2A5GA

Cholera toxin a1 subunit bound to arf6(q67l)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
b'KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
total genus 53
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5gA00
2KBFA 2LKCA 4DUGA 2ECKA 3HR8A 3A1VA 3EC1A 2GZHA 1TADA 5TY0A 5J4VA 1M7HA 1ZD9A 4PSVA 3TQCA 1XTIA 1YZGA 4M1WA 4V03A 4ZDKA 4PPQA 3REFA 3KFVA 4JKYA 1FOEB 4H1UA 4OBEA 5E4FA 5HZHA 3NBZC 1E1QD 2GK6A 1U2RA 4DCNA 2FA9A 3VKHA 1QHGA 2DWPA 2KE5A 5AUOB 3B9PA 4D0NA 1Q57A 1DO0A 4P33A 3G5UA 1HURA 1WQ1R 3SFVA 4BLTA 5SZHB 3EPHA 2OHFA 3THXB 4D25A 1OIVA 2JLQA 2H1LA 2OFXA 4LBYA 1IJEA 4P4TA 3EPKA 4TQAA 5F2EA 4I1OA 3QXJA 1R0YA 1RPZA 2VL7A 4ITRC 1KAGA 4ERNA 3WNCA 2P65A 4NL4H 3AKCA 4DBLC 4JLAA 4NYJQ 4NYJR 2UZ3A 1NSTA 2J7KA 4HZIA 5J4YA 4QOSA 1FW6A 1S4QA 4CEJA 4BFXA 3W5JA 2I1VB 1A82A 1IBRA 2FNAA 4HATA 2NGRA 1LS6A 2SHKA 4TN1A 3O8DA 4W7SA 5BN4A 3THXA 3R9WA 2JLWA 4KI0A 5B57C 3BFKA 3FMFA 1P2TA 1CRQA 3W5IA 3AP2A 1W36B 1FMJA 3FWYA 4IVQA 1VECA 3C15C 4X8HA 3TSWA 1M7BA 2WTUA 5JRZA 1JB1A 1KDRA 2E1RA 1IXSB 1E99A 4QJ5A 3NTUA 4ILEA 4WOPA 1N6HA 1J8YF 2GA8A 4XTCS 3FOZA 3ADBA 1GL9B 3ZQ6A 2CLCX 3VTKA 4OJQA 1U94A 1NBMD 1V43A 3KZ1E 1MKYA 2EFGA 4CT5A 4XSGA 2FEMA 2ATXA 2P6UA 4B47A 1EFRD 3UATA 2WWXA 4PO9A 1A2KC 1YQTA 2R65A 4ZO4A 3P4XA 2HXSA 2V1XA 4MYTA 2ZRFA 3CH5A 2YVUA 4PZLA 1LS1A 3I8SA 2XAUA 2Q9CA 2PZEA 3I4LA 4WBSA 3ZVNA 1QRAA 1N6LA 4HB4A 1Z6GA 2ZE8A 3AUYA 2DFNA 2V7QD 4PX9A 1GFIA 2BMJA 4HDQB 4BFTA 5LDDC 2A30A 4XD7A 3PR1A 2WMOB 1NVUQ 1VHTA 4LJ4A 1Z5ZA 4A0RA 1KI1A 2F1HA 4QBHA 4ESHA 3AF0A 3PXGA 2ZE6A 2AK3A 5L3VA 4GNKA 3QEOA 2PX0A 4M9QA 5JS8A 3B13B 3P4YA 1ZCBA 2V8OA 1CBUA 4TMWA 4V0ME 1N0UA 2AK2A 2J5XA 2Q9AA 1WBDA 1L2TA 3EA0A 4S35A 2GZAA 3CBQA 4TL8A 2QTVB 5LBIA 2BCJQ 1M6NA 1MH1A 3VR2A 4QM6A 1Y3AA 1CJUC 3QOFA 2WJYA 2C9OA 2VEDA 4FCVA 5HKKA 3CX8A 3O47A 1NY6A 1AKEA 3MJRA 3LLMA 2KWIA 3ZGXA 1NVWQ 3IO5A 4I1VA 4OHVA 1EFCA 1JNYA 4Q02A 4CDGA 2Y8EA 1JR3E 4V0NA 3AVPA 3HPQA 3LQQA 1Q22A 3MWJA 4HUQB 2VH5R 2IYQA 1AS2A 3HR7A 5B64A 1ETUA 4LDJA 2QU8A 1H8EA 2DFTA 4GSYA 2WJIA 1X6VA 4JL8A 3BH7A 3B9QA 5FPSA 5FPKA 1UBGA 3R8CA 5JEDA 3MD0A 4TQUS 2KSQA 4Q9HA 5FTJA 1KGDA 4KFSA 2JLRA 2WWWA 2HT1A 4BLSA 3LWNA 2PZGA 3KQHA 1XPRA 3GCGA 1TF2A 1AS3A 2ZJ2A 3C14C 3ZD7A 3U4QA 2ZM5A 1RKBA 1UM8A 5FUXA 4V0KA 1Q12A 4HAXA 2OBLA 3JZMA 2VIIA 1SULA 2QM7A 3DMNA 3KXLA 1BMFA 3QPVA 5DN6A 1OKKD 1OFTA 5JSZB 3GP8A 4ZKDA 3LAWA 4FMDB 3L2OB 2H18A 1KMHA 1G6OA 4HLDA 5SZJA 1JJ7A 4RD3A 4Q01A 2IF2A 3V9PA 1UBEA 1WP9A 5H70A 4A8JB 1XTQA 2G83A 2QMOA 3MWLA 3I62A 2HF9A 2WSMA 3CPEA 3MCAA 4JIMA 3RNLA 3LY5A 1N2CE 4NBSA 4DEYA 2HEIA 1E79D 1PZNA 1T91A 1CLUA 3B7GA 5DLQC 2QZ4A 4Z8YA 4BFYA 3AVTA 2XX3A 2O8EA 4XTRA 4BPBA 3NG1A 2PZFA 5KDOA 3GLIA 3CZQA 4JL5A 3FMIA 2V54A 1TQ6A 4KVAA 1VIYA 3TW4A 1TTTA 2IYTA 4GDFA 4CT4B 2XITA 3K0CC 1N5KA 3RRNA 1OW3B 4C4PA 3ADCA 1LFDB 1YZQA 2F1RA 2K5UA 1GL6A 1CXZA 2B6HA 4YMSA 1G21E 2QAGB 2YINC 3LFUA 5EJEA 1ZMXA 1L8QA 4LHVA 4R2IA 2AWOA 3T1QA 4US2R 4WXRA 1EK0A 2C95A 2H7VA 1NJFA 1OF1A 1RRFA 4HZUB 4JLOA 4D2IA 1E1RD 3CUEF 3RVBA 3C4JA 3SJAA 1R2QA 3K0AB 1RRPA 4HI0E 2ZS9A 2R8RA 4TLDA 1UBCA 3PG5A 3ZIAD 5J5CA 5CB6A 1IAQA 3WXMA 4A9AA 1N5IA 4IDNA 3VR1A 4B32A 5C4GB 4EIWA 4RFSB 3GMTA 3CIOA 4MUBA 3NEYA 3K70D 1BYUA 3NXSA 3AGPA 1VDZA 4B74A 3T1TA 4TL9A 3BD9A 1XF9A 4N0DA 2WJGA 2X2EA 1UAAA 2EYUA 3A1SA 2VHQA 3FVQA 4D4JA 3GPLA 3RABA 5BQ5A 1KSFX 2BWJA 4HLCA 3NH9A 5SZKB 3T35A 4E03A 3SFZA 3U7FB 1NN5A 1NKTA 3QF4B 1PVOA 3ZD6A 3OFNA 3W8RA 2WWYA 2J45A 4RFSA 4Z51A 3KX2A 4MKHA 3AVWA 1CKEA 1W2HA 1V5WA 3FHOA 4HSEA 5TVKA 3LO5A 1DARA 3I1FA 4UXHA 3A58B 5KHOC 1GL7A 3GLHB 2XZPA 3X1XA 2MMCA 2RGAA 4KO8A 5FOUA 2Z0MA 1I2DA 4WW0A 1KDOA 2QPTA 3AGQA 1QVRA 1NBME 1XMVA 2BIFA 4C0QC 5E3HA 2I3BA 2ONKA 3K0EA 4U02A 4X8MA 1SGWA 1HA3A 3QKUA 3PUVA 3SJCA 4RD0A 2P2LA 5JRJA 2O5VA 1HQYE 4PXAA 1IJFA 1SKYB 2ZRNA 3EZ7A 4H1VA 4ZIRA 1KAOA 5AWFC 1G291 1AKYA 2G0NA 3LW7A 4RZ2A 1H8HA 5CIQA 3K9NA 3GLGB 4Q7KA 1SXJA 3WY9A 3KQNA 2XXAB 3GJ8A 1IN5A 1EX6A 4WAUA 5BN5A 1IN8A 3TGPA 5H1YA 1EWQA 4LOAA 1RIFA 3RS5A 3AUXA 2HYIC 1HYQA 3THYB 521PA 5CM8B 4POAA 3I5YA 1KO4A 2ZJYA 4JT4A 4KBFA 121PA 3IPYA 1W4RA 3K53A 3B8HA 2PCLA 2Q0HA 1VYVA 1U9IA 2V4ZA 2ZUDA 2RGCA 2FEOA 1K5DA 3K09C 2BDTA 1MO5A 1W0JA 5FUVA 1DAFA 1F48A 2QAJA 4NTZA 2CJWA 3D3QA 4KLNA 1VTKA 2XXAA 3B1WA 2B92A 4UXJA 5FI0B 4DCSA 3EARA 4Q19A 4F4JA 4BLRA 3VNVA 3QXCA 4C0SA 2CK3A 3KFXA 1II9A 2BBTA 2C9YA 2HCJB 1ANKA 3IBYA 3ICEA 4ESVA 2ZSDA 1CF4A 1EFUA 1OXTA 4D4LA 4US0R 1XWIA 4AYXA 2UKDA 3CB4A 3I72A 5EP3A 3WNBA 1NG9A 1YE8A 1IY0A 4CEIA 1KO7A 5FL7A 1KI2A 3FB4A 4OJKA 3GLFE 4DEXA 4Z1MD 1N3BA 3I73A 1Q1ZA 3TKLA 3OEED 4DC9A 1TUEA 3K1JA 3W90A 2XTMA 2QRNA 2J0QA 1M7GA 2DPXA 1E6CA 4I4LA 1WDTA 1S9DA 3OHMA 2ANBA 1KI7A 4RD4A 5J47A 3GLHE 3R8FA 4BGDA 4LPSA 5GJVC 3EXAA 1Q44A 1CJKC 2OEPA 2WAYA 1S2MA 4GMDA 1P9NA 2GF0A 3U7HB 1MR3F 2FFAA 5DI9A 1OXSC 1AK2A 2BVNA 2BCGY 3GFTA 4JBXA 4FWIB 1E2JA 4OI1A 2B21A 2R6DA 4CYMA 4G5RA 4OK3A 1YVDA 1G64A 1T9HA 3K0FB 3HU2A 1FP6A 1UKVY 2NO6A 3QPUA 4DZZA 1CR1A 2RGEA 3K70B 3GLGE 4JVLA 2NMVA 2GCNA 1Z0IA 2QP4A 3LXRA 1BS1A 4QM7A 2JEOA 1GOTA 3IBGA 4PC1A 3VFDA 4A0FA 4CRWB 2CMKA 1RW4A 4ACAA 5HZKA 2IXGA 3PITA 3DZ8A 5EUMA 2VF7A 5C2JB 1TQ2A 3X1YA 2J1LA 2CEAA 1QHHB 2GDJA 3EZFA 3QPWA 4UJ3A 3P20A 1DG3A 3A4MA 5FOVA 3KUDA 1QBKC 3LBIA 4HLQB 1GNQA 2XJ9A 4Q7JB 4FN5A 1S1CA 1ZNZA 2YC4C 3MWKA 4KXFB 1PUIA 1R0XA 4KFUA 3CRRA 5IRCD 5DNYB 2Z43A 2OLKA 2QRZA 2FPLA 3K8YA 2Z4RA 1AGPA 5BWMA 1BOFA 1E69A 4I1SA 3TIFA 4DLXA 1NKSA 4BRWA 1T5LA 3ASYA 4Q03A 4B2IA 1YHNA 3DMDA 2VF8A 4M1KA 3BK7A 4GZMA 1Z07A 3TSZA 3O8BA 4BLQA 1R5BA 4IRUB 1KKLA 2GVZC 3SYNA 3S1AB 3G0HA 4OI0A 4RKEA 1JXOA 1Z8FA 3KJGA 3AKYA 5JFGA 3FKSD 1HV8A 2W58A 2F7SA 3Q8XB 3SQXA 1DE0A 3KB1A 1ZM7A 2IUTA 5HTKA 4EUNA 2CVFA 4IFBA 2GTPA 3RS2A 2JLVA 3TUZC 3EIEA 1GWNA 1JPNA 2IBMA 4D82A 2ASEA 4NPHA 1WBBA 1CULC 2QORA 5M04A 4IFEA 1VIAA 2AR7A 3BB1A 1MO6A 3BOSA 1C1YA 4KSCA 4DHEA 1DBSA 3RSOA 3B2EA 5FTNA 3IGFA 4HYYA 2VP5A 5E7JA 2V3CC 4OQLA 2GHIA 3T34A 2JIZA 4UNQA 4URZR 5J4HA 4HAVA 4JYCA 3SNHA 3GJ3A 2VP4A 1WCV1 3W9YA 1OV4A 3UK6A 2IYLD 3KKPA 4FMCB 2JJ2D 1J2JA 2VRWA 1A4RA 2XSZD 3EASA 3ZJYA 4JVSB 1Z08A 4TYQA 2IS1A 3CLVA 4CGZA 4TLBA 2CCJA 3DZDA 2D7CA 3ZZTA 1W4CA 4JSYA 1D8TA 2E9SA 4C2UA 5K8IA 4PQRA 3FMPB 1P6XA 2WWIA 1FX0A 1GZSA 2GEUA 3U3KA 4EQ6B 4A92A 3FYHA 4TT3A 3L0SA 1W46A 3BERA 4K81B 2BBOA 5FOWA 2QP9X 4LC0A 4CZ2A 4BZXA 1NP6A 4LJ5A 2EYQA 4YXWA 4EFLA 1JPJA 1HT1E 4RZUA 1XDBA 3B1VA 2HCBA 2GJAA 4IDHA 1D2NA 2PX3A 4E5UA 1U81A 4LYFA 1XTSA 1U0HC 3BC1A 1DOAA 3T5GA 1GRNA 2JCSA 3B1YA 5EZ6B 1TQDA 3BB3A 1Z0JA 1UEJA 1DAIA 4G5GA 3UMFA 4JS0A 1CU1A 1YR8A 1P61B 1MOZA 3IO3A 4P4SA 4PHFA 2A5YB 3VNUA 1HH4A 1QG2A 1ZCAA 4W5JA 3LQRA 4D4KA 2ZYTX 1OXXK 2JJ1A 2VTKA 1E2HA 1N25A 2GAOA 4TMKA 2J46A 4JLKA 3BJIC 3CNOA 2ZU0C 3LBHA 1KKMA 3AF1A 2PLRA 2IXEA 5EUQB 4D4MA 4TZ6A 1T3LA 4DDTA 2QE7D 2F3TA 1RYFA 2O0KA 2YWHA 4JZKA 4DCVA 1KNXA 2ZSFA 1VG8A 2GXQA 3A36A 3OE7A 1AN0A 5IK2A 3VHXA 1XTJA 4QC2A 4QXAA 4BWYA 4B3XA 4LV8B 4YDSA 1OH8A 3QVVA 3QUSA 4DIDA 3BH6A 1ZM9A 3HPRA 4F91B 1N6OA 2QBYA 5KO2A 1G8GA 3BRWD 4QGAA 1CIPA 4F7WA 2V6IA 3VR4A 4LGMA 2GJ9A 3U6KA 3AF3A 1KK3A 1SVWA 2HJVA 4EKDA 3ZDQA 2XZOA 3CNLA 5FOSA 1HEIA 4EJSA 4PO8A 4ZCLA 2IXFA 3LNCA 2F6RA 1W5TA 2D62A 3P1JA 2ZYWX 4X8OA 2D3WA 4DCUA 2RKOA 5L3QA 1HQCA 4OQMA 1XTKA 3HYRA 4LHWA 2NZJA 2FOLA 3BH0A 1XXHB 3U3RA 1N5JA 1E9SA 2CNWA 4N3NA 3L0PA 4TMTA 4HDOB 3C5HA 4NYIQ 2NTYC 4NYIR 1E9DA 1KNQA 4DLUA 2N42A 3TJZA 1G6HA 3UXMA 4MQBA 2OSBA 2DYKA 4BE7B 2OCYC 4KVGA 1YR7A 721PA 1TEVA 3SEAA 1U90A 2BBWA 3KQLA 4LBVA 4PAMA 2IYRA 4BFZA 1EWRA 1RRCA 4PPFA 1MABB 4M9ZA 2CE7A 3ZLJA 1IXRC 2WSSA 2FFBA 5KNCA 3J81k 4ACBA 4AYTA 4P4UA 4B71A 1E9FA 1U8ZA 2WOJA 3RWOA 2WJVA 3OAAA 1YJ5A 5EXPA 4C7OB 1RYHA 2ZQ5A 4DJTA 1WE2A 1E4VA 1HE1C 1G7CA 2C9CA 2ZRPA 4MGIR 4QGGA 4TTRA 4UXIA 1UPTA 5DI3B 3GFOA 2ANCA 3ONWA 1ZUHA 3KQKA 2BJVA 2C96A 3DO6A 2QEQA 5JJLA 3U7GA 2WM9B 1OE0A 4M9XA 5CLQA 2WICA 2IW3A 3KDSE 1F60A 1R4AA 4PHGA 1XMIA 4W5WA 4JJKA 2GEDA 3PEWA 4TYYA 2EFHB 3FPAA 4LRWA 3RAPR 3IPXA 2RH5A 3DVLA 4AIIA 2ZI4A 4FXPA 5EE5B 3U2QA 4C30A 4G01B 1UKZA 3T1VA 4II7A 2IEZA 3AP1A 5DI3A 2RGNA 1P5ZB 4TMVA 1OYWA 5BYJA 2W00A 5CYOA 4B3CA 1BMFD 1SKQA 2F1IA 4HLUA 1U8YA 1IY1A 3BS4A 1KJWA 1T0HB 4URVR 1ELOA 5AJXA 2IYYA 2C77A 2PMDA 2XOKD 4B33A 5GJBA 1SVSA 2H17A 1KIMA 1LV7A 3I8XA 4V0MA 4MITA 5F9HA 1PJRA 3NBXX 2ZRDA 1T4GA 1P2UA 3GQBA 1XXHE 3RS0A 2QUZA 1CP2A 1W2GA 4JYBA 5SZIA 1IM2A 4A2PA 4IW3B 4QG7A 4PQYA 3NBYC 4LBZA 3W6OA 4C9BA 4MGZR 4TWZA 3W6NA 1Z6YA 3FGNA 1JI0A 3BB4A 1HUQA 1RC8A 1A1VA 3WHLA 1G7TA 2O0JA 1XCMA 2IT1A 3PUYA 4Q4LA 2HF8A 1DG1G 1KI6B 2BC9A 2BMFA 1JR3A 3UWKA 2G1KA 5JBQA 5KPJA 1Z22A 2IYSA 4DVGA 4Q9KA 2RMKA 1EFTA 2GNOA 2W0MA 3ND9A 4LSGA 2EFCB 1G3MA 1P60A 3G82C 4FW9A 3N70A 2Z5FA 2PH1A 2BMEA 1I4DD 4MUAA 3SN6A 3Q9LA 2C99A 1AIPA 4F38A 2KBEA 5TMPA 1NVVR 2NPIA 2YWGA 4MRNA 4RD6A 4ABYA 5GJWC 1ZUIA 3F3YA 1XD8A 4Q1FA 1N0VC 2ZXUA 1DAKA 5TV2A 3DOFA 1XB2A 3MWYW 2QTHA 4F4IA 3EIQA 1YU9A 2R9VA 4NONA 4UNSA 3EW9A 3SYKA 1YRBA 4FMDF 4LYAA 3SZRA 2J0UB 1OFIA 1S0UA 5AJVB 4B3BA 1T8UA 5ELXA 3JVUA 3CPJB 2ODNA 5L3RA 2KI5A 1KYIA 2OUKA 2EVWX 1M74A 3K9LA 3V4RA 2A5FA 4B2PA 3CF0A 4TSFA 4LJYA 4PSAA 4B6FA 2Z4SA 1G3QA 3PEUA 4Z8XA 1W0KD 2BKEA 4DLWA 4EDHA 1UDWA 1OHHD 2V6JA 1N6PA 2IYUA 3Q3JB 1I4LD 2QNRA 3D8BA 4DRZA 4PC6A 5C18A 4C0HA 1KY2A 2OCAA 3EX7C 3LX8A 2O8CB 1JECA 1SVOA 1P2SA 4Q9JA 3IIMA 5HR5A 1YZLA 5DYGA 2D2FA 2OLJA 3CONA 2G77B 1CRPA 2WWFA 3Q7QA 2P3SA 1GKIA 3LVQE 4UJ5A 2NO9A 2CVHA 3KKQA 1COWA 1E2QA 3SR0A 3VR3A 1VYUA 2IUSA 2ZUBA 4PC2A 5EE1A 5EE3A 1E1QA 4HUQA 1T3SA 2LKDA 1KK1A 1GTVA 1CJMA 4XSHA 3VKWA 1DTSA 1H8HD 1NN1A 2QGNA 4LWZA 5HE8A 2AN9A 3IDQA 1SXJD 4IXMA 2EU8A 2R6CA 2PT5A 4E22A 1E0JA 5FL3A 2REBA 4OQFA 2O8BB 1EXMA 1GIAA 4TMXA 2ZS7A 2W6JD 1G3IA 2R44A 3TR0A 1GP2A 1JR6A 1OB2A 2GRJA 5CJPA 3TLXA 1LF0A 3CRQA 4C0KA 4DSNA 3TQFA 1UADA 3QXHA 4LJ7A 2QI9C 4QBFA 2ZTSA 1AGRA 2FWRA 3F5FA 4LYJA 2IWRA 1P75A 4V02A 4C0JA 5GJCA 2P5TB 2JLYA 2CK3D 2OM2A 1XEXB 3QKSB 5JSZA 2FF7A 2Z6VA 4BRUA 4KBGA 2FGKA 4WXPA 1ZM4A 2CBZA 2LCFA 3WRXC 5FTLA 1AS0A 2AXNA 3LX5A 2QG6A 3C8UA 1Z83A 2OCBA 1ZBDA 3GJ0A 2EQBA 2OXCA 4K8OA 4MH0R 1E2NA 4A8JA 5BXQC 5FL7D 5KYKA 3CF2A 4IOKA 4ZV4A 4CVNA 1XCPA 1BH2A 2CHVA 4GL2A 1D5CA 1Q3HA 2O0HA 4HUTA 5KNDA 5JMTA 3QKRB 3T5DA 3VR6A 1IXZA 4P0TA 1QHXA 4OI4A 3CX7A 4JT2A 3A1WA 4A1FA 5E7MA 4PO1A 1NBMA 2ZJOA 4D0GA 5CB8A 4TYPA 1C9KA 3HJNA 2DBYA 1D6JA 4EPVA 1E2FA 2WHXA 4PHHA 1FTNA 5LB4A 1Z6XA 2ZAMA 2GILA 4QBGB 2C2HA 4XJXA 2ATVA 2Q21A 2W83A 4YLGA 2QAGA 2FFQA 2X8AA 2BM0A 1VG9B 3Q7PA 4XIGS 2ZREA 3CPHA 3MGCA 1CR0A 5CDFA 4AKEA 2V7QA 3BWDD 4BZQA 4HZUA 4B73A 4RCYA 2A78A 4A4DA 3DOEA 1AA9A 5AUQA 2CHQA 4G3XA 4B6EA 1F2TB 5FBWB 4LHXA 3K0AA 3FHTA 2C03A 5DE3A 4RD2A 2Q3HA 3L8ZA 4HB3A 5JHHB 1G9XA 4B76A 3IEVA 2I4IA 3KUCA 4AI6A 3GLFB 3EPJA 2YYZA 3I92A 4GP6A 4C0BA 2EFDB 2H8KA 4O2LA 2RGBA 3DKPA 1ZU4A 2R62A 4M22A 4RJLA 4DKXA 4EPTA 2IS6A 4QRHA 1NMZA 3KKOA 1SXJC 1KZ7B 4BEBA 5KUTA 4NCHA 4DT1B 1XRJA 1Z6TA 4QHYA 1J90A 3OIYA 1UDXA 3UG6A 5TARA 1PLKA 1Q1QA 3M6AA 4ZI3A 3AVQA 4QBIA 1VG1A 2EWWA 2ZJ5A 2VHUA 4JVNA 3D31A 4H9GA 3GLFA 3PFIA 4ASUD 4M1TA 1GRRA 3JZAA 1GNRA 4C0AC 1KI8A 3EWSA 3QF4A 4GOJA 4EAQA 1TF5A 4QHTA 2ZS8A 3RC3A 4NDZA 2DB3A 4Q48A 3SOPA 2A7QA 1F2UB 4KJZA 1ZRHA 3TVDA 4NZYA 3X1WA 1IY2A 2ZRKA 1RJ9B 4HB0A 4DXAA 3NHAA 1YZTA 2IL1A 3KXKA 3LRPA 1E94E 1ZC4A 3GLHA 1FUUA 3ZZUA 3L0OA 4QNRA 1OFHA 3UMSA 1Z47A 2AKAB 2RB4A 4UNRA 1S3GA 1R0ZA 1VCNA 2KJQA 2OBNA 5JJIA 2GZDA 3ZVRA 4NCJA 1CS4C 4Q9LA 3X2SA 3IKJA 1FUKA 1D9XA 1G20E 1J70A 4IOLA 4IEEA 1YZKA 4EPYA 2WV9A 3AP3A 4B35A 3GLGA 1MT0A 2F43B 1LB1B 3UMRA 3AH8A 1XP8A 3DKVA 2FSHA 2R6GA 1LVGA 1G16A 2QY9A 5JS7A 2XZLA 3Q5DA 1OKKA 3THYA 4IHQA 4LPKA 1US8B 2GESA 1AZTA 2W6ID 2ODEA 1U0JA 3GD7A 1S3SA 4M53A 4BFSA 2CL0X 3UKDA 4DWJA 2HT6A 5KSOA 2J9RA 2F3RA 4BUJA 1IN7A 1K6MA 2FFHA 2ZR9A 4MRRA 2QMHA 3VMFA 2P6RA 2OE2A 2HLDD 4BECA 1TAGA 1OB5A 2XB2A 4OHZA 1R5NA 1E79A 4O25A 1NRJB 2OAQ1 3QG5A 3IILA 1QHYA 1SHKA 1G4AE 5J40A 4B3GA 4LHZA 1US8A 1Z2CA 2WKPA 2ZJZA 4NP6A 5E7IA 5EE0A 2YV5A 3DM5A 3WP0A 2XTNA 3F0TA 4OQXA 1Z2AA 1ZINA 3OF5A 3VR5A 4RZXA 1X8KA 4R71A 2BV3A 1X1SA 1P7CA 2ZI9A 2ZRBA 2ZSBA 3CF6R 4U5XA 2ZSEA 5KDLA 2OFOA 4ARZB 1Q1BA 1GKUB 2ZROA 1GVNB 2FE4A 3TSOA 3VU9B 4B2LA 2WKRA 3CX6A 4UQOA 3KB2A 2G6BA 4LHYA 3OIVA 1SXJE 5C4MA 1WF3A 2ZRMA 3QXXA 1T3HA 1HE8B 4OL0A 2ZRGA 3AF2A 1TU4A 2QROA 3AKDA 3C41J 3CKLA 4G1UC 3P32A 5FUWA 4FWTA 3PUWA 2AD5A 3LV8A 5LD2C 1YR9A 2C04A 1WMSA 1ZNYA 3VU9A 1JQLB 3AV0B 1KTVA 3NC0C 3K0FA 3TRFA 4LJ8A 3QBTA 4LCBA 1Z0KA 5EQTA 2UZIR 2C98A 2HV8A 2MSEB 1M8PA 2RGXA 4C2TA 4LI0A 3A6PC 2WJHA 5IK2D 1PLLA 4PPNA 2JDIA 2MSCB 4FMCF 1E98A 5DISB 3VX3A 3LLUA 3KKMA 2X2FA 1E2PA 5H68A 1P4SA 1G1MA 2GK7A 1QHHA 4A15A 2LWIA 2R2AA 3OEHD 3PEVA 4Q00A 1XPOA 4TTQA 5FR1A 3QXSA 2DY1A 3BE4A 4RCZA 1FQKA 4TLEA 2OILA 4EPXA 1KOFA 3DPUA 1RRGA 2B8TA 1KO5A 4HEJA 1ZM2A 3CR7A 4IOJA 3ZVMA 2VQSA 1NLFA 4TTPA 2V1UA 1UKEA 1ZNXA 2QMUA 3BIFA 3U3JA 1OJLA 5TDHA 3Q85A 3NKVA 1ZP6A 1L4YA 2J3EA 4LJAA 1R0WA 3B82A 4KSBA 2GXUA 2PT7A 4AC9A 5DHAA 1M1YE 2IYWA 3MSXA 1OFUX 2YNMA 1KDTA 2FH5B 2WWGA 3IUYA 4PC3A 1NIJA 3ZVLA 3S1AA 3U7EB 1FZQA 4M8NE 1XD2B 4FI3C 4M21A 1FMLA 2J41A 4DUGD 4B75A 4P31A 4G5OA 2BMDA 2WOOA 2QQ0A 1Z06A 3CRVA 3U3OA 3JVVA 2DWQA 4DIEA 1N6IA 3KQUA 1G41A 5CYPA 4QJ4A 4XOIA 2XGJA 3ND8A 4B3FX 3E2IA 4URYR 4MKGA 4I81A 1KDPA 3I3SR 4LJ9A 3K9HA 2QP3A 1MO3A 3RHFA 4TYWA 2IYXA 2IYZA 2VHJA 1Z0DA 2VP9A 4JBWA 2DR3A 1SHZA 4YC7A 3WBJA 4XWAA 3L8YA 1KK0A 5FTMA 2A2ZA 4KV9A 1WXQA 1NMYA 1YRAA 2P6NA 3WMEA 2CDNA 1K5GA 1CTQA 1XNJA 1H65A 3WYGA 4D0LB 3DM9B 1T5IA 2PEYA 2EW1A 3C5CA 4CEHB 4Z1MA 3KL4A 4Q1BA 1BO6A 4Q4HB 2R6AA 1HT2E 1GG2A 3R9XA 1Z0FA 2IA5A 3C16C 1GSIA 2J7PA 4DCTA 3VAAA 1DAHA 1AQUA 2GCOB 2WVJA 4D6PA 3ADDA 1X8LA 1R8SA 5AUPB 2C5LA 4URXR 2J0VA 3MG9A 1G5PA 1EGAA 4EQ6A 2HUPA 1TEXA 2CL6X 4X8LA 2XNDA 5JWHA 5E95A 3GFPA 2YOHA 2KB0A 4NKRA 3U44B 1MRSA 1E2MA 2QENA 1W48A 5EE9A 4BLOA 3DHWC 4DLSA 1NG1A 2J0SA 5FBLB 2HJGA 2IC5A 2MSDB 4O3MA 3EA5A 1SVLA 2GCOA 4EJSC 5EXTA 1Z6AA 4O0MA 2AWNA 2WKQA 1KSJA 1GILA 2ODWA 3W3ZB 2GJSA 3LD9A 4ZDIA 1W36D 4XVRA 3KTAB 3SE0A 3SHFA 1N6KA 2DFKB 4Z54A 3PEYA 4BQSA 2QL6A 2ZANA 5K8LA 3QVUA 3EC2A 2BOVA 4BLPA 4TL7A 1DVRA 1G7SA 2OAP1 4ZCMA 5JWRA 3THWB 1WA5A 2RGGA 4Q4JB 1VG0B 4B44A 1W47A 4OHXA 5FR2A 2F9LA 1ZIOA 2GJ8A 1ZJ6A 4NYMQ 4NYMR 5ANRB 4GZLA 4JLBA 4M4SA 3FMOB 4V0LA 4XD7D 2RGDA 1N0WA 2JLSA 2ZI6A 2ZR0A 4B3DA 3TW8B 2NQ2C 4LK2A 2FDCA 4KYIB 3R7WB 3BFVA 4TYNA 3X1ZA 2ZRHA 2BM1A 1YZUA 4M1MA 3TK1A 3HWSA 8OHMA 3THWA 3UG7A 4Q4JA 1ZYUA 3SS8A 1OIWA 2Q3MA 2IF0A 1OSNA 4I99A 1E32A 3WMGA 4TZ0A 4Q1DA 1SVKA 5G3ZA 5HKKD 2WPDA 4C3ZA 1ONBA 1VMAA 2A5DA 3QEJA 1TMKA 4MRPA 2E87A 5JZVA 1DEKA 4AKIA 1E2DA 2EWVA 4TSFD 1NY5A 1SQ5A 2UVQA 2QSZA 1XXHA 4PR0A 1G8PA 2X1VA 4B34A 4QHSA 4WVFA 1E0SA 3H2YA 4KLZA 1VHLA 2RGNC 5DIFA 1FNNA 4ZKEA 3A4NA 1KO8A 1A5TA 2O52A 3CZPA 4L4UA 1H8ED 2VPPA 4DSUA 1UFQA 4A82A 1UEIA 1D2MA 2CLDX 4GPTA 4HLUC 4QGHA 4IDPA 2GCPA 2XB4A 3UANA 4D80A 4PSKA 2IYVA 5DSZA 1W4AA 3LBNA 1QDEA 3E1SA 3QY0A 1OH7A 1Q1EA 1SVIA 5L8VA 1MABA 3FE2A 1ZD1A 1J8MF 4M1SA 4Q1AA 1II0A 3U5ZB 1COWD 2NOAA 2FPKA 5DHFA 4YMUA 1PLJA 2REXB 4U7DA 2ORVA 2GBLA 2XEXA 4R98A 1Z29A 3W3AA 3SBEA 4C7OA 2FPMA 5GVSA 4DB4A 3PJRA 2W0SA 3M4YA 4TQ9A 4RVCA 3FHCB 1R5OA 1G19A 2ZVPX 1P9RA 1JXMA 3AKEA 4IKEA 2JJ2A 2XSZA 4Q5IA 4CEJB 1Z28A 5G3YA 2RHDA 5AJWA 4Q47A 4GP7A 5DN6D 1W36C 3QKTA 3WNDA 1NL3A 2OFWA 3LDAA 5TXGA 2H92A 3OIWA 3B6EA 1E0KA 2VSFA 3MJHA 4YMTA 3BBPA 2ZRJA 4HAZA 1PV4A 1Q21A 3ZZ0A 4BEJA 1TQ4A 3AQ4A 3ASZA 1KJYA 5JJKA 2DCUA 3CW2A 3EG5A 3RRMA 5HPYB 5FBRB 5EP2A 1LTQA 5DGXA 3NVAA 3H1TA 2QPAA 3WBKA 3N2IA 2WIBA 4PTLA 2ERYA 3HP1A 1VPLA 3TUJC 2W2VA 2OESA 1JALA 1Q3TA 4OK6A 3PUXA 4PPGA 2D4HA 4EPRA 4PFSA 1F6BA 2FU5C 2YOGA 2G3YA 1ZU5A 3K9GA 3AF4A 4YMWA 4U00A 3GJ7A 1G7RA 3QE0A 3T61A 221PA 4L5BA 1DELA 3L82B 4G5QA 1R7RA 3AM1A 2B8WA 5LPNA 5K8UA 2OO7A 2Q3FA 2PLFA 2PEZA 4RY2A 2GWHA 1L7VC 1RE0A 1II8B 3OZXA 4UKDA 5B2ZA 3UPUA 1TUIA 1CEEA 3RRYA 5TB5A 6Q21A 2FSIA 4F93B 4JLVA 4MDFA 2QQEA 3QNUA 4PC7A 2WWHA 4J0QA 1NVVQ 2FZ4A 2W2XA 1VCMA 1XBTA 2QE7A 3X1DA 1A7JA 4OQNA 2JATA 1KI4A 1Q20A 4ZDWA 1KI6A 1ZD8A 2F1JA 3N5CA 2JAQA 3AVVA 1C4OA 2GEVA 2D06A 1JAHA 4B43A 5JCPA 4WZAE 3IIJA 1II8A 2QT1A 3NC1C 2YKGA 5G41A 1MO4A 2AXPA 4A2QA 2AFIE 2V9PA 5HCNA 5GVRA 1I2MA 2ZJ8A 2DHRA 2ONJA 5FTKA 4BFVA 1NNEA 2AKYA 1VCIA 5FOXA 3HU1A 4NU0A 4D26A 1KSHA 2PJZA 2BJWA 2OV2A 1EG7A 2QTFA 2VHTA 1N6NA 2B7BA 3K0SA 1DPFA 4LUCA 3BFXA 2FJUA 3T15A 1OIXA 2CHGA 3QSYA 2VA8A 2YOFA 1NVXQ 3OFND 4Q66C 2VHCA 4DDUA 3D7MA 5KU1A 2J0UA 5F98A 821PA 4WZBE 2CCGA 3I32A 4OI2A 3TBKA 5JWOA 4GOKA 1OH5A 2CE2X 4CIDA 4W5HA 3RWMB 1O3YA 2GXAA 5EZ5A 3ZH9B 1B23P 4JLDA 1LNZA 2PL3A 4US1R 3ICQB 4XWOA 2G9NA 1LY1A 1HTWA 1U98A 3BGWA 1E2LA 1QHSA 3MFYA 5D3MB 3H84A 3U4QB 3IHWA 4DDWA 5AK0A 1AZSC 3RS7A 3B85A 5G40A 3NWJA 5IF9A 1FFHA 4UNNA 4C0LA 4PHTA 2O8CA 2G88A 4G0NA 2WJJA 1OYYA 2AHOA 4QGFA 4DSOA 3TMKA 5DYIA 3VKGA 2L0XA 3CWZA 3AVUA 3PCRB 1G8HA 1KMHB 4A8JC 2A5GA 1T8TA 4D81A 3CM0A 4JLJA 5P21A 2B7CA 1UKYA 2HXYA 5D3MA 3HDTA 1P73A 4JLNA 4NMMA 1G3UA 2O8FB 2ZU6A 1W0JD 3L43A 1XD9A 5FPYA 1E9EA 4GMXA 4E07A 4JSTA 1XU4A 3TVTA 3NH6A 4FIDA 5HE9A 1AQYA 3FFAA 4AKGA 3EZ9A 1KHTA 2O8EB 5IT5A 4ZCIA 4URUR 2O8BA 2FSGA 2EFEB 3GLIB 3RLFA 3ZS8A 1Z3IX 1QVAA 4EPWA 4F4CA 3A1TA 1WB9A 4M1OA 2TMKA 2OG2A 3AVXA 4WA7A 2XOKA 4AY2A 3SHWA 5AUNB 1XJ0A 1IONA 1ZIPA 1GDDA 2YHSA 3SYLA 2O8FA 3FTQA 1JEDA 4GT1A 3H0KA 1ZAKA 2OZEA 2QAGC 1NMXA 3ADKA 2JJ8A 4MGKR 4Y0VA 5JI2E 4DDVA 4KU4A 5FOTA 5JCZA 1Q0UA 5H8WA 3ETLA 4GFDA 1X1RA 1XEXA 5CM9C 4R7ZA 2ZSAA 2AD1A 1YKSA 1DAGA 3QKSA 3PVSA 1R6BX 4TLCA 5A5GA 3QQ5A 4TL6A 3U60B 2BKUA 4YMVA 1JEEA 3F8TA 3H86A 2VLIA 3IQWA 1OH6A 2OCPA 1TX4B 1LF5A 1N5LA 1EFRA 4L9WA 1G17A 3A4LA 2FMXA 1OLOA 1U99A 3C7KA 4EFMA 2NG1A 3I5XA 4HDCA 5KSPA 2BEJA 1ESMA 1KMQA 1P62B 4NHOA 3E70C 4Q1CA 2ODBA 5FBVB 4RSGA 1ZNWA 1BYIA 3QKRA 5AJZA 4URWR 2ORWA 1B0UA 3SU8A 4FCWA 4PANA 2BHRA 4MYCA 3AVOA 1KY3A 3LXXA 4O2RA 2N46A 4A2WA 3WP1B 4DLVA 1SZPA 1NLZA 4PZZA 4A36A 1QHIA 1WRBA 4KFTA 5CIWA 5KSYA 4FD2A 2P5SA 3CRMA 5EXXA 4LZZA 2GXSA 1BKDR 5B58C 1CR2A 1NN3A 1XEWX 4Q1EA 3K0CA 4DLZA 3P27A 3QI2A 2ZRLA 621PA 5BW8A 1W49A 1JBKA 1F5NA 4GBMA 1W7AA 1KSGA 2YC2C 1I4TD 3UWOA 1F2TA 1OPXA 4PQFA 3WMFA 4AG6A 2JDID 3Q5EA 4JVMA 4AKHA 3PQCA 2P67A 1XFAA 4FCTA 3GLIE 3EZ2A 5J4LA 3L0IB 3PV0A 1U9IC 3M1IA 3U61B 1XZQA 3B1XA 1U8AA 1IQPA 2HYDA 1W0KA 4FMBB 5EP4A 1OHHA 3KKNA 4KAXA 4ZIRB 4P32A 4DT1A 4MYHA 4QJ3A 2VP6A 5J4KA 1T0JB 3B60A 1AJEA 3IEUA 1SXJB 1P2VA 4L8GA 1TU3A 4HAUA 1X8JA 2FV8A 3ECCA 4KHZA 5BYKA 4B48A 1GNPA 3PUZA 2IWHA 4N1AA 2VP0A 2GKSA 4NE2A 3TUIC 3WHKA 1QF9A 3VHLB 1F2UA 4A0HA 4BZPA 4OHWA 1RJ9A 3U6BA 1QZXA 4MKFA 1EX7A 1G3RA 1OXUA 4R2HA 2CJWB 3T06B 4IEIA 3CRW1 2FZLA 3W8NA 2YZ2A 4JMPA 5AJYA 1E0AA 3IHLA 3SDZA 4AURA 2Z83A 1TPZA 4MKIA 5CDFE 1E9RA 3GEIA 3ZQJA 1E2EA 1JJVA 3QG1A 2A9KA 2FGJA 3TAUA 1OXVA 2HDNB 5CJ2A 2W6JA 2JIZD 4DSTA 5JI3E 1KO1A 1GUAA 2A5JA 4UNPA 4Q21A 3W34A 1W1WA 2XTZA 3V4FA 5C46F 1CJVC 1VCOA 4IJMA 4CEIB 2IHYA 5CK4A 5IDVA 3SQWA 4I1UA 3QBVA 1R8QA 4MYUA 1EFHA 2F43A 5F3WB 2J59A 3DDCA 1LW7A 2ZRCA 3GEHA 4LJ6A 4XWKA 5JECA 2ZETA 2RHMA 3NHBA 5CITA 5L3SB 4MA4A 3AVYA 2REOA 3GJ5A 4A6XA 4NCIA 4OKSA 2ZJAA 2VSXA 2O8DB 5FPHA 2AFHE 1E9BA 1Y63A 3GJ6A 4E09A 2IEYA 3KXIA 4R9UC 4DLRA 3LH5A 2BEKA 1E2IA 1G5TA 3CR8A 2MMGA 4GI7A 2BBSA 4KYUA 1G8FA 1KK2A 1D2EA 3IQXA 3OIUA 1J7KA 4TT3D 1Z0AA 3B5JA 1R10A 2GAAA 3SJZA 2QMEA 3SBDA 1F3OA 1CJTC 3ZS9A 4Q9IA 3TAHA 4CF7A 3RYTC 2W2TA 2ZUCA 4OK5A 3TNFA 2P0EA 4YXWD 3LVRE 5A4JA 4TMZA 3K70C 3K09A 5L3SA 2Q9BA 2ZJBA 2GVDC 2J7PD 2O8DA 5KOYA 4LBWA 1FQJA 4LY6A 4PAQA 5D3QA 1E1RA 3V00A 5K8TA 4XH9B 4GRAA 3R9IA 3IIKA 4RZ3A 1W44A 4QFMA 2XNDD 4AG5A 2DWOA 2GF9A 2WZQA 4ARZA 2CLSA 5F9FA 4DLYA 1NF3A 3DL0A 3BORA 3ZIAA 3MRSA 1G5RA 2JLXA 3MUFA 1P72A 2JJ1D 3H4MA 3N2EA 4JLPA 2ZRAA 4PAOA 5FFMA 1A2BA 4HAWA 4L15A 1SKYE 1XJCA 1KI3A 4L9SA 5A0FA 3U3MA 2C8VA 3CH4B 4MRVA 1JAIA 1ESNA 3LW8A 1U0LA 3AB3A 1FL9A 1BIFA 2F9MA 2I1QA 2YWEA 3O8CA 2IK8A 3R20A 2IX3A 3OE7D 1ZUNB 1XPUA 1P3JA 4ZI2A 2IHBA 2ORIA 5FI1B 1D9ZA 4BASA 4M0LA 4KITB 2VYFA 2QA5A 3FFBA 3TE6A 1AM4D 1E3MA 4LC1A 2F55A 4YONB 4IDQA 5LD2B 3E5HA 3A37A 3Q72A 1K8RA 2VSOA 2C78A 1GAJA 1VKJA 2DFLA 2PBRA 1M34E 2AL7A 3EZ6A 2CXXA 1FTSA 3KJIA 3NBFA 2R6FA 1E2GA 3CNNA 2QM8A 4WIAA 4ZDJA 3NIBA 4IXNA 4AK9A 2FG5A 4XVUA 2VO1A 4ASUA 1TNDA 2V55B 4QL3A 2CNWD 4LYHA 3EAQA 2ERXA 4XVQA 3SI7A 4IOMA 3TR5A 4MGYR 3W6PA 1G4UR 2ZI5A 4QKQA 1TL7C 3O8RA 5FBQB 1TF7A 4OYHA 3AEZA 1P9WA 1XJQA 3KJEA 3RANA 1UBFA 1RZ3A 2WPDD 4AD8A 4BFUA 1EESA 5DH9A 1XEFA 3SC3A 3WYAA 5LB2A 3ZYCA 4F92B 2OBMA 3EIHA 5IHPA 2WMNB 2ZI3A 2FX3A 2N1BA 3GEEA 5KTYA 1PUJA 3BAFA 2WSSD 1DS6A 2ZE7A 2G1JA 2ZITA 4CW7A 2ZRIA 1XMSA 3OAAD 1NLYA 1X3SA 1VYTA 2ZAOA 1NJGA 421PA 1RVDA 1DAMA 1DAEA 1GKYA 1XD2A 3TH5A 3QF7A 3RS4A 2CL7X 2JLUA 2H5EA 1L4UA 4LV6A 4KCGA 2X77A 2IUUA 4JL6A 3UIEA 3RC8A 1QG4A 4JLMA 4AYWA 3NEJA 2ZI7A 2WIAA 1S8FA 3MMPA 4OHYA 1IHUA 4HAYA 2YWFA 3WRYC 2W6IA 2ZE5A 4S2EA 1CR4A 1FX0B 5CLLA 3MLEA 5JEEA 1NIPA 2RCNA 1HY3A 4KFRA 1XZPA 5JHGB 2JLZA 1IN4A 2PCJA 3WYFA 5C1BA 4N0EA 3FKQA 1YR6A 2HLDA 2ZVQX 3OEEA 2D74A 3GJ4A 3QJYA 3A1UA 4QNMA 4A0GA 1JQJC 3B78A 2D7DA 3LA6A 3P26A 1ZM3A 1UF9A 2A3RA 4M1YA 1KI9A 4IDOA 4M2LA 3RSLA 5FPTA 3RS3A 4FINA 5AR1A 1ZC3A 1XEWY 1KZGB 3DEFA 3BXZA 4P3YA 4RKFA 2IS4A 4P4SB 2NZ8A 1S9HA 1S1MA 2QGZA 2ZYVX 4DB2A 1XTRA 2AX4A 4CEHA 1OT3A 1X86B 5G53C 5KSZA 2PJRA 4Q4HA 4Y0AA 4A6PA 1IOZA 1FPMA 3NDPA 4LV5B 1ZVQA 2WAXA 3KJHA 3FDIA 2H57A 3D6TB 4K46A 2JASA 4ON9A 3NDBB 5FH9A 4PZYA 5UKDA 1MV5A 3OESA 1QHNA 2RAPA 1E9AA 4JBYA 1NN0A 4YQFA 2ZEJA 3MAAC 4Q4AB 1E9CA 5JLJA 2FN4A 1JR3D 2OT3B 4NCKA 3PENA 1ZW6A 4RFVA 3VX4A 2X19A 1G18A 3EWAA 2FSFA 3U44A 2IS2A 2H16A 2D2EA 3QIAA 1UJ2A 5CK5A 3RDPA 2ZIAA 2J87A 2WBLC 4GOXA 4EFNA 4Q18A 1MRNA 2Q6TA 3I61A 2QBYB 2ZR7A 2GJKA 1XMJA 4AWXA 5GADl 5B30A 1O87A 2VP2A 4MRSA 5KPDA 3KTAA 5EXSA 4Q4AA 2OXRA 2NPFA 3THOA 4BFWA 4EJSB 5BN3A 2NIPA 3CWQA 3SJBA 4W9MC 2VBCA 2YJTD 3T12A 5L3QB 4JJZA 3EPLA 2PMKA 2CCKA 1T6NA 1RFLA 2NO0A 2GETA 3CO5A 1DO2A 1ODFA 2JA1A 4G5SA 4TLAA 4Q7MB 4LX0A 3QENA 4M9SA 4ZPXA 1W4BA 1NSFA 5FUYA 3VQTA 3HU3A 5HCIA 3OEHA 1XX6A 2ZYUX 3T1OA 2XJ4A 4YDHB 1GRQA 1J99A 2JGNA 4WZ6A 5KNBA 4MDEA 2QSYA 3A8TA 2NO7A 4NCNA 1DADA 4JKIA 4RD1A 5KDDA 3PIRA 3R7WA 3FKSA 4Q7LA 4KODA 1GM5A 1W5SA 2QPOA 3GJXC 1FP7A 2G0TA 1E2KA 1G8YA 4IVPA 2QT0A 1S96A 3RRZA 1IN6A 1SVMA 2GBLC 2XNSA 1NI3A 2NO1A 4DLTA 1E4YA 1FNMA 1M2OB 1N6RA 2QN6A 3B1ZA 1YZNA 5DO9A 3HYTA 4HB2A 4L16A 4V0OA 1Z63A 3M0EA 1XCGB 4NH0A 1GITA 3REGA 5EP1A 1KJZA 4IVRA 1E96A 2ZPTX
chains in the Genus database with same CATH superfamily
1SK8A 2KBFA 4TS3A 2LKCA 4Z4EA 2ECKA 3FTCA 1LRJA 1JU9A 4P82A 5JDCA 1M2VB 1MVLA 1TADA 1LC3A 2IY9A 2PRJA 1EK5A 1QKKA 3E9YA 3FW1A 4JJFA 5J4VA 1SUDA 3AM5A 2DT5A 5B12A 3H87A 1RPJA 1YR3A 4M1WA 1L3IA 3O3NB 4GNRA 3KFVA 2AVNA 2WI8A 3HKDB 5G0TA 4JKYA 4ZO9A 1NPTO 1ADJA 4KK4A 4UNIA 4A7PA 5HZHA 2QG9A 2YH2A 4MA0A 4LG1A 4U8GA 4RH3A 4XUGB 2PUJA 3BJMA 3H4VA 1EK2A 1JKMA 4M0PA 1SQSA 4CKXA 2VT6A 3M4NA 3CW9A 3N76A 4JC8A 4DCPA 4EG7A 3B9PA 1L7NA 2HA5A 4QDKA 2GKGA 3IB6A 4P33A 4BV2A 3S2SA 4WK6A 4OXKA 1N2SA 4P98A 4RF3A 4BX8A 4CN9A 3SZ3A 1HT0A 3E5NA 4HV4A 1XVUA 4LHEA 2OHFA 4HF7A 4D25A 3F8WA 1OIVA 1XTPA 2JLQA 4I2VA 2C7PA 4G23A 4B0OA 4XJTA 5FQNA 2B37A 3TTSA 1IU9A 3QXJA 1R0YA 1TGYA 4B6GA 1CJCA 1KAGA 1LGYA 3ZY3A 2WTAA 2B5OA 2NSYA 2FEKA 1YDGA 2OZKA 4FKBA 4NYJQ 4JYAB 4PCUA 2J08A 1P4GA 3EVBA 1L4HA 4PZUA 1SKBA 1S4QA 3EVEA 3U9SA 4OP3A 3ZW9A 2I1VB 2KW5A 2BY4A 4UATA 2A0UA 3E48A 3DTNA 1O5OA 2ARKA 2Q5HA 3AL2A 1DC6A 4OGWA 4QUKA 3R9WA 5ALVA 3U7JA 4KI0A 3WGHA 2QNIA 2XUOA 5B57C 1EM6A 1QB7A 4H6WA 4RXMA 3RSZA 3W5IA 2ZPUA 1YCHA 2QN3A 3AP2A 1XZ8A 4FR5A 1T6BY 4IVQA 4TTVA 4CQMB 3N9IA 4EJ2A 2FZKA 1M7BA 3KSZO 1Y8ZA 4RPCA 3LLCA 5ERGB 5JRZA 1JB1A 2E1RA 3VVMA 3IAAA 4IH9A 3EY9A 1P31A 1C1XA 4ZN6A 4ILEA 4JC5A 1QTNA 3UFXB 3V7NA 3EHEA 3R6GA 4XTCS 5AKZA 1QIDA 3ADBA 2NZ2A 4D97A 3ETCA 2O3JA 3VTKA 1OBCA 4CIBA 1MZPA 4RGYA 3ANYB 2G1PA 1ODIA 1RM5A 3FCOA 2FEMA 4HXFB 3WRWA 2ATXA 1SWVA 2I4TA 3IAS6 1DXQA 1YO6A 4BNTA 3NV9A 5KWEA 2O7RA 2FKAA 1Q7BA 2WJPA 3HKCA 4GLJA 1R1DA 3DTTA 3PXCX 4KZKA 4MPJA 4P81A 4TV8F 3FX2A 4L4SA 4G07A 4ZO4A 3ZWVA 4YMLA 3RYCA 4H1WA 1CUIA 3VUFA 4XQ0A 3GD5A 3D3WA 4PZLA 1J4AA 3R5HA 4BCCA 3JRXA 3KEMA 4BX2A 2EJUA 3N0WA 2Q9CA 2VWHA 4DL9A 1WR8A 2F8TA 3KR2A 2LTAA 1WW3A 3THSA 1Z6GA 2ON6A 3NIFB 3GDWA 3BRWA 3QOYA 4PX9A 1GFIA 2BMJA 3GRUA 2A30A 4TKUB 2YXPX 4URFA 2WMOB 2HK9A 1NVUQ 3FF1A 2J8ZA 4GH5A 1VHTA 4LJ4A 4QYIA 5FI5A 1YIDA 4B6JA 5C7OO 5I5GA 3WB2A 4IICA 4NBNA 3AF0A 5KWSA 1IQRA 4GLBA 4O4HB 2GDZA 3OQHA 5AVZA 5L3VA 4C1BA 3BJZA 4RLSA 3UC5A 2RARA 4M9QA 4OLJA 5E2BA 3RYHB 4F46A 5JS8A 1THGA 3GNSA 2JAUA 3F71A 4JQSA 2Q8QA 3CFYA 2NU7B 2Q49A 3FNGA 2W4MA 5TSDA 2PGJA 2ZZNA 3PQEA 4JMLA 5E2IA 1FF9A 2PR2A 2QXUA 4TMWA 5EQJB 1O0CA 4AJHA 1KYVA 1L2TA 1R0KA 4V2UA 4EI2A 1NQAO 4N5DA 2R8ZA 1UC5B 2DQ4A 4TWBA 3PFGA 3JQFA 4HYTA 3VR2A 3HCAA 3MMSA 1Q1NA 5KQLA 4FFDA 4BXOB 3NEAA 1Y4SA 1P6QA 2PSFA 3NHZA 2QT9A 3CX8A 3MS7A 1NY6A 1P0PA 4FCVA 4W5QA 3L04A 4DLBA 1RBYA 2FAXA 4ISCA 5IH3A 5JAHA 2OLEA 3LHSA 3RSHA 4KPUA 3MWEB 5HDBB 1DB3A 1JSLA 2P1DA 2BCEA 4QPZA 5CLIA 1CQXA 5AHKA 5TMEA 4I5DA 3RS8A 1F6WA 2HZBA 3G02A 1JNYA 1F9EA 1DLJA 1T8RA 3AL0C 4F84A 2Y8EA 1IWPB 3HTXA 3MUEA 1W85B 1NATA 3CUWA 4UARA 3HPQA 5DSXA 3FUWA 4OH7A 4UCXA 2IYQA 4XASA 1AS2A 1B00A 1QO7A 1VSTA 2X6RA 4LDJA 1SFRA 2NX2A 5LQUA 4W5OA 3OX3A 2DFTA 2LV8A 3JYQA 2W2KA 4G1EB 4M7WA 4G5XA 3SY8A 3THWB 2WJIA 1FYDA 5K6RA 1K97A 1RZVA 3PGVA 2JW5A 5JEDA 1KWKA 2OCGA 4KR7A 2ZT7A 1GG8A 4OATA 4Q9HA 5BUZA 1KGDA 1R64A 4KFSA 2WWWA 3G13A 2O5EA 3E15A 4CCAA 2PZGA 4XIFA 3VZBA 1DINA 1K4KA 3RRXA 2XCQA 1AS3A 3HEBA 4NDAA 4C5AA 4CKBA 5A3SA 3UXHA 1YFZA 3WBFA 3KS9A 1U0FA 2J48A 4YFYA 3UMYA 5CAEA 1MB3A 4HAXA 2DTXA 4B80A 1N9GB 1NX9A 1PWZA 3H9EO 4CKCA 2QMZA 5IXYA 3I2KA 5BV0A 1YASA 2XT6A 5CX4A 2WB2A 3ORSA 4QLBA 2ZSIA 2CFTA 5FXMA 5CFPA 3ZU3A 3K1YA 1T4BA 2FN9A 5LP6B 5MF6A 3LAWA 1RM4A 2A33A 3L2OB 1KMHA 3MQ2A 4HLDA 4PNZA 4CL3A 4BVBA 2C57A 4N5NA 4Q01A 5B6IA 1VA5A 2YV4A 4MS1B 1WP9A 3DFFA 3OTWA 5EJAA 5H70A 1NT2A 1RKUA 3RAFC 3RFFA 5KS2A 4I3FA 3W78A 3M3PA 4AJPA 1FRFS 3WJ7A 4GC5A 3B7GA 4HCJA 3SBOA 2QZ4A 3VYWA 3PLRA 3W77A 2XGMA 1UUFA 4LDZA 5CTAA 3UWSA 1UKCA 3GLIA 3ODGA 4AY4A 1SCJA 3CZQA 3EXEB 2P2ZA 3GRFA 4EECA 1R5JA 5KX5B 1Z7YA 4G81A 2F59A 3VR4H 4B4UA 4BGIA 5MN6A 3VR5D 3Q5GA 4D9NA 1NDHA 3W5AA 4GDFA 2BHLA 1YUMA 3PX2A 3OMWA 1JPVA 4C4ZA 4CLOB 2QN2A 1N5KA 1F20A 3RRNA 3ZHYA 4CI0B 3VZCA 1MGPA 2K5UA 3AJRA 1GL6A 2C31A 5FYQA 3I28A 5AVUA 2ET6A 3H97A 1F8FA 2XF8A 4GOMD 3T1QA 1MDBA 4OFZA 3I52A 4CTJA 1U65A 1EK0A 2C95A 4N03A 3QU7A 1LDEA 3HDJA 1NJFA 1RRFA 4JLOA 5BV2P 1EDZA 3CE9A 4XX0B 1KFCB 3B3JA 5IVPA 4FFPA 1W1UA 3RVBA 2ZQZA 3P45A 1R2QA 1CVIA 1NJ5A 2YN4A 4PQGA 1MJGM 2W6PA 1UBUS 4NABA 4U7JA 4E5YA 3KWMA 1PQYA 4EO9A 1G20A 1I2AA 4WT7A 3H8VA 3U4AA 5CB6A 2WQ7A 3V8EA 3AIMA 2WTMA 4JGGA 1I1NA 2LRHA 1JFFB 2AJ8A 4GX2A 3A4TA 3VR1A 2OZLB 5C4GB 3WLMA 2VJCA 4RFSB 1L7AA 2CF5A 1YQUA 2J5RA 4IV0A 3G8CA 4MB2A 4XD2A 1BYUA 3STWA 3DULA 2AFHB 3NXSA 3CSSA 3P19A 4PYIA 1DDIA 4DNFA 3T1TA 3VTZA 3GXOA 5K0LA 3BD9A 3X2FA 2ZSUA 4N0DA 3A4IA 1UAAA 2BEUA 3A1SA 1Q2UA 1XZIA 2VHQA 1E7YA 3FVQA 3K8ZA 2I33A 3RIHA 5J2UA 1VL5A 1TA4A 3QW2A 5BQ5A 3NH9A 3T35A 3SFZA 3ZWWA 5LU8A 2YUIA 1H6CA 3CX3A 3IPCA 3TZBA 4W1PA 3GGDA 4KSYA 5LOVF 2X4IA 3TIIA 3ZD6A 1PVOA 1XWWA 4V0RA 5FF9A 4MPRA 4RORA 4KWCA 1REQA 3OOSA 3GDHA 5HJ5A 2OHXA 3FHOA 4QIHA 5TVKA 3TCKA 4NCBA 5H5JA 1JDZA 3I1FA 1VLMA 2BMWA 1BE8A 2RGAA 4TKMA 5LZ5A 3BQMB 1FEZA 4WW0A 5TQ0A 5HVNA 3AGQA 4K0KB 2GPNA 1V16B 1XAGA 2BIFA 4Q15A 1GNLA 1Q92A 2I3BA 1QV7A 1O58A 4QSMA 3UK2A 1G9TA 3QKUA 4K9LA 4TM8A 3OCYA 3LZDA 3SJCA 3BMNA 3RFUA 2P2LA 5JRJA 2O5VA 4HK4A 2PHZA 3UT5A 1HQYE 4ZIRA 1IJFA 1F8XA 1GPKA 3GBSA 3JPYA 2FQ1A 5LQMA 1ZH6A 1Q1GA 4PG7A 2QD2A 5CIQA 3GAZA 1UJMA 5HG0A 2WTBA 2XZTA 3LPNA 1IN5A 5BN5A 3MB8A 3IUPA 3BKWA 2BGWA 1R9MA 1V41E 1CERA 1HYQA 1NVTA 4H6VA 4XSVA 3U3ZA 1Z4MA 1T2EA 2F2TA 2HWUA 2M6SA 3LCUA 1KO4A 2WAAA 4JT4A 3LJKA 3UB3A 4BUZA 2BKXA 2RAFA 3B8HA 1E64A 4NARA 3WNQA 4IGFA 1VYVA 3DMTA 5KTPA 3G5MA 1IB6A 2RGCA 3C1UA 3K09C 2ICAA 5CFNA 3BSWA 4OH1A 5J3JA 1QFSA 4FYJA 4Q9AA 2DUMA 3V1YA 5IWAB 2XXAA 1VTKA 3DZCA 3X43A 4DCSA 4D0SA 2Q4BA 2VAWA 3ZU5A 2FW0A 4U6NA 1WM1A 4B8WA 3VNVA 4ARCA 4N3CA 2C9YA 2VSNA 5AVKA 1ECGA 4YCLA 4YCNA 2PUVA 5KTSA 4E5VA 5CR9A 4D4LA 1FP4A 4UHBA 1XWIA 4L73A 3EGVA 2UKDA 4RHXA 3OY7A 1TQHA 5EP3A 3WNBA 1NG9A 2VG8A 1YE8A 1QUEA 2ZYGA 2BISA 1E8NA 3H1AA 1C1DB 4QVKA 1A9YA 2AC2A 2CXOA 3RD5A 2I2WA 2IIBA 3H9GA 2IHVA 1Q1ZA 1QIJA 5JPCA 1HOXA 2PGDA 1L5HB 1TUEA 2NAFA 4DC9A 2RBKA 2XTMA 4U6QA 3UBMA 1Q6ZA 4GM1A 1M7GA 5LNK1 1QTQA 1F5SA 3O92A 3O21A 4O1IA 2WJWA 4F3CA 1DKRA 1S9DA 3NT2A 1C9EA 3L1JA 5JZMA 1PTJC 1H23A 1KI7A 3BMXA 3LHKA 4UPEA 4DMKA 3GLHE 5DNEA 3R8FA 1NAHA 5GJVC 2UZ4A 3EXAA 1Q44A 2OEPA 3LKBA 1S2MA 1W30A 3GRZA 3KJQA 4NK5A 4BVLA 3OSZA 4YXFA 4UBKA 1P9NA 3ETHA 4GU5A 4KO1S 5IM4A 1PKXA 2D1SA 2ZBEA 1OXSC 1AK2A 4PYQA 4OYYA 4CYMA 4JQCA 4JWTA 2HDOA 1E2JA 3N59A 5HILA 4ZQEA 2Z58A 3PQ4A 4GAEA 4OK3A 5CCXA 3FVRA 4DWOA 1YVDA 1G64A 1FB5A 1X7XB 4TTJA 3E22B 3HU2A 3BL5A 2OKGA 2NO6A 5DM60 3GLGE 5HJ2A 3ILVA 2Z8ZA 1Z0IA 3MGGA 2GEBA 2QP4A 3LXRA 5AXCA 2B98A 3VTAA 3V8PA 2FTKE 1XEAA 2ZWPA 5G0WA 4UEQA 3BL6A 1NDUA 2HPHA 4G1MB 4ZXFA 4A0FA 4CQNA 1PE0A 2PE5A 4CU5A 3WQHA 1T6YA 3NGMA 5HZKA 2YQZA 5HXAA 3LECA 3TYXA 1GAWA 2FOIA 3PITA 3DZ8A 3WLEA 5G2OA 3WZMA 2VF7A 4HWTA 4F06A 5E6SB 4B45A 3EZFA 4UJ3A 2J67A 4ZVTA 2NACA 3D1LA 4YRCA 5K8JB 4HLNA 3HLKA 6LDHA 1EPUA 3N3AC 1GNQA 4LS3A 1TUBA 4PBTA 3C4QA 1ZNZA 2VNHA 3CLKA 4RTRA 4KXFB 5EIXA 5IRCD 1WXEA 3FF4A 5AKYA 2VQDA 2P79A 2WF8A 2HUNA 3DXXA 4GM4A 4I55A 1Z8NA 5DW3A 2FPLA 4AJ9A 2DLDA 3KTFA 2WIFA 9LDBA 3KT0A 1XTVA 4NJOA 4I1SA 1T6ZA 1WB4A 3TIFA 4BRWA 3K0BA 1PJTA 1WY7A 2BZ1A 2E4XA 2Q2OA 3CLSD 4MRMA 1FYVA 2IU0A 3A6HA 4J91A 4B2IA 4YYZA 5IJZA 5HM8A 4HTAA 2B94A 1Y6JA 2LE0A 3PPWA 3BK7A 5L7TA 2HJRA 2JFXA 2V6BA 5T57A 3DT9A 3O8BA 4DYDA 2X0NA 2Z1NA 4CQLB 1Z3CA 2QZJA 4IRUB 2GVZC 3ECAA 3SYNA 4PNHA 2C3PA 4H08A 1T2CA 1JXOA 2PRKA 1Z8FA 4ZREA 1LWNA 3N2KA 5CYFA 3CUTA 4DV6B 3DNMA 5JFGA 2A94A 3MT0A 1DE0A 3KB1A 1J33A 5AQ1A 1JV2B 2AUNA 2FZGA 4RPIA 3HSKA 4X92A 2FW7A 2DT8A 1DOHA 5LQSA 1MH9A 1YVEI 2FWJA 2JEYA 5TQJA 5JROA 5L53A 1TCUA 5GV7A 1Y6RA 4HMOA 1OWMA 4MICA 3G1TA 4PVCA 4QBKA 4RE5A 3RS2A 4HGYA 3ZCUA 2JLVA 3MTBA 1JPNA 4BE9A 1QAOA 3C3WA 2NVUB 1RQ7A 2BELA 2OGTA 4NPHA 1WBBA 1CULC 1EFDN 1TMOA 4KNYA 3GDGA 2QORA 1EBFA 1UC8A 5T4HA 1RPNA 4CMCA 1C30B 1Z4KA 2UXDB 1RKVA 3GFFA 1QH8A 2QXYA 2CT8A 3GU3A 3B2EA 3OWOA 4TV9B 5E7JA 3OZBA 2UXCB 3GLQA 4FOSA 4NY1A 1R15A 4D9IA 1ULUA 2QQ5A 5IYZF 2VDNB 1DC7A 4FUTA 4F2GA 4URZR 5J4HA 4HAVA 3SEZA 3SNHA 2VP4A 4FYHA 3H18A 4XM1A 1Q1AA 3UQYS 3KKPA 4C5CA 5BY2A 3EASA 1IBLB 3B12A 1DAOA 4F5DA 3ENVA 4WJLA 4LN1A 2Q1YA 1PF7E 3KT6A 2CCJA 3DZDA 3KDPA 1PG5A 2BEVA 1DT3A 1GUBA 2E9SA 2GVNA 5IP5A 4BC1A 2HK6A 3OY2A 5A3QA 5AMXA 2FPIB 1P6XA 1RE1A 3PR3A 5I8PA 2A0KA 2ZWVA 3K2EA 1AH2A 1H2RS 2FWNA 3BE5A 3LKZA 3Q9UA 3NVMB 5LDGA 3ROEA 3DE6X 4A92A 4EQ6B 3PL5A 4RSHA 4ZJUA 3QBDA 1YCDA 2BBOA 2HF2A 4JLUA 3HGQA 3ONFA 4M8SA 3UUFA 5EJ9A 3HXLA 4BZXA 4DR3B 1Q95A 1NP6A 1Y4ZA 4LJ5A 2IUFA 2GR9A 3C8MA 1F0KA 4J2TA 1LNSA 2OCIA 2PX3A 4E5UA 4BEWA 4LYFA 1C3OB 4NBWA 4B1FA 3F67A 1DOAA 3N6RA 3VDQA 1GRNA 3B1YA 3DD5A 5EZ6B 3N07A 3VHQA 1DAIA 4IZHA 5AUNB 5LWQA 4JS0A 2EKBA 1CU1A 1OFGA 2QRMA 4QU9A 3IO3A 3CLSC 3SP1A 3TWOA 3W5SA 5FEMA 4LSZA 1ZCFA 2DUWA 3DBHA 1ZCAA 3SE7A 1AURA 4PGHA 4QTYA 1K2WA 3F7NA 3LQRA 2C97A 3E2PA 1IWBB 2COKA 1E3EA 1TVKA 2HMTA 2QZPA 4IG4A 4HNAB 3DLPX 2YXLA 1A77A 1OXXK 2JJ1A 1U8TA 3AFOA 3F78A 3MRTA 3QPAA 2W37A 3UQZA 5I7VA 2J46A 4IGKA 4JLKA 1QF6A 3CNOA 5ITZA 1NOIA 4CTMA 4GOOD 1LA2A 2EDAA 2PLRA 4L5CA 4D4MA 1RAAA 1GCIA 4TZ6A 1XV5A 3QXGA 1PW7A 4EG0A 2ZSFA 1VG8A 4HH0A 2IHZA 1ULSA 3OZWA 2NZXA 3OQJA 4YALA 3W1WA 1ZN2A 5IKOA 4EHNA 2HD4A 1DV1A 2HBYA 3RU9A 3FAKA 4KI7A 2BW0A 4PM4A 4CMJA 1N9KA 2CZCA 4U8HA 4DIDA 3QVJA 1EWKA 1RABA 1ZM9A 2FK8A 4QD3A 4XJVA 1Q16A 2XYVA 2Y0PA 3P4UA 2CKDA 1D5WA 3QY9A 4ML3A 4G89A 1S5PA 3LCVB 4LGMA 2WJAA 3AF3A 5ALYA 5C34B 3U6KA 5KQSA 2HJVA 4GR4A 4EKDA 1ADGA 1KH2A 5IVKA 3CNLA 5FOSA 1WLSA 3JAKB 4PO8A 3STTA 4BU0A 5KSWB 1E7MA 3RSSA 3LNCA 2F6RA 2OQVA 1QYWA 1T25A 1WXFA 2ZYWX 4RKYA 4XQEA 1FW8A 2PS9A 2WVAA 4OHUA 2WSIA 2RKOA 5CLHA 5L3QA 3ROFA 3BXEA 3GFVA 2J3IA 4NI5A 4O5AA 3RVRA 5ALKA 5FWXA 4Y67A 4MDHA 1WMEA 3D8SA 1A8SA 1BWSA 3U3RA 2ZT5A 1KC1A 3L0PA 4KUHA 1WXDA 4TMTA 4DJFC 3OE4A 4N4AA 4XGRA 5CA0B 4OFWA 1ULHA 4FFWA 4NG5A 3GMDA 4W6QA 1KNQA 4Y2RA 5A71A 2JJQA 1U5CA 2VHEA 2LR0A 2N42A 3OLQA 4K0RA 2XIQA 3O93A 5ALNA 3GVIA 1RVV1 1BNCA 2OSBA 5CIYA 3Q8LA 2FCAA 1YQWA 3U39A 5IHXA 2IYNA 4JX8A 2C3YA 4KVGA 4BQIA 3TD6A 1RD4A 3A1FA 3L4SO 4YT8A 1RRCA 3WYBA 5BN1A 3ZLJA 1MABB 1HZZA 5A4KA 1E7WA 2FFBA 2IX9A 1JSXA 3DLAA 4A91A 1DEHA 2FMFA 3JAWB 4B71A 3RWOA 4RTOA 3A9CA 3G2QA 1T1GA 4WCVA 5EIOA 1UOOA 1YJ5A 2I3AA 2YVAA 3VH4A 5EXPA 2D00A 3VR5H 4C7OB 1E4VA 2C9CA 1ZD4A 2XUIA 4ZQGA 4MGIR 2I3DA 2LD4A 3DMGA 3GFOA 5BV8A 4IDFA 4RLHA 4QQRA 3DO6A 3UM9A 4C2AA 3SX2A 1M2VA 2E0IA 2QEQA 2VTVA 3ESRA 4ER0A 3JQ9A 2ZIXB 3G0CA 2MWMA 4JBNA 4KHPB 3HCCA 2WHYA 2WICA 3AFGA 2IW3A 3F2IA 3D1JA 4AY5A 3EUFA 1E92A 1F9AA 3HKDA 5H4HA 4EG8A 1Y98A 5CCBA 3QLTA 3PEWA 3INGA 1N2GA 3QUTA 3AU9A 5FA8A 4Y2VA 3DBLB 2QS9A 4EG1A 4BVGA 1ESCA 4J9UE 4AIIA 2XEDA 4ZYTA 2Y1GA 2Z2YA 2FP4B 2VT7A 2IOYA 4G01B 2IEZA 3AP1A 1AUOA 4HOYA 2XKJE 1XJ5A 2VPIA 4NENB 3SCZA 3SYRA 1NXPA 4GMGA 4U6SA 3DV2A 5BYJA 4I14A 4X90A 5CYOA 5EG5A 4DW8A 3U40A 1BMFD 2RK6A 3R6TA 1IB0A 4HLUA 4KQ2A 3ZJUA 4LFAB 2P30A 3QBJA 4XXHA 3F9IA 4UHCA 1ORIA 1T0HB 4L28A 4J76A 5BUQA 1O6ZA 2IYYA 2H2HA 1QKJA 3NC4A 2XOKD 5DB4A 5FA6A 1ZVJA 2H4JA 2W48A 2ZVJA 3WB1A 3EISA 1D1PA 3I8XA 4XCXA 4UBOA 4V0MA 1EE1A 4MITA 3UF0A 3AFHA 1SUPA 2BGGA 1XTUA 3MJTA 2QUZA 1CP2A 1W2GA 1OU0A 4NWIA 1IM2A 4IW3B 4FMPA 4J75A 4QG7A 4PQYA 2A58A 1XFDA 3LE8A 4LBZA 2HA0A 1B1CA 1WAMA 2WYIA 4MGZR 4TWZA 2A4MA 5A1TA 1WG8A 2VYCA 1FFEA 5LKAA 5HBRA 1L4BA 3DEIA 4RXTA 2OFPA 3O0DA 3WZLA 5ISMA 1PAUA 1ZRNA 1GKKA 5DI3B 2PWZA 4MW2A 5CDGA 2JI6A 3VSBA 5C1IA 2ZB2A 5KPJA 1DBVO 4LTDA 4Y6SA 2IYSA 1KARA 4MVWA 1MC8A 1ZKMA 4KAAA 4JY7A 2AB0A 4Q9KA 5CT5A 2RMKA 3H99A 4BMNA 1JFRA 1ZJYA 2GNOA 1AUVA 3UFXA 1GQFA 1P60A 3ELDA 2D5LA 1THZA 2PH1A 3S40A 1QH0A 4BV9A 4YHHB 1I4DD 3ESQA 4LMRA 5FKJA 5BMVB 2AE2A 4O63O 3NTLA 4YUWA 3DEHA 4HEHA 3UXYA 4BQEA 5TMPA 3RUHA 4HDKB 4MRNA 5JMWA 2P9GA 3IT3A 1SBQA 5T8KA 2OL4A 3N87A 1ZUIA 2I67A 5AI5A 4OMCA 1BXRA 4Q1FA 3EGXA 2Y67A 2SKDA 2ZXUA 3VO1A 3I39X 3DOFA 1TD9A 1KJQA 4KEAA 5IC5A 1S2DA 3WDSA 1KEWA 1O6CA 4L1KA 3WK4A 1RADA 4NONA 2XYGA 1SCQA 2R7AA 2VQEB 1E6UA 3FUVA 2GERA 3TTTA 3JD3A 1S0UA 3QVMA 3ZEAA 4WNYA 4TKUA 2DHDA 4B3BA 1NUPA 4KOAA 1LSSA 1G2PA 5ELXA 3JVUA 1OXKB 4ZI5A 1ZI6A 2VZLA 2VPYA 4P93A 1XTZA 2WWRA 2O5CA 1UANA 1XRNA 4O4HA 3RUEA 3KB6A 4GYWA 3EIFA 4DS3A 4OMDA 3FNHA 1Y3DE 3CF0A 4FN4A 4L4YA 1JF8A 3EVDA 4MV9A 3RYHA 1M2JA 3UGKA 5ALSA 2Z4SA 1Z25A 3CKMA 3W9BA 4GLFA 3Q1LA 3F1LA 1UDWA 1JHZA 2G9UA 4GI5A 3WLKX 1N6PA 4IG9A 2P0AA 5EFOA 3Q3JB 4NEHB 2G06A 4GKBA 1DRUA 4GI2A 2JGFA 5KKNB 1UAGA 4B4WA 2OCAA 3GN1A 3HDQA 1BQEA 4IKOA 3MXOA 5CVTA 2HW8A 2C3UA 1VIDA 4CTKA 4BXOA 2E6KA 3OKAA 5AKXA 3L1KA 4I8DA 2JS7A 4NMLA 2YTZA 1P2SA 1JILA 4Q9JA 2B82A 4GS5A 2H4FA 4IGEA 3MWEA 2O2ZA 1GQ2A 2YHBA 3BE8A 3I0NA 4QA9A 1OZGA 4WH0A 4HYQA 2PXHA 2QK4A 5TQ2B 4CKEB 1GKIA 2PL1A 3L6RA 3VZSA 4UJ5A 1GADO 3AHCA 4NHEA 1COWA 1E2QA 2QPLA 4QOJA 3VR3A 3R0ZA 2OB1A 1W85A 5L51A 1G21A 3OQIB 3D5TA 5A9RA 3GUUA 3JWGA 2A0FA 3UW1A 4XSHA 3IVXA 2MYTA 1DTSA 1NN1A 1OUMA 2QGNA 2QX9A 4R05A 2BAGA 3IDQA 1SXJD 1VPTA 2QVYX 4KC0A 1N92A 1O8CA 2Z57A 2XCOA 3KQYA 1DKPA 2EU8A 2GD6A 3LT1A 4RK6A 2JHGA 3DOHA 4HVAA 1DTWA 4AZVA 1IJBA 3IQEA 4OM7A 4D9GA 4OQFA 4PXYA 2O8BB 2L19A 2QRKA 1EXMA 3FD8A 2HHLA 1NURA 3L7IA 1R3UA 2DG2A 3KJNA 2ZS7A 2PLNA 2G9ZA 5KI6A 4G1BA 1VP3A 5CJPA 4BNDA 3F6PA 4C0KA 1FVOA 4X6YA 4DSNA 1P3DA 3QXHA 1CY0A 4KIWA 3TQFA 4H60A 1AGRA 5LMCA 2H59A 4CL2A 1N9GA 2IWRA 3U31A 5IXJA 3L0CA 4ZQCB 4HTFB 3AR4A 3A27A 4KRGA 5HF9A 1FFWA 1I6LA 4JBLA 2JLYA 3H9BA 3U1BA 4DAOA 1L5NA 3QKSB 4UE2A 2ZLBA 4K6KA 4JFAA 5LP6A 5KYXB 5CA1F 1ZM4A 4R9RA 4MVJI 4RVHA 2AXNA 2QG6A 3JQPA 1U2QA 1ZBDA 3HZZA 4F1WA 5DTIA 2EQBA 4K8OA 5GY7A 1E2NA 5FL7D 2NZUG 3CCCA 3WLLA 3HN7A 2VHXA 4LRTB 4NPCA 1EZZA 2IVZA 1BH2A 4GL2A 4LFCB 3SEQA 1N0HA 5KZMB 3T5DA 3TDNA 3TFWA 1IXZA 2AA3A 3CG4A 3NM5A 4OI4A 2R6ZA 1VI2A 3IEXA 3A1WA 4MVJD 2JBHA 4PO1A 1DZIA 1JBEA 1OX4B 3EXEA 4D0GA 5KX5A 1C9KA 3T5CA 4PNEA 3D6JA 3KSUA 1VPDA 5BNIA 1PEAA 2LNDA 1YDEA 1BD4A 5EKSA 3O5AA 3S70A 5LB4A 3PFWO 5J2TF 2FFRA 3TL6A 1Z6XA 2JGDA 4CLOA 1I3MA 2BLLA 2WSLA 4A03A 3M82A 4DV3B 2K7ZA 4AJKA 4LKRA 1QLWA 5D1HA 4Z7JA 1FFBA 5FWAA 3RI3A 1R6TA 3LA8A 3R4VA 5CFOA 3A6GA 2GM9A 2X8AA 3ZV3A 1WQ4A 5HTKA 5SV2A 3GW8A 2C2YA 1VMEA 3LOQA 3NNNA 2V7QA 3NYWA 4MS3B 2UUAB 5AKIA 4B73A 4RCYA 4XX0A 5AOBA 1HE3A 3RT7A 4A4DA 2PUAA 1TJYA 5AUQA 2CHQA 4GWLA 3RJMA 4B6EA 5D51S 5FBWB 4LHXA 5CXUA 3P9ZA 4M87A 1GTMA 1Q0RA 1ZOPA 3FPKA 3GLUA 3L8ZA 3O4RA 1EXWA 1PL6A 3S8MA 3C48A 4Y1RB 3N8NA 4ZYLA 4B76A 3EUEA 2MCFA 1GLVA 2Q41A 3GEMA 4R01A 1Y5RA 1YOBA 3LUBA 4YBZA 3WMWA 1V1RB 2AI3A 4JKOA 4BLUA 2RGWA 4CLEA 4EG5A 1JFFA 3H2HA 2X22A 4RJLA 4DKXA 4PSUA 2OZLA 4NFHA 1NMZA 2ZYRA 4JJ4A 4UM8B 4EB8A 1SXJC 4DMGA 1KZ7B 1U6KA 4BMOB 2DWUA 1UXIA 4NCHA 4WRRA 4RS4A 1XRJA 5DM1A 1Z6TA 1SOAA 4EHKA 2BGJA 3RIEA 1D0VA 2FXIA 2VDWB 4NVRA 5K3OA 5M2QA 1YHZA 1P4HA 1FP1D 2GM3A 3FSJX 3R76A 1T1EA 3DKIA 5DRTA 4Y98A 3M6AA 5TARA 3UG6A 4Y18A 5JDIC 5E6RB 5KYYB 2H0RA 3VZQA 2VRBA 2HQRA 2ZJ5A 4JVNA 4N49A 1JKXA 3GNLA 3UNXA 3PFIA 4LQDA 1NQUA 4KMMA 4EAQA 3E1KA 4GOJA 4RHFA 4KLAA 1RKQA 4QHTA 3UAZA 3OPMA 3ZUPA 1RI1A 5IG2A 2A7QA 2Y1OA 4ETNA 3ZDCA 3H3XA 3TVDA 1TZJA 2ZRKA 7GPBA 2IH2A 1QO0A 3NHAA 3WAJA 1OAAA 4P3XA 4P84A 3NHKA 2BDUA 1L5RA 1LVUA 1ZC4A 5EIFA 1JJAA 4RPGA 2BI8A 2G9VA 3HJUA 2CDBA 2P7HA 3I83A 2OD7A 2CC2A 5ETJA 3UMSA 3PXEA 4BL5A 5I45A 2AX3A 4CHGA 4PGGA 1JZQA 4PRKA 2AMJA 3KHSA 4D6YA 1V16A 2XOXA 3W7VA 2QTLA 5JJIA 2GN9A 3S8EA 3ZVRA 1GYRA 4G8CA 4D3FA 3QHQA 2ZTHA 4Q9LA 3ZHUA 3O3CA 1QIHA 3DWEX 3I1YA 4OMFG 1FUKA 3PSHA 1PNVA 4MEBA 2C7QA 2YRWA 1J70A 2D8MA 4H7FA 1YZKA 3AERA 2FUG6 4B35A 1MT0A 2A1TR 3AH8A 2YFKA 1EP1B 1GD1O 1LVGA 5LMUB 1UDCA 1N7GA 2YXEA 1C3EA 5ADHA 5JTTA 4H3KB 2HFJA 4A5OA 1PGJA 1US8B 1UINA 4HEQA 4LPKA 2GESA 3EOZA 1P7VA 5HDQA 2VPQA 3V8RA 1TK2A 5D6NA 3L05A 2JIPA 1BMTA 1EX1A 1FP2A 3PE6A 4M53A 4N47A 4LRYA 1G66A 2HT6A 1NPYA 2F3RA 4RNDB 1QIGA 4BUJA 1B8NA 4B17A 3EAGA 4KVFA 1GZ5A 1K6MA 2FFHA 2ZFUA 5KCMA 4PZEA 1KZHA 4FZRA 3IE1A 2P6RA 4EY3A 1ZD5A 4OHZA 3ONEA 1R5NA 2Q9UA 4O25A 2JAOA 5BNFA 2YZNA 4BWVA 1G4AE 3OKCA 3J7TA 4JI6B 1R8JA 4DY6A 1RIIA 5IF3A 4NP6A 3GT0A 5EE0A 2GSWA 2YV5A 3IAS1 3UKJA 3WP0A 2XTNA 3O7WA 5BW5A 1B8VA 5BW4A 4OQXA 4F6LA 4G63A 1NXXA 1P7CA 2ZI9A 1F2DA 1KEUA 3R40A 2ZSEA 5KDLA 1C1DA 1BE0A 4ZEVA 1GKUB 2ZROA 1H3EA 1AF7A 4EH1A 4S3MA 1MX9A 4HGPA 4U39A 2BUAA 1L5HA 1JTVA 3ENQA 1PK8A 4I08A 2MTBA 3CRNA 2WWTA 3TTYA 2PZJA 1LI7A 1SHJA 2WKRA 4PYMA 1Y8RB 4IS3A 3ZGZA 1N2XA 2DHQA 4E5NA 2CDAA 3OIVA 3R7FA 4DILA 2C5EA 5HMMA 1SXJE 1GN9A 1QK3A 1HE8B 1Z82A 2E37A 3UEOA 4M83A 1CZOA 2QROA 4ZVKA 4INPA 1KVSA 4B7ZA 5FUWA 7YASA 3ZBPA 3VYTB 3PUWA 3VH2A 4CR8A 4JA2A 5JARA 1E62A 4LOHA 4RPKA 4RMJA 1PZXA 3LV8A 1YR9A 5AW6A 1TKBA 3HLTA 4MPPA 1Y9DA 1JQLB 1X7XA 3E22A 3NC0C 5KQMA 4TTAA 5ESRA 3TRFA 4AIRA 3NKLA 1SU7A 1V0JA 1WBJB 2NTNA 1Q0HA 4CF3A 1Z0KA 3BZUA 2X15A 1FTGA 2MSEB 2VUTA 4FHDA 5CNMA 3DAHA 3JYHA 1RAHA 3PT5A 2EG9A 2QTGA 3WGJA 3A6PC 2JJYA 5IK2D 1XMPA 4PPNA 2QVBA 3MN1A 4RABA 1ECCA 5JE8A 2PQ6A 3RGWS 2H85A 4ZGGA 1E98A 5DISB 5C80A 1DU4A 3LLUA 3QFTA 3CN9A 2GK3A 1ZVVA 4WCFC 3MYRA 3H5AA 4HJRA 5E6SA 3DCIA 3SR4A 4F21A 2V6FA 4KGVA 3Q3CA 4ZK6A 5HKBA 4A15A 2R2AA 3EG9B 5HIMA 1A04A 3OEHD 3QLUC 1XPOA 2JNWA 3OUZA 4RCZA 2OC4A 4FILA 5CDUA 1D4FA 1YL7A 5KNBD 2FMTA 3DPUA 2R8XA 2WR8A 2Y1KA 3ZVMA 1KO5A 1CETA 1IUKA 1NLFA 1DXHA 1XCLA 2JIRA 2DETA 2FN3A 1MQAA 1X38A 1IZ0A 3LPDA 1KYQA 4DCCA 1YB6A 3BIFA 4MVJE 4NFSA 3IA7A 3B38A 3U3JA 2FEXA 4WBXC 2J3EA 4FHGA 2DPHA 1OCEA 4UM9D 1UZLA 2E89A 1XRRA 1SUFA 1YS1X 1ZMOA 2QTMA 2ZBUA 4LJAA 4KSBA 4CODB 2AN3A 3TMYA 2X23A 4P2GA 4IPTA 5DHAA 4AMYA 1PJZA 1HFEL 4HDNB 3IUYA 4I19A 4RDXA 2Q07A 1PSZA 2ZULA 5DEOA 1SA0B 2YJ3A 3KHKA 1EINA 4LOLA 3WC4A 2J41A 2E82A 4PIVA 2BMDA 4OSEA 4MHTA 5JO9A 5JBNA 2QQ0A 1LPOA 1Z06A 4D45A 3EEIA 3U3OA 4DIEA 2DWQA 3LUHA 5IJ9B 5CYPA 1UXJA 2FPOA 4AXBA 1ONOA 1RWMA 3USCS 2AZTA 2VJNA 3E2IA 4I81A