E A;  5IRA A;  3RDX A;  4BX5 B;  2RTK A;  1RAV A;  3RDS A;  1Y53 X;  3RDQ A;  4BCS A;  2G5L A;  4JNJ A;  4BX7 B;  3RDO A;  4Z2O A;  1SRJ A;  1VWD B;  4GD9 A;  1Y52 X;  4GJS A;  3RDU A;  1SWE A;  1SLE B;  4JHQ A;  2OF8 A;  2Y3F A;  4GDA A;  1VWL B;  1IJ8 A;  1SWD A;  5L3Y A;  4GGZ A;  1SWF A;  3T2X A;  2BC3 A;  1SRG A;  1SWU A;  1VWR B;  4CPE A;  1SRF A;  1SWB A;  1N43 A;  1SWA A;  2ZSC A;  5K67 A;  5B5F A;  2IZH B;  1VWO B;  1LCV A;  1SLD B;  4Z28 A;  1SRI A;  1KFF A;  2RTL A;  1MEP A;  1VWM B;  2Y32 A;  2JGS A;  1LEL A;  1LDO A;  4BJ8 A;  1VWA B;  2RTG B;  4GGR A;  3EW2 A;  3RDM A;  3MM0 A;  3T6L A;  1STP A;  1WBI A;  1Y55 X;  1SWS A;  2RTM A;  4Z2P A;  1N7Y A;  1VWP B;  1LCZ A;  3RE5 A;  1N9Y A;  2IZD B;  3WYP A;  2IZC B;  3T2W A;  4Y59 A;  2A5B A;  1SWH A;  2RTI B;  4Z27 A;  2RTC B;  3EW1 A;  2OF9 A;  1KL4 A;  1SWR A;  4EKV A;  4OKA A;  1HXZ A;  2IZI A;  3VHM A;  1STR B;  2IZG B;  2WPU A;  4IRW A;  1RXH A;  1VWB B;  2RTH B;  2RTB B;  3VHI A;  4YVB A;  1VWI B;  2RTR B;  2QCB A;  5F2B A;  3RE6 A;  5IRW A;  1VWJ B;  2A5C A;  4GJV A;  1HY2 A;  1NQN A;  1MOY A;  1RXJ A;  1SRE A;  3WZO A;  4DNE A;  3T6F A;  1MK5 A;  1VWF B;  2FHL A;  2RTA A;  1N9M A;  4Y5D A;  1SWP A;  4Z2V A;  3WYQ A;  2AVI A;  3PK2 A;  5B5G A;  2OFB A;  1NQM A;  1SWC A;  1VWG B;  1SWO A;  5CHK A;  1SWQ A;  2IZF B;  3SZJ A;  1VWK B;  2RTQ B;  3SZI A;  1KL3 A;  3SZH A;  1NDJ A;  1SRH A;  3VHH A;  2FHN X;  1SWK A;  1NBX A;  2IZA A;  1NC9 A;  4I60 A;  1AVD A;  2RTP B;  3WZN A;  1VWC B;  1RXK A;  2CAM A;  1SWN A;  1LCW A;  1SWL A;  2IZJ A;  2IZL B;  5K68 A;  2RTE B;  2RTN B;  3MG5 A;  3VGW A;  2UZ2 A;  4CPF A;  2RTO B;  4BBO A;  2F01 A;  1VWN B;  1RSU B;  1SWT A;  2C1Q A;  1PTS A;  3RY2 A;  4CPI A;  4BX6 A;  1VWE B; 
#chains in the Genus database with same CATH topology
 1SLG B;  4KCA A;  1HQQ A;  3P6F A;  1SWG A;  1SA8 A;  4IAW A;  2QOM A;  4R0B A;  3RY1 A;  4CPH A;  3MVF A;  5F1E A;  1AVE A;  1W6F A;  2ACP X;  5BVT A;  4O3Y A;  1QAB E;  3G7X A;  2FLJ A;  4TKJ A;  3WZP A;  4AZO A;  4BX6 B;  2FWV A;  1I9H A;  1MX8 A;  1VYO A;  3BY0 A;  3HWF A;  3WZQ A;  3VE1 A;  2OVE A;  2RTF B;  4GGT A;  1DF8 A;  1DZP A;  2Z4H A;  1BJ7 A;  3GAQ A;  1FJ1 E;  3VG7 A;  3HOL A;  1BRP A;  1LDQ A;  2CM4 A;  4U9C A;  2FTB A;  4U46 A;  5D48 A;  3EMM A;  1ACD A;  4Y0Q A;  2CZT A;  1N4J A;  2A8G A;  2Y3E A;  1ZNH A;  5IRA A;  1KXO A;  3RDX A;  2RTK A;  3TZS A;  2FR3 A;  5IO5 A;  1XKI A;  3AEH A;  4YFQ A;  2RD7 C;  3CR6 A;  2OVA A;  2G5L A;  4L1N A;  2OYB O;  3RDO A;  1ZNK A;  4CDC A;  4Z2O A;  1VWD B;  5H9N A;  1Y52 X;  3IFB A;  4ES7 A;  3RDU A;  3ZW2 A;  1SWE A;  4JHQ A;  2OF8 A;  4O4O A;  3WBG A;  2HYS A;  3Q34 A;  1KT6 A;  2BS6 A;  4GGZ A;  1I04 A;  2RQ0 A;  1T68 X;  3JSQ A;  2OY5 O;  1KOI A;  3T2X A;  4COT A;  1IW2 A;  3HWD A;  4IB8 A;  1SWU A;  1VWR B;  1PM1 X;  2ANS A;  4U8U M;  5B3M O;  1DV9 A;  2KT4 B;  3JS1 A;  3Q6L A;  5FQ7 E;  4ORX A;  1BSQ A;  2ZSC A;  4YCE A;  1JMX A;  5K67 A;  1WUB A;  2JMB A;  2JN3 A;  4LKP A;  5AJB A;  2Y32 A;  2RTL A;  5CE4 A;  3VG4 A;  3AKM A;  3V8U A;  2X8F A;  1HMS A;  1ZRY A;  2JW1 A;  5LJK A;  2A2G A;  4YFP A;  2NNQ A;  1LIB A;  4N7D A;  4YKO A;  2MO5 A;  3D95 A;  1LDO A;  1UYO X;  1KT4 A;  4O3X B;  2GTF X;  1G85 A;  1JYJ A;  1KT7 A;  1SY1 A;  2IFB A;  1BBP A;  1GX9 A;  4OEM A;  2O62 A;  4KII A;  3D97 A;  2LFO A;  3RSW A;  1SWS A;  1OSP O;  2K62 A;  1E06 A;  1LCZ A;  1LNM A;  1PMP A;  4YCH A;  1TOW A;  2FT9 A;  4GU8 A;  2A5B A;  1SWH A;  3E3C A;  3HOE A;  3STK A;  4HPC A;  4ZGU A;  2LA7 A;  5C0N A;  4QAE A;  1OPA A;  3S5X A;  2OF9 A;  1KL4 A;  4CK4 A;  1EAL A;  2AT0 X;  5DG4 A;  4ALO A;  4DCB A;  1EIO A;  5CYB A;  3BX8 A;  4ZHG A;  2HLV A;  4MEE A;  3RZY A;  3RKG A;  2RTH B;  4OS8 A;  3EBW A;  1EQD A;  4NLI A;  4ZHD A;  2POA A;  1U17 A;  2X34 A;  4AYH A;  2HNX A;  1VWI B;  1PBO A;  1RBP A;  2WSJ A;  2OL8 O;  2W2B A;  4KH8 A;  5F2B A;  3RE6 A;  3FYF A;  1T0V A;  3B2H A;  3BSZ E;  3KFF A;  4DNE A;  1VWF B;  4I3C A;  1TOU A;  2FHL A;  1N9M A;  4LZV A;  4Y5D A;  4ZCB A;  4ZHH A;  3FA6 A;  1SWP A;  4TJZ A;  2AVI A;  4HPD A;  3SLO A;  3KQ0 A;  2GTL N;  5EPQ A;  1VWG B;  1JMZ A;  2ASN X;  3FID A;  3WJB A;  1SWO A;  1FE3 A;  2RTQ B;  5HBS A;  1KL3 A;  1U0X A;  3C76 X;  4QGX A;  1NDJ A;  4QYP A;  3BU9 A;  3KZA A;  3SZH A;  1Z24 A;  3CKF A;  1GT3 A;  4MIS A;  1SWK A;  4FBR A;  3HK1 A;  3QKG A;  3ZZV A;  2IZA A;  4GNW A;  2G8C O;  2BT9 A;  1AVD A;  3FA7 A;  1JZU A;  5IO6 A;  2IZJ A;  2M4L A;  4D6A A;  4ID2 A;  1B4M A;  1HBQ A;  3WJD A;  1A2D A;  3VGW A;  1BSY A;  4CDF A;  4KT5 A;  3D96 A;  3FLL A;  5H9K A;  4QZT A;  3TGA A;  4BBO A;  2G78 A;  4B55 A;  4CPF A;  3U03 A;  2X32 A;  3S26 A;  4DQ3 A;  2L9C A;  4ORU A;  1X8N A;  2NP1 A;  5H9A A;  3MX7 A;  4CPI A;  5B2A O;  1CBQ A;  4IB7 A;  2CZU A;  2Q2P A;  2WEW A;  4AW8 A;  3UEX A;  2W2F A;  3WOV A;  3FDC A;  5LJD A;  1SWJ A;  2KTD A;  2X8S A;  1VYF A;  1X89 A;  3PEC A;  3PH5 A;  2AL0 X;  1LKE A;  2G7B A;  2MF6 A;  2N93 A;  1JYD A;  2GC9 A;  3KFG A;  5IRU A;  1W5R A;  1CRB A;  4CPH B;  3HTY A;  1KQX A;  3UEV A;  1H91 A;  1UYN X;  5IXG A;  1SLF B;  4TQ2 A;  1BLR A;  4BX7 A;  2BHV A;  4PJ2 A;  2K23 A;  4XMD A;  3QQ2 A;  4NV8 A;  1LUQ A;  3SOT A;  5F7G A;  4NNT A;  4FQB B;  1PEE A;  1T8V A;  3PED A;  1GT5 A;  3N91 A;  3RDS A;  2LBV A;  4JNJ A;  4ZGF A;  2VFC A;  5JR8 A;  2VDF A;  1E5P A;  2RN4 A;  4GD9 A;  4CV7 A;  1LIC A;  1EXS A;  1QQS A;  3NR3 A;  4GJS A;  1ERB A;  4GDA A;  4O9S A;  2BSZ A;  1VWL B;  2E4J A;  1X71 A;  4I95 A;  1IJ8 A;  4C5P A;  4EEJ A;  5HCC C;  1SWF A;  3I17 A;  2BC3 A;  1HQP A;  4K19 A;  4CSB A;  1A3Y A;  2OL7 A;  1IKJ A;  4ORY A;  3WVM A;  5EED A;  4CPE A;  4MVI A;  1SWB A;  3HWE A;  1AEL A;  4ORS A;  5B5F A;  4I3B A;  5KHP A;  3JQO A;  4A1H A;  3P6H A;  3O22 A;  4ZR2 A;  1S44 A;  1FTP A;  3APW A;  3P02 A;  4GET A;  2WQ9 A;  4MVL A;  4CDD A;  2OVD A;  1I4U A;  3FR2 A;  1VWM B;  2A3F X;  4JGL A;  1EUO A;  3EBK A;  4TKB A;  1AQB A;  4YMY A;  4OEL A;  3ZI8 A;  1DC9 A;  1K24 A;  1A18 A;  4HPB A;  3RWX A;  2Q4N A;  1VWA B;  1EII A;  4TLJ A;  4Y0S A;  4GGR A;  3RDM A;  1YIV A;  2JOZ A;  3MM0 A;  4O4X A;  5FQ6 E;  2OFM X;  3T6L A;  5F58 A;  1KT3 A;  2RTM A;  4FBV A;  3F6Z B;  5EZ2 A;  1BRQ A;  1DZJ A;  1VWP B;  4FGI B;  1N9Y A;  3WYP A;  1HBP A;  4IMN A;  1TVQ A;  2IZC B;  2QO6 A;  2X8T A;  3IA8 A;  2GTL O;  2RTI B;  4Y59 A;  1QY1 A;  4AZQ A;  3CKG A;  2R74 A;  3ZUI A;  2HZR A;  1SWR A;  4EKV A;  1G7N A;  4OKA A;  3TGB A;  1GXA A;  1Y9T A;  2DM5 A;  2F73 A;  3PPT A;  1Y9L A;  2WPU A;  1YWA A;  1RXH A;  2L67 A;  4ZHF A;  2RTB B;  2AMM X;  4WFV A;  3HWG A;  1A57 A;  3FIQ A;  3EYC A;  3T1D A;  2OY8 A;  4GJV A;  2A0A A;  1BSO A;  1HY2 A;  2RCT A;  4YGZ A;  1GT4 A;  1LFO A;  1MOY A;  1RXJ A;  1SRE A;  2EU7 X;  2OL6 O;  3D4R A;  3WJF A;  2Q2M A;  4AZP A;  3NQ9 A;  1ZND A;  4LZU A;  4Z2V A;  3ZQ3 A;  4Y0R A;  2L68 A;  5B5G A;  2OFB A;  5L8N A;  1NQM A;  1SWC A;  2AF5 A;  3NQ3 A;  4GNY A;  1GX3 A;  2Q9S A;  5LKE A;  2I5V O;  5AJC A;  1FDQ A;  1CBS A;  2FGS A;  1VWK B;  2OVS A;  4ZHC A;  2A2U A;  1SY0 A;  2LKK A;  3VHH A;  3VU1 A;  5EEE A;  4KC7 A;  4ZH6 A;  4KC8 A;  3APU A;  3LHN A;  3FA8 A;  5F6Z A;  4GE1 A;  3PP6 A;  2JU8 A;  3WZN A;  4Y0P A;  4OMW A;  2IZL B;  5BVS A;  2OFR X;  1OEE A;  5L8O A;  4NLJ A;  1BEB A;  1N0S A;  1SXW A;  4I9S A;  2RTN B;  4YDA A;  3U0D A;  4U8U N;  1YWB A;  1QFT A;  1OBU A;  1S7D A;  1SWT A;  2ZAG A;  1IIU A;  3GE2 A;  4AZR A;  5IO7 A;  3UEU A;  1B0O A;  5HZ5 A;  1KL5 A;  1VWH B;  5LJE A;  5HCE C;  2IZK A;  2QOS C;  1MM9 A;  4L3R A;  1L6M A;  1TW4 A;  1QWD A;  3B2I A;  4Z6J A;  2RTJ A;  1HXL A;  1ZNG A;  5BYP A;  2LBA A;  4TNN A;  2AT5 X;  1NP1 A;  2C1S A;  5B27 A;  1ICN A;  2X4M A;  2C4I A;  4GDZ A;  2MWH A;  3CWK A;  1STS B;  3CQR A;  1YWD A;  4BX5 A;  3FEK A;  1GKA B;  4OS0 A;  1AB0 A;  2MHD A;  4TKH A;  2YG2 A;  1RST B;  3BS2 A;  1LF7 A;  1QFV A;  4IBA A;  2RTD B;  2VFB A;  1EPA A;  5D45 A;  5HA0 A;  4ORR A;  1Y53 X;  2JU3 A;  2XST A;  3APV A;  5LKF A;  1MUP A;  3RDQ A;  4YGG A;  4BCS A;  4BX7 B;  1GX8 A;  2HMB A;  3P6D A;  3VG5 A;  4QYN A;  2WEX A;  1FEN A;  3BLG A;  1LIE A;  4ODD A;  4DQ4 A;  4EFG A;  2BLG A;  5HZ8 A;  2BS5 A;  2JU7 A;  1QG5 A;  3TGC A;  4BOE A;  5L3Y A;  3TF6 A;  3L4R A;  1GKA A;  1IKE A;  4XMH A;  4LKT A;  1FEM A;  1DZK A;  2HKD A;  4BVM A;  4EQA C;  1D3S A;  1SXU A;  1LPJ A;  5HCD C;  1N43 A;  1SWA A;  3DSZ A;  2W2A A;  3NPO A;  1X8U A;  1GGL A;  1VWO B;  4O49 A;  5LJG A;  5HZ6 A;  1SLD B;  5HA1 A;  1SRI A;  1AVG I;  4Z28 A;  2OZQ A;  3C77 X;  4A8Z A;  1KFF A;  5L8I A;  1JJJ A;  2HZQ A;  3B2J A;  4CDE A;  1SY3 A;  2X45 A;  3UEW A;  4HPA A;  1MX7 A;  4MVE A;  2JGS A;  3FEL A;  1GT1 A;  1LEL A;  1ML7 A;  1ALB A;  4BJ8 A;  1HMR A;  1EPB A;  4IB9 A;  1S2P A;  1KZW A;  4XME A;  1X8Q A;  1STP A;  4Z2P A;  1Y55 X;  4ARH A;  2QMI A;  2CM9 A;  1G5W A;  2A13 A;  3RE5 A;  2IZD B;  4ON1 A;  1X8P A;  3O2Y A;  5D4A A;  4EDE A;  3T2W A;  3KFH A;  2FKG A;  2RA6 A;  3P6E A;  3PDF A;  1JV4 A;  4Z27 A;  5LJH A;  1OPB A;  2RTC B;  4IB6 A;  4NP1 A;  5H9L A;  3EW1 A;  2WWP A;  3NP1 A;  2WUT A;  1HXZ A;  1I78 A;  1HN2 A;  4WBK A;  1VWB B;  3SLJ A;  4I6S A;  1DF3 A;  1ZNE A;  1RLB E;  2XKL A;  1ICM A;  4INN A;  5D8J A;  5AQ6 A;  3ZW0 B;  1OBP A;  3NX2 A;  3APX A;  2X55 A;  1JJU A;  2Z4I A;  5IRW A;  3OD9 A;  1JJX A;  2A5C A;  2LB6 A;  4I9R A;  4QNI A;  2OY1 O;  1BM5 A;  5FQ8 E;  4U8U O;  3WZO A;  3T6F A;  3ZW1 A;  4WFU A;  2RTA A;  4NW4 A;  1JBH A;  3VE2 A;  3FR4 A;  4QRL A;  1NGL A;  1QY0 A;  3I0A A;  1YP7 A;  3WYQ A;  3PK2 A;  2G79 A;  3PQU A;  4FBO A;  1I05 A;  1URE A;  4YKM A;  4A1Y A;  4ZFX A;  3SZJ A;  4I3D A;  1YUP A;  3BDR A;  3P24 A;  5FEN A;  2MJI A;  3PQS A;  2FS7 A;  3F8A A;  2FHN X;  1CBR A;  3FEP A;  1ADL A;  3ZW0 A;  2F09 A;  2NNE A;  5H8T A;  1NC9 A;  5HTE A;  1VWC B;  3F9D A;  4GKC A;  4M6S A;  1SWL A;  3UAQ A;  1NP4 A;  1KZX A;  3CBS A;  2DJG A;  5K68 A;  2RTE B;  1VYG A;  5FFH A;  5KID A;  3B2L A;  3MG5 A;  3ZWE A;  2CBR A;  2FS6 A;  3PH6 A;  2UZ2 A;  2GJ5 A;  4OMX A;  2CBS A;  4YGH A;  3WJC A;  2ACO A;  2F01 A;  1VWN B;  2DJF A;  3MBT A;  4GH7 A;  4ML7 B;  3CMP A;  3P6C A;  4OS3 A;  3RY2 A;  4MIR A;  1G74 A;  4BX6 A;  3FR5 A;  3OBL A;  3STM X;  2MM3 A;  3X00 A;  4YBU A;  1UZ2 X;  1YP6 A;  1O8V A;  5BVQ A;  1VWQ B;  5D47 A;  5LJC A;  4M7M A;  5AEO A;  2UYW A;  4JO6 A;  5CSE A;  2IZE B;  3P6G A;  2OFA A;  1R0U A;  4HFO A;  3K3L A;  4GRJ A;  1KQW A;  3RBY A;  2PI3 O;  4XMF A;  1B56 A;  1LIF A;  1ZNL A;  5JD2 A;  4RUU A;  5HZQ A;  2GH7 A;  1YWC A;  3NX1 A;  5B11 O;  3VPJ E;  2GTL M;  2RCQ A;  2X46 A;  4O4S A;  3FW4 A;  2IZB A;  4NNS A;  2FRS A;  2NND A;  4BX5 B;  1RAV A;  4HWM A;  1X8O A;  1KGL A;  1HMT A;  4IMO A;  2R56 A;  3OE3 A;  1SRJ A;  1SXY A;  4GZV A;  3SAO A;  4O4U A;  3DTQ A;  1SLE B;  2Y3F A;  4GUZ A;  3SLT A;  1VPR A;  2Q39 A;  3BRN A;  1SWD A;  2KD2 A;  3B2K A;  4O3Z A;  3AKN A;  4NV7 A;  4ORW A;  5HTD A;  3VG6 A;  1SRG A;  2YMS A;  3BU1 A;  5F6B A;  3D9W A;  3EC5 A;  4ZH9 A;  4ALB A;  3CQN A;  4D6B A;  1MDC A;  1SRF A;  2IZH B;  1PBY A;  4BGF A;  1MVG A;  1OEJ A;  1SY2 A;  1LCV A;  3FEN A;  1SXX A;  1D2U A;  1MEP A;  5FAZ A;  4N7C A;  4EXZ A;  4A60 A;  2AT8 X;  4YDB A;  3STN A;  2ZAI A;  1XCA A;  3EM0 A;  4YFR A;  2KW1 A;  5HAE A;  2WQA E;  2RTG B;  4NYQ A;  1EI5 A;  3EW2 A;  1O1V A;  1WBI A;  1N7Y A;  4WHI A;  2I5Z O;  2WR6 A;  3WJG A;  1SMP I;  1LID A;  4QGW A;  4YH0 A;  3FA9 A;  4BQU A;  3BX7 A;  1O1U A;  2ALL X;  1TXL A;  3ELX A;  1B8E A;  3KVN A;  1Y0G A;  5LJB A;  1W4T A;  3ELZ A;  2R73 A;  3NQK A;  5DPQ A;  3U9P C;  2IZI A;  5HWZ A;  3VHM A;  1STR B;  2IZG B;  4IRW A;  1IFB A;  1K3B A;  3SZI A;  2OY7 A;  2QM9 A;  3WXQ A;  3VHI A;  1GM6 A;  5B10 O;  4YVB A;  2RTR B;  2QCB A;  2KTS A;  3KFI A;  3NAD A;  1FEL A;  3LV4 A;  5EDB A;  4AZN A;  3LTW A;  1VWJ B;  3NBX X;  2AKQ A;  1NQN A;  1OBQ A;  4YBP A;  3VG2 A;  1MK5 A;  3HPE A;  5EDC A;  1EW3 A;  4RUN A;  2QO4 A;  4ZJ0 A;  3CBC A;  1BWY A;  4IAX A;  1I06 A;  1OEK A;  4U3Q A;  3FMZ A;  4QQ1 A;  5B29 A;  4MVK A;  4QZU A;  3ZUO A;  2FR2 A;  2PY1 A;  2AT3 X;  2AT6 X;  3AUM O;  1DFV A;  4QGV A;  5CHK A;  1SWQ A;  2IZF B;  3S60 A;  3ZW1 B;  2FKJ A;  1P6P A;  1IFC A;  4NYR A;  1CBI A;  1U18 A;  1SRH A;  2QO5 A;  3FW5 A;  4UU2 A;  1CJ5 A;  5K06 A;  4XMC A;  4UU3 A;  2P8G A;  4XMG A;  1NBX A;  1E2T A;  4I60 A;  4PSQ A;  4AZM A;  2RTP B;  2AH7 X;  5HZ9 A;  1DZM A;  1JQP A;  1RXK A;  1SWN A;  1E02 A;  1LCW A;  2CAM A;  3O19 A;  4IAB A;  4LQZ A;  2X56 A;  3H3I A;  3VG3 A;  3S5V A;  1ERX A;  1KT5 A;  3OJY C;  3WJE A;  3C78 X;  2RTO B;  1E00 A;  4GK9 A;  1RSU B;  1JIW I;  4O3W A;  2C1Q A;  1PTS A;  2L5P A;  5KIC A;  1QY2 A;  1VWE B; 
#chains in the Genus database with same CATH homology
 1KL5 A;  1VWH B;  1SLG B;  3X00 A;  2IZK A;  1HQQ A;  1MM9 A;  1SWG A;  3RY1 A;  4CPH A;  1VWQ B;  3FDC A;  4Z6J A;  1AVE A;  1SWJ A;  2RTJ A;  1HXL A;  2UYW A;  4JO6 A;  5CSE A;  2IZE B;  4BX6 B;  3WZP A;  2C1S A;  2MF6 A;  1I9H A;  1VYO A;  2C4I A;  3WZQ A;  2OFA A;  5IRU A;  2RTF B;  4GGT A;  1DF8 A;  1STS B;  4BX5 A;  4CPH B;  1LDQ A;  1SLF B;  5JD2 A;  4U46 A;  4BX7 A;  1RST B;  2GH7 A;  2RTD B;  1LUQ A;  1N4J A;  2A8G A;  2IZB A;  2Y3E A;  5IRA A;  3RDX A;  4BX5 B;  2RTK A;  1RAV A;  3RDS A;  1Y53 X;  3RDQ A;  4BCS A;  2G5L A;  4JNJ A;  4BX7 B;  3RDO A;  4Z2O A;  1SRJ A;  1VWD B;  4GD9 A;  1Y52 X;  4GJS A;  3RDU A;  1SWE A;  1SLE B;  4JHQ A;  2OF8 A;  2Y3F A;  4GDA A;  1VWL B;  1IJ8 A;  1SWD A;  5L3Y A;  4GGZ A;  1SWF A;  3T2X A;  2BC3 A;  1SRG A;  1SWU A;  1VWR B;  4CPE A;  1SRF A;  1SWB A;  1N43 A;  1SWA A;  2ZSC A;  5K67 A;  5B5F A;  2IZH B;  1VWO B;  1LCV A;  1SLD B;  4Z28 A;  1SRI A;  1KFF A;  2RTL A;  1MEP A;  1VWM B;  2Y32 A;  2JGS A;  1LEL A;  1LDO A;  4BJ8 A;  1VWA B;  2RTG B;  4GGR A;  3EW2 A;  3RDM A;  3MM0 A;  3T6L A;  1STP A;  1WBI A;  1Y55 X;  1SWS A;  2RTM A;  4Z2P A;  1N7Y A;  1VWP B;  1LCZ A;  3RE5 A;  1N9Y A;  2IZD B;  3WYP A;  2IZC B;  3T2W A;  4Y59 A;  2A5B A;  1SWH A;  2RTI B;  4Z27 A;  2RTC B;  3EW1 A;  2OF9 A;  1KL4 A;  1SWR A;  4EKV A;  4OKA A;  1HXZ A;  2IZI A;  3VHM A;  1STR B;  2IZG B;  2WPU A;  4IRW A;  1RXH A;  1VWB B;  2RTH B;  2RTB B;  3VHI A;  4YVB A;  1VWI B;  2RTR B;  2QCB A;  5F2B A;  3RE6 A;  5IRW A;  1VWJ B;  2A5C A;  4GJV A;  1HY2 A;  1NQN A;  1MOY A;  1RXJ A;  1SRE A;  3WZO A;  4DNE A;  3T6F A;  1MK5 A;  1VWF B;  2FHL A;  2RTA A;  1N9M A;  4Y5D A;  1SWP A;  4Z2V A;  3WYQ A;  2AVI A;  3PK2 A;  5B5G A;  2OFB A;  1NQM A;  1SWC A;  1VWG B;  1SWO A;  5CHK A;  1SWQ A;  2IZF B;  3SZJ A;  1VWK B;  2RTQ B;  3SZI A;  1KL3 A;  3SZH A;  1NDJ A;  1SRH A;  3VHH A;  2FHN X;  1SWK A;  1NBX A;  2IZA A;  1NC9 A;  4I60 A;  1AVD A;  2RTP B;  3WZN A;  1VWC B;  1RXK A;  2CAM A;  1SWN A;  1LCW A;  1SWL A;  2IZJ A;  2IZL B;  5K68 A;  2RTE B;  2RTN B;  3MG5 A;  3VGW A;  2UZ2 A;  4CPF A;  2RTO B;  4BBO A;  2F01 A;  1VWN B;  1RSU B;  1SWT A;  2C1Q A;  1PTS A;  3RY2 A;  4CPI A;  4BX6 A;  1VWE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...