2A5GA

Cholera toxin a1 subunit bound to arf6(q67l)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
molecule keywords ADP-ribosylation factor 6
total genus 53
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5gA00
4Q1BA 3UIEA 1YE8A 1W0JD 3TR0A 3IPXA 4NKRA 2HEIA 4GOJA 2A5GA 3DOFA 4O25A 5DH9A 2NPIA 2GRJA 1ODFA 1VECA 5BYJA 2UVQA 2ZSBA 4TMWA 3RAPR 5JI3E 3L2OB 3N2IA 5FTNA 3ND8A 5CIQA 4AC9A 721PA 3B1ZA 4PQYA 2DWQA 2ZANA 1N6KA 2WKPA 1JQJC 3LO5A 3NDPA 3HU1A 5J5CA 2ZRLA 3OE7A 2OCYC 1VDZA 1QRAA 3C14C 4DJTA 3ZS9A 2CLSA 2W6JD 3JVVA 4KCGA 1G8PA 1KDRA 3TKLA 5FOTA 2ZEJA 1NLYA 1A5TA 2VP5A 3KKNA 1JQLB 4PPFA 3BH7A 3IEUA 4Q1FA 4CZ2A 3K9LA 2F1IA 1W4RA 1SVIA 3LA6A 3U7HB 2O8BB 3W6PA 3I5YA 2KSQA 3B85A 5FUVA 4YDHB 1QVRA 2QBYA 4ACBA 4B35A 3L8ZA 1OKKA 2ZRGA 1Q21A 1XP8A 2FGJA 1KO5A 2ZITA 1G291 1SHKA 3SNHA 3WBJA 4CT4B 4OQMA 1G41A 4BLSA 2UZIR 2JIZA 5JLJA 2YWFA 4E07A 1XTJA 1TPZA 2A5DA 3EWSA 4GP6A 4XSGA 2ZREA 1G3IA 3TUJC 3FHTA 2VSFA 1TU3A 2JEOA 2OCPA 4V0ME 1Z28A 5KNCA 3M1IA 2VO1A 1IY0A 2VP4A 4RVCA 1NJFA 1RZ3A 3IEVA 4LHZA 3KXIA 3KQKA 2AD5A 2MMGA 1ZUIA 3UG7A 1YJ5A 3K0AB 2IYQA 5CB8A 2V8OA 3OEEA 121PA 4IFEA 1MO6A 1CBUA 1DAHA 5TY0A 1ZM3A 4TLEA 3U7FB 4E5UA 2O8CB 1UEIA 3K8YA 4G5RA 3EA0A 5F98A 2VPPA 1Z22A 4LJAA 3A1UA 4JS0A 4LSGA 4G3XA 1CJMA 1DE0A 4A6PA 1E9RA 1SVWA 3EWAA 3HR7A 3FWYA 4DLWA 4W5JA 2RAPA 4D0GA 5IRCD 1UEJA 1LNZA 4PR0A 4RZUA 1CF4A 4NYMQ 4X8LA 4AKGA 4L4UA 3I1FA 4PAQA 4C4PA 5FUXA 1OXUA 1WBBA 1YZNA 3IHWA 3RS3A 3M0EA 2OM2A 4WZ6A 3X1YA 4QM6A 4BLTA 3F0TA 5JBQA 4QOSA 1G5PA 4OQFA 3X1DA 4EQ6A 2HXYA 3L0SA 3GLIB 3QKTA 1FUUA 2CK3D 3LWNA 4XJXA 2WWXA 4BWYA 4M1MA 5FBWB 4IVQA 2QUZA 2KBFA 3SQWA 1U0HC 2MSCB 2QNRA 6Q21A 2ANBA 1XEXB 1M2OB 1DG3A 2OLJA 2WMOB 4L9WA 5AK0A 4IEEA 3KJHA 4B2PA 4TT3D 4C0BA 1AM4D 3TK1A 2JJ2D 3Q72A 1VYVA 4IVRA 3B1WA 3T34A 4DXAA 1QHSA 2QPAA 5AJVB 2ZRDA 1KI3A 3NBZC 4JVLA 2QRNA 4PC2A 3BC1A 3WNCA 1G3MA 3CZPA 3ETLA 1EG7A 1G8HA 4DSUA 1R0YA 1KO8A 4M22A 1ZCAA 1D9XA 4EFNA 1S0UA 3L0PA 2QQ0A 1VHLA 2JLVA 1P75A 1R5BA 2RGAA 3BFXA 1OLOA 2IS1A 3SJAA 1G17A 1ZUNB 1TQ2A 2EFCB 1SXJD 3D31A 4LBWA 3W9YA 1B23P 1EFCA 1EWQA 4BASA 3K9GA 1BS1A 4DCTA 3N5CA 2QT1A 4PHHA 1TU4A 2WIBA 4EPVA 1JR3A 1W4CA 3PEYA 4Q4AB 2BM1A 1SVMA 2H57A 2XNSA 2ANCA 3SOPA 1LY1A 4EPTA 2REBA 3NDBB 2HJGA 1IM2A 1YR6A 1T0HB 1YR7A 3PUYA 3QE0A 2AX4A 1EX7A 2CL7X 4JLNA 4RD2A 3AM1A 4GL2A 2C03A 3AQ4A 1W48A 4PC3A 2IK8A 4URXR 5H1YA 5KPDA 1GL7A 1TEVA 3E70C 2ZI3A 2O8EA 1LF5A 2Q9BA 2W6JA 3LXXA 3NC0C 4KSCA 2WWHA 1UFQA 5ELXA 2P6NA 4DIDA 1G7TA 4QJ5A 4AKIA 2DWPA 1FZQA 3WXMA 2C9CA 2ZJ2A 1AGRA 5C4MA 2OBMA 3CNNA 5F3WB 3I73A 3IO5A 3CH5A 4BLRA 1E0JA 3SJZA 4FWTA 1A4RA 4PSAA 2ZPTX 3SQXA 1OB2A 2ZSAA 4MYTA 2ZI7A 5GJBA 3SYLA 5C46F 2UZ3A 2WWWA 1MABB 2R62A 5J47A 3PQCA 4R2HA 5DYGA 3L0OA 3MLEA 2X2EA 2QAGC 4NCJA 2K5UA 5FTJA 1D2EA 3SJBA 2YYZA 3NHBA 2O8BA 4JSYA 4BGDA 5DYIA 1PZNA 5A0FA 1HT1E 2BMDA 1N5JA 2ZTSA 1S4QA 1N6NA 3X1XA 1E32A 3KQNA 4P4SA 2NO9A 3PUVA 2YZ2A 1VTKA 5KDLA 3LX8A 3UK6A 2GF9A 3LAWA 1XU4A 1NG1A 4PX9A 3ASYA 4EJSC 1UDWA 2JLQA 1IY1A 4NU0A 3D3QA 1XMVA 1XCMA 4LBVA 5EUQB 4IDQA 3TJZA 2ZR0A 1KMHB 2XXAA 2ZJOA 1PJRA 4Q03A 2XSZA 1RYFA 3KXLA 821PA 3P26A 1E3MA 4Q1DA 1CR2A 2ORIA 2X77A 3IIMA 1KI6B 4P3YA 3T1QA 5A5GA 3F3YA 3AVPA 4HZUA 4TQUS 4TN1A 5BN3A 2DCUA 1W0KA 3I61A 4QGGA 2F9MA 2QT0A 5DIFA 4NYJQ 5KYKA 1ZD1A 3KB1A 4R9UC 4MKFA 5JJIA 3GJ6A 4MGYR 4RFVA 2ERXA 2C98A 5FUYA 2IX3A 1T0JB 1M8PA 1XXHB 4D4LA 3RVBA 5FTLA 4OK3A 2SHKA 4KYIB 3REFA 4A8JA 4XH9B 3S1AA 3B60A 4JBXA 2CJWA 1TNDA 3UMFA 2ZR7A 2WJIA 2CK3A 4NMMA 1F2UA 4NYMR 4PQRA 4MYHA 1JECA 1XZPA 2ORVA 3WBKA 3AVWA 2HYDA 4XSHA 1RE0A 4GFDA 1G7RA 3VNVA 1OFUX 4Q9HA 4CEJB 1II8A 2AFIE 4OQNA 5P21A 2GVZC 2ZVQX 1UKEA 4B6FA 4WXRA 2WVJA 4QFMA 5EE3A 1M1YE 5EZ6B 3SBDA 3F8TA 1GKYA 5CK5A 4DT1B 1BIFA 4WAUA 4QBFA 3DM5A 2Q9CA 2IYZA 2ZUCA 5BYKA 3JZAA 4C3ZA 2ZYUX 4DEXA 5DLQC 3TAUA 4KHZA 4RCYA 1Q1QA 1JB1A 1N5IA 2P6UA 2WJJA 2QE7A 4C2UA 1A7JA 4HUQA 2BEKA 4LYJA 2I4IA 4YDSA 3FKSD 1OYWA 3O8DA 2CMKA 1WP9A 1R5NA 3EXAA 4BLQA 2BV3A 4HUTA 4NBSA 4PZLA 3CNLA 1GL6A 1JEDA 3Q8XB 3CRRA 4ILEA 1O3YA 4XTRA 3K0FB 5HZHA 5TMPA 3RS5A 4ACAA 2ERYA 4B48A 2RGNC 2G1KA 2C9YA 2KI5A 3OZXA 3WP0A 1KKLA 4KSBA 3ASZA 1XPRA 1W5SA 1T8UA 2O8CA 5DHAA 4D80A 4AYXA 2O0JA 2A3RA 2C95A 2DFTA 4U5XA 1GFIA 3WHKA 2JLRA 2JA1A 1P6XA 3KJIA 3KX2A 3GCGA 4KXFB 5FI0B 3AVXA 4C0QC 2J87A 4HLQB 2IF2A 1U8ZA 4TLDA 4NCNA 1D8TA 4EUNA 2IL1A 2O0KA 2AXNA 3NXSA 5L3QA 4K81B 4DLRA 2C99A 3VX4A 3CM0A 4HATA 1YZQA 2BCGY 3CX7A 4Q7KA 2N1BA 3QG5A 1KHTA 3WRYC 3PUWA 2CBZA 2CHGA 4G01B 2OG2A 4TWZA 4KLNA 3GLFA 5AJYA 3K70C 1KYIA 4B3CA 3W3AA 2HLDD 2B8WA 2A78A 2WJYA 4JYCA 1Z47A 4QG7A 3M4YA 4AY2A 2WZQA 2NOAA 2V7QA 4S2EA 1QF9A 2B92A 2OEPA 3CRQA 3U7EB 1XMIA 3C5HA 5DISB 3QVUA 1GM5A 3CBQA 4DEYA 3P1JA 3TLXA 4US2R 2EWVA 2P5SA 2QENA 3K0CC 5DN6D 3R9WA 2RB4A 5JRJA 1Z07A 1LS6A 3LQQA 3UATA 4TYPA 1FX0B 3SDZA 2D7DA 4EDHA 2O8DA 3I32A 5HE8A 3THXB 1N6IA 1GDDA 4KO8A 4R2IA 3W3ZB 4FN5A 1R4AA 4IKEA 3OEHD 4QHSA 1NP6A 1H8HA 2GAAA 2GJAA 2ZVPX 1XB2A 2YWHA 1CJUC 3X1WA 3TSWA 1YZLA 1X8LA 1U2RA 5EXPA 5FI1B 2V6JA 2E9SA 2C8VA 2DFKB 2BC9A 3BERA 3J81k 3A4NA 5G40A 3SEAA 1HY3A 3LBIA 3OIUA 3IUYA 2NPFA 1JR6A 3RRNA 3DMDA 3VTKA 1CRPA 3A1SA 4OJQA 1DO0A 5JS7A 1BMFD 5BXQC 2ZU6A 3PIRA 2DWOA 1OF1A 1R0ZA 3QKSA 4DCUA 1UPTA 1W0KD 2YWGA 3BH6A 4I4LA 4OKSA 2G9NA 1D2MA 3VR2A 4DDTA 4JL8A 5KUTA 1YQTA 5L8VA 3IQWA 3LV8A 1TQ6A 1L2TA 5J4VA 3MRSA 1AQYA 1IAQA 2GNOA 3AP2A 3I4LA 4HAUA 3RNLA 2VHCA 2OAQ1 1UF9A 4PHFA 2QMUA 5L3QB 5CLQA 4TL6A 2GEUA 1ZJ6A 3L8YA 5F9HA 1DELA 2ZS7A 4JLDA 4A2PA 1G16A 2RHDA 2RMKA 2WMNB 3AP1A 2XZLA 1AKYA 3GLGB 4B33A 5K8IA 1YZUA 3AH8A 2FFHA 2W2TA 3W8RA 2WKQA 2W2VA 3F5FA 1RJ9A 1ZVQA 2DY1A 3FMIA 2QQEA 1IN6A 3EARA 1J8YF 5FH9A 1IBRA 4OJKA 5HCIA 1KJWA 1NJGA 1Z0IA 1FUKA 3ECCA 1V43A 4MGZR 4A8JB 4URUR 4FD2A 1OJLA 1R8SA 2ZJAA 1KIMA 3KDSE 1H8ED 4JVSB 3B5JA 3AVUA 1PUJA 3CRVA 4DLYA 3L82B 3PJRA 1JPJA 3FHOA 3H86A 2CVHA 2P67A 4GDFA 1MT0A 1Z0FA 5BQ5A 5L3VA 1MO4A 3LQRA 2ZUDA 1DEKA 3MAAC 3QEOA 1WMSA 2E87A 4V0MA 1Z2AA 2AHOA 3A37A 2R2AA 1E2QA 3RYTC 4PHGA 4WW0A 4FMDF 4I99A 3WYFA 1KO4A 2NZ8A 1HUQA 4QHYA 4BFVA 3TQCA 2RGCA 3Q85A 4MGKR 3TE6A 2CE2X 3BIFA 4Q5IA 221PA 1IXZA 3DHWC 5DHFA 3AVQA 3IO3A 5TARA 4QM7A 3ZVNA 4I1OA 4G5GA 2EFDB 4TL7A 1NNEA 4LYFA 1KMHA 3A36A 1ZIPA 4GMDA 4RD3A 1HH4A 1RRGA 4CF7A 1OIXA 5EE1A 3FKSA 1E2JA 3C41J 5EP1A 1JPNA 1JI0A 5GJWC 4B3XA 2IYRA 3DVLA 4WZAE 1R2QA 1YRAA 2MMCA 1JXMA 1L8QA 1XEWX 3ZIAA 2OFXA 5K8TA 4Z1MA 1S8FA 1NN5A 1AN0A 1KNXA 1NLFA 3LLMA 3ZD6A 2BHRA 2BEJA 4HSEA 3EIHA 1EXMA 1XTRA 4OQLA 3T1OA 1Z0KA 4BE7B 2BM0A 2HUPA 4XVUA 4AURA 4EPWA 3GEEA 4PANA 1IQPA 3GEIA 1RVDA 3B1XA 3ZQ6A 4M9XA 4RY2A 3FGNA 4LPSA 3CUEF 3C8UA 2C04A 1XMSA 1II8B 2OO7A 2AXPA 5G3ZA 4XD7A 1SVLA 5HR5A 3GJXC 4W5HA 4EFLA 5BWMA 2X19A 3QPUA 5AR1A 1RJ9B 2VF7A 3C7KA 1G8YA 3FMOB 1ONBA 4DCNA 2ODNA 2J3EA 1LF0A 1L4UA 1SXJC 1LS1A 2XX3A 4B2IA 4KVAA 3BJIC 1M7BA 1ZW6A 1KDPA 3P32A 2ZJ8A 3T15A 4Q02A 2CVFA 3NEJA 1G6HA 1ZD9A 1K5DA 1S1MA 4ZCMA 4AKEA 2ZRAA 1TQ4A 4P32A 2CLCX 4QXAA 4BQSA 5A4JA 3LVRE 1KDTA 2PZGA 2XOKA 4PC7A 2OV2A 1FNMA 3U3OA 3EC2A 2IYYA 5DSZA 3E1SA 3R7WA 2ZI4A 3NIBA 5HPYB 1T3LA 2CCJA 2ZXUA 3X2SA 1X86B 3AF1A 3K0FA 1GITA 4KU4A 1YR8A 4F93B 4Q4JB 4F7WA 3MGCA 5LD2B 3FMPB 4MRRA 1Z6TA 3EPHA 4LUCA 4AKHA 4IXNA 4B34A 4WBSA 2ZSDA 1KZ7B 5FR1A 1RKBA 4RD6A 1HURA 2CLDX 2OE2A 2A5JA 2QGZA 4OK6A 4IJMA 1SULA 3GJ0A 5CDFA 1T6NA 4YMVA 5K8UA 5JECA 1V5WA 4HAXA 4ZDWA 3Q7QA 1KO7A 2ZRNA 3CNOA 1QG4A 1QHHB 4X8OA 4TLAA 1T8TA 2NGRA 2VA8A 1GWNA 3SZRA 4F4JA 3QBVA 4RZ2A 1GP2A 2FU5C 1PUIA 5G53C 4URVR 3K0AA 2VSXA 1C9KA 1Z6YA 2ONKA 2ZIAA 3O8BA 2D4HA 3NG1A 3CRW1 3K0EA 3HR8A 2F1RA 1QHGA 1W2GA 3ND9A 2EQBA 1FOEB 1MKYA 4LJYA 3VKHA 1P9NA 3U61B 1E4VA 4AG5A 3GLGE 2GXAA 1E6CA 2AD1A 3PVSA 1ZNXA 1CIPA 1TQDA 2JDIA 2DHRA 1K6MA 4N3NA 3E2IA 2WJGA 2F55A 4BFXA 3RS7A 4EPXA 1M74A 2R6CA 3OFND 2RHMA 2FWRA 1DOAA 4OI2A 5AJZA 2JLSA 5H70A 2JLZA 1XD9A 4DIEA 5EE0A 1P7CA 4ZDKA 1AGPA 3B2EA 2ZRIA 2BCJQ 3E5HA 1XTKA 3FFAA 3PEVA 4OBEA 1KOFA 4EKDA 2G6BA 2C9OA 4GBMA 3THXA 4JSTA 1CLUA 2OZEA 5HZKA 4TTRA 4NL4H 1VG1A 3GLIA 2NO7A 1J70A 2BMJA 5TB5A 1KSJA 1Q1ZA 4C9BA 1KNQA 1IN8A 1XX6A 4B76A 4U7DA 2VP0A 1CTQA 2GBLA 2ONJA 4OI4A 2FFBA 4V0LA 3T5DA 4BZQA 4Q9JA 2F3RA 4Q00A 1W4BA 4G5SA 4A8JC 4HDCA 2PL3A 3B9QA 3CR8A 5JZVA 4P4UA 5KSOA 3QVVA 3GJ3A 3WYGA 2JCSA 3K09C 4RD0A 1ZMXA 5LPNA 1XPUA 4DLXA 5EUMA 4ZI3A 5J4YA 2ZRKA 3AF0A 5J40A 4PPQA 5KSPA 3FB4A 3O8RA 5CK4A 3UXMA 4PAMA 4B32A 3ZGXA 5BN4A 5E7MA 1VCNA 4ESVA 4AYWA 3DOEA 3TSZA 3THYA 3VFDA 2IXEA 3TW4A 2J41A 3KKOA 1WDTA 4PPGA 1NN0A 1U8YA 3FYHA 2J46A 4O0MA 5E4FA 4BEBA 4XVQA 2NO1A 2H16A 3B1YA 3EG5A 4DLUA 1P62B 3MUFA 1AS0A 4UXIA 1OW3B 1LW7A 1G4UR 2G1JA 2ODEA 3DDCA 3H84A 3T1TA 4BFSA 1WBDA 2ZYTX 1GRQA 3RWOA 4BUJA 4B71A 1NBME 1T3HA 1XBTA 4G5QA 3TBKA 2HCBA 3PG5A 3A58B 1ZC3A 3V00A 2F6RA 4L15A 5LB2A 4D4KA 4NYIR 3MD0A 1G20E 2F43A 1EWRA 2XAUA 4LCBA 4XD7D 3OAAD 1RPZA 1UADA 1N0UA 2OLKA 5EE9A 2C78A 4FCVA 2GETA 4MUBA 2GK7A 4I1VA 4NP6A 1ZD8A 1SQ5A 1KSGA 3G82C 2Z43A 4H1UA 1ANKA 3KL4A 2ZYVX 3QF4A 2VP2A 3MFYA 5CM9C 1BYIA 5FL7A 1XPOA 3BB3A 3B9PA 4FCTA 1XJ0A 3BFVA 1OYYA 1ZNYA 1E1QD 4BLOA 1ZM9A 1OSNA 1CJVC 4YMSA 5FPKA 2RGDA 4IFBA 1ESMA 2PT5A 4TL8A 2QSYA 3KQHA 5FR2A 2O52A 2HF9A 3NH6A 1CXZA 4Q1CA 3U4QA 2ECKA 2RH5A 1CR0A 1OT3A 1TF7A 5DO9A 2GESA 3AUYA 2P0EA 3K1JA 1I4DD 2NO6A 2J45A 1N0WA 1SGWA 3MWYW 1AIPA 3EC1A 4Q7JB 3SU8A 4D0NA 3RS4A 1K5GA 1N5KA 3AB3A 5DI9A 1E0AA 3VR3A 4KLZA 2FZLA 4E22A 3UPUA 3SYNA 1XTSA 2FA9A 3TGPA 4JBYA 1NVUQ 1RW4A 2QI9C 3GJ8A 3NWJA 2R8RA 4O3MA 1P61B 2BOVA 2V1XA 5GADl 1VHTA 2WWFA 1ZP6A 4HB3A 1FMLA 4QJ4A 1QHYA 4F92B 4D81A 2ZI5A 4TMZA 4OI0A 3NHAA 3SN6A 4JL6A 1T3SA 3L0IB 4FMDB 4A92A 1EFRD 2PBRA 2HV8A 3QBTA 2KB0A 4HDOB 4JJZA 1XEWY 1L7VC 2XB4A 4M21A 5SZHB 5B58C 2Q0HA 3HU2A 2G0TA 2LKCA 3B1VA 4B3BA 1FPMA 1D9ZA 3VR6A 2YC4C 1BO6A 1HE1C 3AF4A 3P4YA 1YHNA 1HQCA 5FTKA 3OIYA 4OQXA 4L16A 5JWRA 5KPJA 1UBCA 2I1QA 4HZUB 1DAMA 2ZE7A 1G8FA 1UM8A 3IILA 2KWIA 5JRZA 2WIAA 4LV5B 4XWAA 4F4CA 1Q1BA 3Q5EA 3BORA 4MKGA 1E4YA 3CKLA 3U3JA 1NBMD 3BBPA 3LD9A 2X2FA 3BD9A 1ETUA 5FPSA 2YWEA 1VG0B 2IXGA 3OEHA 4XWOA 5IK2A 1IJFA 2IUTA 4JMPA 3S1AB 5SZJA 1QVAA 4QRHA 1TX4B 1Z83A 1F2UB 2ZRPA 5C1BA 5CLLA 4URWR 3ZLJA 2QY9A 3RANA 1NRJB 2WICA 2Q3HA 2HT6A 2R6FA 4UXHA 5FPYA 3R7WB 1Z0AA 3DM9B 4HAWA 1BH2A 1SXJE 5UKDA 1XTQA 4Q48A 3ZZTA 4CT5A 3K9HA 2JLXA 4O2RA 2EW1A 3R20A 3HPQA 4Q4JA 2AKAB 1XFAA 1NSTA 1FP7A 3P20A 2QP9X 3GLFB 1BKDR 1KGDA 1SKYB 1KAGA 4KI0A 1CKEA 1GNPA 4IOKA 5SZKB 3PUZA 4GPTA 2B21A 4MKHA 1MRNA 3NC1C 2ZE6A 2C96A 2P3SA 4H1VA 3U2QA 4EPYA 4JVMA 3U3MA 2QTHA 1Q20A 1RRPA 5BN5A 1E9DA 1W49A 4CYMA 2FV8A 2VIIA 5IDVA 2BBSA 3MJHA 2A9KA 3QY0A 2IS6A 3HP1A 3LFUA 4JYBA 1B0UA 4B3DA 5EP4A 3ZVLA 3BWDD 3PUXA 3NBYC 3TR5A 4AYTA 4V0NA 2CCKA 2ZETA 4L8GA 3I8XA 3B78A 4LYAA 4UNSA 1UBEA 1W1WA 4DHEA 2F3TA 1P5ZB 4TYYA 1DO2A 3NEYA 2FPMA 4IOJA 3GPLA 1GL9B 2VF8A 4PFSA 5FTMA 4HEJA 2RGGA 4M1YA 1JAHA 4UNRA 3SFZA 3ICQB 4GMXA 1XEXA 1GSIA 3CF0A 1XXHE 3Q7PA 4EJSB 5JFGA 2IYXA 4TMTA 2IW3A 2Y8EA 1DS6A 4PSKA 4DVGA 1K8RA 1OKKD 2WJHA 5FPTA 5LB4A 3LH5A 4W9MC 2QMHA 1SHZA 3QENA 4BPBA 4AIIA 5CYPA 4ZKDA 2ZSFA 5FUWA 5DN6A 1I4LD 1Y63A 3N70A 3AKYA 3LVQE 3DMNA 1JNYA 1XZQA 3CONA 3MG9A 3OIVA 2GBLC 4D26A 2P2LA 4DDWA 1JEEA 1D2NA 4KYUA 2A2ZA 3UG6A 3QF4B 2XB2A 1JBKA 2E1RA 3O47A 4XIGS 4EAQA 3OESA 5FL7D 3EPKA 4TL9A 4HLUA 4BFUA 4L9SA 1M34E 4CDGA 4M9QA 1P2VA 2MSEB 1RFLA 5JHGB 1R0XA 4Z8YA 3A4MA 3EZ6A 4Q9LA 3GLGA 4NH0A 4OHZA 1F48A 1KI7A 3EAQA 4YONB 1BMFA 2ZQ5A 4N1AA 2J5XA 1EFRA 1U8AA 4LJ7A 1KSFX 1BYUA 4FMBB 1GRRA 4IVPA 1BOFA 2OT3B 1ZRHA 4IDOA 4QGFA 3UMRA 2AK3A 1CULC 1KY2A 2QORA 3GJ7A 1A1VA 3BAFA 1NMXA 2Z4SA 2D2FA 2J7PA 4ZCIA 3HWSA 2O8EB 1GZSA 1S1CA 3BH0A 1FQJA 1E2MA 1MOZA 4YXWD 2REOA 1QG2A 2W58A 4NDZA 2VH5R 4LV8B 2DFLA 2IEYA 3CF6R 5AJWA 1E2PA 4TTPA 1VPLA 4PXAA 3THWA 4C0LA 4D2IA 2WWIA 3HJNA 4FW9A 2OCAA 1IY2A 2N42A 4PO9A 1VIYA 1KK0A 5JS8A 4RD1A 3BS4A 1IXRC 2N46A 3H4MA 4IHQA 1RRFA 4GT1A 2ATXA 5EE5B 4DB2A 4TT3A 5DI3A 2FFQA 3K53A 4DLSA 4XTCS 4B3FX 4WZBE 2QM7A 2W6IA 3CH4B 4EJSA 4JJKA 1E9AA 2O8FB 5GVRA 4TLBA 2BKEA 2VHTA 1KI1A 3GJ4A 3I92A 1ZC4A 4V0OA 2J7KA 3MCAA 5KTYA 5IHPA 2J0SA 4CW7A 2GCPA 5F2EA 1OFHA 4M9SA 1Y3AA 1YKSA 1W0JA 1XD2B 3N2EA 2QN6A 1XTIA 4IDPA 1UKYA 3QIAA 3ZYCA 3BOSA 4RKFA 1W36B 1TF5A 3IKJA 1KI9A 3K09A 2R9VA 4ZIRA 3I5XA 1EESA 4AD8A 5H8WA 3FMFA 3KKMA 2PJZA 4MRSA 5FFMA 4A1FA 4EFMA 1CP2A 4ASUA 4A6XA 2VHQA 2IUSA 1S3SA 4Q4LA 4QHTA 4YMTA 4ZV4A 3FHCB 2G3YA 1E9EA 4P0TA 1E1RD 1DAFA 3FDIA 2FSHA 1NVXQ 2ZM5A 3W8NA 4FMCF 1W2HA 4ZO4A 4DC9A 3ADCA 3DO6A 1KI2A 2IYWA 2VQSA 4Z1MD 1F6BA 2OHFA 2ZRJA 1LV7A 1PV4A 1JR3D 1U94A 2I3BA 2D06A 4A82A 4MITA 2BJWA 1YVDA 1IXSB 2QAJA 5EQTA 4TSFA 3CZQA 1U9IA 4MGIR 4MRVA 2OXCA 1EK0A 3GLHB 5L3RA 4R98A 2QM8A 1G1MA 1Q1EA 1TTTA 4LHWA 4GNKA 4HLDA 1MABA 3LLUA 3KQLA 1OB5A 1NKSA 3BE4A 4Q66C 2YC2C 1R5OA 3P27A 3SFVA 1PLKA 2GXQA 3KUCA 5FBQB 4A15A 2G83A 4Z8XA 1DG1G 3WNBA 1R7RA 1HYQA 4M1TA 3UKDA 4LOAA 3JZMA 1KMQA 2BBWA 4URYR 2WPDD 3LNCA 1MO5A 3LX5A 1N0VC 2VBCA 2VLIA 3AVOA 4YLGA 4B47A 2ZJ5A 1GNQA 2ZRBA 2GCOA 1FMJA 3ZZUA 1O87A 4A36A 3GJ5A 2AN9A 4FXPA 3V4RA 3QKRB 2ASEA 1E9CA 1Z5ZA 2BWJA 4R7ZA 4LWZA 1II9A 1Z3IX 4MUAA 5C2JB 5H68A 1XRJA 2VP6A 1AQUA 2QPTA 1KTVA 4C7OA 2PLFA 3RS0A 5AUNB 3DKPA 3RS2A 4TZ6A 4HLUC 1YR9A 2ZUBA 2YKGA 2TMKA 1W44A 2QZ4A 4A0RA 1E2NA 2QE7D 3CX8A 1Z0JA 4UQOA 1M7HA 3HU3A 1COWD 1VCIA 2VYFA 2IUUA 2GVDC 2PEZA 5B30A 1D6JA 5KDOA 1P9RA 3OHMA 1GKUB 1IN4A 3BGWA 3GMTA 1E2DA 2DYKA 2J0UA 4HB2A 5TV2A 3C5CA 4Q1AA 1RIFA 2XTNA 2NQ2C 1YZGA 1VG8A 4RD4A 4QGHA 3W5IA 5JEEA 2R6GA 4JLMA 4PQFA 1SVKA 2D3WA 2HLDA 4V03A 2PEYA 2PX3A 5CITA 1G7CA 4X8HA 1VCOA 1NVVR 3LXRA 4B44A 5B64A 2OBLA 4G5OA 3K70B 2ATVA 1XCGB 2H1LA 2BDTA 1E98A 1DAIA 3B6EA 5D3QA 4LDJA 3U3KA 3K0SA 2R44A 3FOZA 1XJQA 4Q9KA 5FOSA 1MH1A 4KODA 4TMXA 2RGBA 1NIJA 1NN1A 4GOKA 3HDTA 4A2QA 1T4GA 3THOA 5EXTA 3BFKA 4GZMA 4LBYA 2XJ4A 2ZS8A 3GD7A 1KO1A 4LJ8A 1CRQA 4B3GA 621PA 1N2CE 1NY6A 2HCJB 4KFRA 2GILA 2FSGA 3RSOA 3GP8A 1HQYE 2ORWA 1U0JA 4NONA 2ZJBA 3PXGA 3V4FA 4D0LB 3T35A 5JEDA 2OFOA 2H18A 2JLUA 4JLPA 4Q9IA 4FMCB 4PC6A 2GCOB 4XVRA 4DZZA 4HAVA 2PLRA 1Q3HA 2ZE8A 2IWRA 2FX3A 1G3RA 1GUAA 1E99A 1VYTA 1SVSA 4CRWB 3NTUA 5AJXA 1XD8A 1Z8FA 4X8MA 1U81A 2HYIC 3DL0A 1KJYA 1AZTA 4LC1A 4LJ9A 4HAYA 3AEZA 2OXRA 2NTYC 2Z0MA 3DZDA 4IRUB 3BB1A 3PR1A 4PC1A 4DLVA 2W83A 2QEQA 1P2SA 2GA8A 3IGFA 4Q7MB 4UNPA 2GDJA 2O8FA 4BEJA 3T5GA 4C0AC 1Z6GA 1NKTA 2A30A 2PX0A 1IN5A 2B8TA 2XTZA 2V9PA 3KB2A 3R8FA 2ZI6A 3SC3A 4RCZA 5B2ZA 8OHMA 1MRSA 3CPJB 2AL7A 3TW8B 1NMYA 2XZPA 1XD2A 4TMVA 1FNNA 2IC5A 4DDUA 2OSBA 4BECA 1U9IC 2VHUA 3A8TA 1UKVY 1TL7C 3MWKA 3NH9A 3MSXA 3ICEA 2B7CA 1E0SA 1GAJA 3B82A 2WAXA 2OFWA 4LJ6A 4M0LA 4A0GA 4M8NE 4NPHA 4LC0A 3TNFA 4YMUA 2ZS9A 5JCPA 1GKIA 4B2LA 2ZJZA 3R9XA 4ASUD 1PLJA 2D7CA 4RZ3A 5L3SA 1E2EA 3CX6A 4DSTA 2REXB 4EPRA 1LFDB 2YV5A 3VQTA 2YNMA 4JZKA 1OXSC 4QNMA 1DAGA 1PLLA 3PV0A 4RFSB 1R0WA 4AG6A 4HYYA 2EFHB 1P3JA 1Z08A 2PJRA 1ZUHA 2C2HA 1FX0A 2FJUA 2WM9B 3IPYA 2YHSA 1NF3A 5HKKD 1ZU5A 3RABA 4ON9A 5GJVC 1HT2E 1ESNA 1WF3A 4Q18A 4ZPXA 4CEHA 3MWJA 1XEFA 4C0JA 1N6OA 1JAIA 4A2WA 2V7QD 1UAAA 4M53A 4Q21A 4LYHA 5KOYA 2IS4A 2NIPA 3HYTA 1HV8A 1E9BA 3OE7D 4Q19A 1Z6AA 1QHNA 1KI4A 2GAOA 2WSSD 3FVQA 2C77A 3VU9B 5DI3B 4W5WA 2GZAA 1EX6A 4GZLA 4QL3A 3CB4A 3LW7A 2FOLA 5ANRB 4CGZA 1CR4A 2JATA 2ZROA 2RGEA 3U5ZB 4A4DA 3TMKA 2VEDA 4LBZA 4F4IA 2GWHA 3ZS8A 1E1QA 3WNDA 1E9FA 4J0QA 2YOHA 4Q1EA 2IYTA 2ZYWX 2ZE5A 4IXMA 2F43B 1PVOA 4GOXA 3TAHA 1OXXK 4UNQA 3ZH9B 1W36D 3WMFA 1N5LA 1TUEA 3EW9A 2PMKA 1OH7A 1KK1A 4JL5A 3U7GA 2WAYA 4RZXA 2FDCA 1JALA 4LGMA 4B74A 4LV6A 1SKQA 2JASA 5EXSA 1CJTC 4II7A 3EPLA 3QXSA 4TLCA 2IHYA 2XNDD 5HE9A 4V02A 1CR1A 3GEHA 1XCPA 5JWOA 4A9AA 4Q4AA 1N6HA 4KFUA 1J7KA 5EZ5A 3B13B 2GEDA 3AGPA 5KNDA 2XXAB 1FTSA 4W7SA 1KK2A 1D5CA 4TYWA 1TMKA 4HB0A 2CL6X 4QBIA 1MR3F 4RKEA 1E2GA 1KI6A 4NCIA 3QI2A 4JKIA 4KFTA 1GNRA 2CEAA 2GKSA 1SVOA 1HA3A 2AR7A 3WYAA 3SI7A 1N6PA 1FFHA 3ZD7A 1YZKA 4Q47A 2JLWA 2FEOA 3SE0A 1F60A 3QQ5A 3LRPA 4PO8A 3SHFA 3U6BA 1Q12A 4MQBA 2V1UA 2CNWA 3Q9LA 1G6OA 3ZDQA 1VCMA 1U99A 5KNBA 2JJ1D 2CJWB 4JLKA 3EA5A 4NHOA 2HJVA 4JT4A 4DUGA 2ZI9A 1VKJA 2HXSA 5GVSA 3BK7A 5FBVB 4FI3C 5E3HA 1A82A 4CEHB 2L0XA 4YMWA 1E96A 4C0KA 3K9NA 1E2LA 3FKQA 1OHHD 1Z2CA 2H7VA 4Q4HA 2EU8A 4BFYA 1Q44A 4MRNA 5FBLB 3IBYA 3KKPA 1E2IA 1Z29A 2JGNA 2NG1A 5IK2D 5JJKA 2FE4A 2F1HA 2VRWA 1KAOA 5E7IA 1E2KA 3AGQA 2HT1A 4I81A 1OIWA 4M1SA 4QKQA 2WTUA 4QJ3A 3VHXA 5G3YA 2YVUA 1QBKC 3SYKA 3WHLA 2XNDA 2AFHE 1US8A 4KITB 3CIOA 3GLHE 4AK9A 2FSFA 2H92A 4MKIA 4XOIA 2GJSA 1EFTA 5KDDA 1DTSA 2IWHA 3KJEA 1P4SA 2J0UB 4GP7A 4NCHA 4OHWA 4F38A 5J4KA 1HTWA 1I4TD 2V4ZA 2Z6VA 4NE2A 1X1SA 2O5VA 2QBYB 2QP4A 4OI1A 4C0SA 2LWIA 1P72A 3KUDA 2PH1A 2BIFA 2F1JA 3OAAA 3H1TA 1WXQA 5FBRB 2CL0X 3B8HA 1CS4C 3W90A 3FFBA 1ZIOA 4Y0VA 4YXWA 2BBTA 3ZIAD 3VNUA 1GG2A 5CJ2A 3VKGA 1KZGB 2XTMA 4ITRC 3TQFA 4ZDIA 3QSYA 1X8JA 2WHXA 2GTPA 1E2FA 4HDQB 1T9HA 3EZ7A 4JBWA 4TYNA 4EIWA 4IEIA 4E03A 1P60A 3TVTA 3WMGA 3WY9A 3A1TA 5D3MA 5HKKA 4UKDA 1TAGA 3DZ8A 5DE3A 1F2TA 2J0QA 3W34A 2J9RA 2W00A 3NBXX 1NIPA 4OK5A 3C16C 3MMPA 3QKUA 4US1R 3DPUA 4HB4A 1EFUA 4TQAA 1GIAA 1E79A 1T5IA 1DBSA 1ELOA 2QL6A 2BVNA 5F9FA 4GRAA 4DT1A 4IOLA 2RKOA 5J4HA 4ZDJA 1OH8A 1J8MF 4JKYA 3QG1A 4KBGA 2B7BA 4IOMA 3PENA 3QPWA 5IF9A 1AA9A 1NVVQ 2OAP1 4CEIA 4Q4HB 4JLJA 3W6NA 5KO2A 4H9GA 3OIWA 2XJ9A 4TYQA 3TSOA 3VX3A 3VU9A 5KHOC 2O8DB 4EQ6B 4G0NA 2G77B 4DKXA 2CHQA 1NL3A 2V55B 4NCKA 1W5TA 3THYB 4POAA 3ZVMA 1US8B 4GI7A 3CPEA 4M2LA 4JT2A 3I8SA 5C18A 1WCV1 2WOOA 3MJRA 1VYUA 2FNAA 2Z83A 2VP9A 2EVWX 4ZKEA 1II0A 1OIVA 2Z4RA 3AV0B 3RSLA 1WB9A 4DLZA 2DBYA 2ZRMA 3VKWA 2PT7A 3T1VA 1GTVA 2P65A 2YINC 3FTQA 4OHYA 2J7PD 2IYVA 2ZJYA 4WIAA 3A1VA 4Z54A 4CIDA 2GK6A 3EPJA 1R6BX 4BLPA 2WKRA 2J59A 3GLFE 1GVNB 2QMEA 3QEJA 1SZPA 3R8CA 3CW2A 4ESHA 3ADDA 1C1YA 4WA7A 3I62A 3LBNA 4B73A 4K46A 2CXXA 2HDNB 2NZJA 3LBHA 1E79D 3X1ZA 1E69A 1OV4A 3AVTA 1G64A 4TQ9A 4YQFA 4IDNA 1J2JA 2J1LA 4ABYA 5JMTA 2R65A 4DUGD 5LD2C 4ZIRB 4B6EA 1F2TB 3C4JA 1ZNWA 1W36C 2YOGA 3ZZ0A 1W7AA 3ZJYA 2QA5A 1GILA 4Q7LA 1RRCA 1G19A 3EZ2A 3TRFA 4A0HA 4PZZA 3A4LA 1Q22A 1G3QA 1G5TA 2FEMA 4FCWA 1Q3TA 3RHFA 3ZQJA 2JIZD 1H8HD 2X1VA 4LY6A 1FTNA 3BXZA 2IYLD 3AF3A 1WA5A 1P2UA 1ZCBA 2MSDB 4URZR 3OFNA 3P4XA 3REGA 4D6PA 4F91B 1M6NA 1HEIA 2XZOA 2KJQA 1XF9A 1QHIA 4PO1A 2VHJA 2GEVA 2LCFA 2XITA 2IXFA 3CF2A 2FG5A 1DAKA 4DRZA 4LPKA 5FPHA 4DDVA 4BZPA 4C2TA 1COWA 4MYCA 1IOZA 4B43A 4DCSA 2ZRFA 4D4MA 1YZTA 1AK2A 1DPFA 1X3SA 3QKSB 3AP3A 3KTAB 4MH0R 4KAXA 4BZXA 1S3GA 5JJLA 3AKEA 1E1RA 4G1UC 3G0HA 5DNYB 4BFTA 5FOVA 5E7JA 2IHBA 2FF7A 4S35A 1Q0UA 4TMKA 5EJEA 2H8KA 3DEFA 1DVRA 2QAGA 1IN7A 1VG9B 1W47A 1NBMA 2DR3A 5G41A 1NY5A 3PEUA 421PA 4YC7A 2R6DA 2V54A 1LVGA 4DB4A 3ZVRA 1GOTA 5JSZB 1VMAA 3SHWA 3UANA 1G4AE 1S9HA 3A1WA 3CWZA 2CCGA 2IYUA 2V6IA 3AKDA 3QOFA 3RDPA 3H0KA 2GJ9A 1IHUA 3V9PA 4HI0E 3T12A 4ZCLA 1FL9A 2BMFA 2WPDA 4WOPA 1TEXA 1XNJA 1OFTA 5HTKA 4BRWA 5CB6A 3AVYA 2ZSEA 2F9LA 1UBFA 2CE7A 3K0CA 4P4TA 1TADA 3RRZA 3Q5DA 2QMOA 4GSYA 1CJKC 1LTQA 2W0MA 2FZ4A 3EZ9A 3QPVA 4D82A 4US0R 2NO0A 1ZM7A 1CU1A 1LB1B 1WQ1R 3GLHA 2OILA 5D3MB 5J4LA 2VSOA 3PFIA 1DARA 1J99A 2QROA 2RCNA 3UWKA 521PA 5SZIA 3KZ1E 2OUKA 3AF2A 4KFSA 1ZM4A 5HCNA 2WSMA 4U02A 4LJ4A 3RRYA 2IS2A 1I2MA 1X6VA 3U44B 1JJ7A 1FW6A 2ZR9A 4XWKA 3FE2A 1F3OA 4MDFA 1U90A 2BMEA 1S2MA 4ARZA 2XGJA 1ZAKA 5C4GB 2VTKA 1OE0A 4JIMA 3RC8A 3TVDA 1NMZA 2BBOA 2GXSA 3QXXA 1KK3A 1JXOA 3I3SR 3ADKA 3SS8A 1J90A 4LK2A 2NMVA 3CO5A 4JLAA 4K8OA 5BW8A 2ZRCA 3CPHA 3KKQA 1AS2A 3BRWD 1DADA 4N0EA 3BB4A 3QXCA 1JJVA 1OXVA 3C15C 4C7OB 1XWIA 1GRNA 4P4SB 5DGXA 3VR4A 1G3UA 5FOXA 5GJCA 5KSZA 1OPXA 2H5EA 1Z0DA 1IJEA 4LHYA 1ZINA 2A5FA 2Q3MA 4PAOA 3VR5A 4C0HA 2W6ID 1NI3A 4HUQB 1XDBA 5JI2E 3TH5A 2IF0A 1P9WA 3GFTA 4MYUA 3W5JA 1M7GA 1N25A 1NVWQ 2EFEB 1QHHA 2Q3FA 2DPXA 2OBNA 2PZFA 3DKVA 3QNUA 2FH5B 2PMDA 2FPKA 1OFIA 3CWQA 4DCVA 1CEEA 2IBMA 2W0SA 1N3BA 5JWHA 2DB3A 4MRPA 2GZDA 5CYOA 3RWMB 1S96A 1S9DA 3GFPA 4WXPA 1ZYUA 2FFAA 2LKDA 2YOFA 1ZBDA 4PTLA 2GHIA 2I1VB 1P2TA 4DSOA 1T91A 4V0KA 1XXHA 4DBLC 4IW3B 1ZM2A 1G9XA 3QXHA 2F7SA 5FOUA 1IONA 1KDOA 4UXJA 2G0NA 1EFHA 2ZU0C 2X8AA 1UJ2A 4KV9A 1UDXA 3HPRA 3RC3A 1OXTA 1E94E 3SJCA 3KXKA 4D4JA 4CEIB 4CEJA 4KBFA 2ZAOA 1ZNZA 5LBIA 5TXGA 2PCJA 1A2BA 2WWYA 2QPOA 1E9SA 1KJZA 3IHLA 4LHXA 3FPAA 3TIFA 4A0FA 5AUOB 3CLVA 4R71A 4BRUA 4LHVA 2J0VA 1MV5A 1H8EA 1KKMA 3W6OA 5L3SB 1NN3A 2JJ8A 3GQBA 1U0LA 1T5LA 2Q9AA 4UJ5A 5FL3A 1QZXA 4MDEA 2YJTD 2OESA 1TF2A 4FIDA 4JLVA 4PSVA 4RFSA 4I1SA 4BFWA 1OH6A 5KU1A 1Q57A 4QNRA 4OL0A 3CR7A 3LDAA 4TZ0A 3AUXA 3HYRA 4JLOA 2IYSA 1U98A 1FP6A 3QJYA 3WP1B 3VR1A 3EX7C 3D6TB 1WE2A 2P5TB 2GJ8A 2OCBA 3EASA 2EWWA 1Z6XA 2FSIA 5KSYA 4M9ZA 3ADBA 3IQXA 4RJLA 4Y0AA 2FMXA 4I1UA 2B6HA 1XJCA 3IDQA 4JLBA 4M1WA 4TTQA 4JVNA 4WVFA 2HF8A 5CIWA 4BFZA 4ERNA 4CVNA 1N6RA 1N6LA 3KTAA 2A7QA 2KBEA 1R10A 4FINA 3VAAA 4M1OA 4DLTA 2ODWA 4Q01A 1FQKA 4QBHA 3IBGA 3NBFA 5LDDC 2V3CC 1HE8B 2H17A 3MWLA 4P31A 5EXXA 3THWB 2P6RA 4KVGA 1KY3A 2IEZA 1R8QA 5CM8B 3QUSA 4NYJR 1G18A 2JJ1A 4LI0A 3T61A 1XMJA 1W4AA 2GF0A 5TVKA 2UKDA 3A6PC 2CNWD 3WRXC 3KQUA 3L43A 2D74A 1DAEA 2QGNA 2XEXA 3PCRB 1P73A 2WBLC 3OF5A 3GFOA 3TUIC 2Q21A 3OEED 3Q3JB 2A5YB 3D8BA 4Z51A 2QG6A 4HZIA 3GLIE 4M4SA 5TDHA 1KSHA 2WSSA 1UBGA 1I2DA 4RSGA 5AUQA 2PZEA 2BJVA 2WWGA 1AKEA 3UWOA 1F5NA 4UNNA 3NVAA 5K8LA 3EIQA 3KFVA 2JDID 1SXJB 2JAQA 2QRZA 3LY5A 2IT1A 2D2EA 2AK2A 2GJKA 3QF7A 4NZYA 1G7SA 2DFNA 4U00A 3G5UA 2W2XA 1NSFA 2QSZA 2ODBA 4TSFD 4P33A 1SKYE 3SBEA 4OYHA 2RGXA 2CHVA 3VHLB 4DSNA 2BKUA 4ZI2A 4PPNA 1AJEA 2KE5A 3I72A 5CJPA 3AKCA 2PCLA 1L4YA 1Z06A 1E2HA 3U44A 1YU9A 1E0KA 2XOKD 4UJ3A 5EP3A 1A2KC 1WRBA 4AI6A 3K70D 3IIKA 3PEWA 5EP2A 1X8KA 1QHXA 1W46A 2D62A 1X1RA 2CDNA 1RYHA 4LZZA 2AWNA 3WMEA 1JR3E 4MA4A 2FPLA 1H65A 1VIAA 3KFXA 3LW8A 3U6KA 3EIEA 2C5LA 2FN4A 2QAGB 2RGNA 2VL7A 3QXJA 1G8GA 3R9IA 3UMSA 4DWJA 3H2YA 2EYQA 1MO3A 1C4OA 2ZAMA 4OHXA 2WV9A 4PZYA 4C30A 5CDFE 2QP3A 5JSZA 4L5BA 3TUZC 4HAZA 4FWIB 2GZHA 5IT5A 4LX0A 1QDEA 2EFGA 4QC2A 2Q6TA 2GCNA 4QGAA 3ONWA 3U3RA 1ZU4A 3PITA 1TUIA 3QKRA 1AS3A 4NYIQ 3JVUA 4KJZA 5JHHB 1NG9A 4B75A 3O8CA 2EYUA 1EGAA 1G21E 4NTZA 4PHTA 3EZFA 4HLCA 3KJGA 1AZSC 1OHHA 2IA5A 2QU8A 5AWFC 3D7MA 2XSZD 3RRMA 4QBGB 1UKZA 5FOWA 3AVVA 1KI8A 3B7GA 2Z5FA 3CRMA 2WJVA 2JJ2A 1YRBA 2QTFA 4OHVA 3VMFA 1Z63A 4IDHA 2O0HA 4LRWA 2ZRHA 4M1KA 3NKVA 1NLZA 2AKYA 5AUPB 3IIJA 2AWOA 3T06B 5E95A 5M04A 4LJ5A 4N0DA 3U60B 3RLFA 3SR0A 1OH5A 2FGKA 5B57C 4AWXA 4D25A 2WOJA 4E09A 2GXUA 4O2LA 5JCZA 1SXJA 4ARZB 2JLYA 1RC8A 1G5RA 2R6AA 3M6AA 3U4QB 2QTVB 2G88A
chains in the Genus database with same CATH superfamily
3T1HB 2C5EA 4Q3OA 2IBTA 3EFOA 4Y3UA 5G0SA 1FFEA 4YAGA 2BT4A 3DOFA 5DH9A 4UE2A 2C3MA 4R1NA 1WUHS 2WUVA 2A33A 4AG3A 2XWQA 1VECA 2YZMA 5BYJA 4B6GA 2X1MA 4QUEA 5FTNA 1OVMA 5KQPA 5K3CA 2G9QA 3QFTA 3G0GA 4NNJA 5BSRA 3V1MA 4AC9A 2I9KA 4PQYA 2DWQA 2ZANA 2WKPA 1I6LA 2KLHA 3VRHA 5A2GA 4L28A 1ISGA 2BEWB 2ERCA 3OE7A 4M3NA 3WIUA 3TL2A 1HFJA 3C14C 2BFCB 1BDIA 1JXQA 5FA6A 4KCGA 4XQ9A 1KDRA 3KALA 3NEPX 3II6X 1NLYA 1A5TA 2IPOA 2LRHA 3KKNA 1CJSA 1XI2A 1K4YA 3N86A 1DCMA 4LWPA 4MVJP 4PPFA 2XT0A 2AT1A 1EUDA 3IT2A 2HDOA 4M0KA 4OMUA 2CXOA 1UJ4A 1NBAA 1SVIA 1W4RA 2FXIA 3K9LA 3W6PA 2QZ9A 4RV5A 2C2ZA 1IK6A 3CISA 2WDPA 1M9NA 1EP3B 2YJNA 5FUVA 4YDHB 1V5FA 2QBYA 5J59A 4ACBA 4AZTA 5AW6A 1IH8A 3L8ZA 3IC5A 4L5JA 1E3SA 3IQEA 3BGSA 5B1EA 1Q21A 1NW8A 4K7JA 3DUFB 2ZYSA 4L6CA 2R25B 4H0FA 3SNHA 1DMSA 3S7TA 1RZRA 4BLSA 1ZVVA 1SCUA 1QVZA 2UZIR 3R3VA 2JIZA 5BP7A 2WFZA 5D51S 3ABIA 1Q95A 4EHJA 1JU3A 4LXUA 3ORSA 4NZNA 1XTJA 2YXPX 2ZP1A 4UBMA 4W1QA 2XCSB 3EWSA 3QVOA 3R6WA 4XSGA 3GV0A 4MXDA 1G3IA 3TUJC 4C7KA 3FHTA 5AKZA 5KNCA 3O4IA 2OCPA 4EYEA 1IY0A 1E6LA 1CK4A 2MYNA 3BD6A 4L3WA 4LHZA 2BHSA 1TT5A 3E7WA 4GE3A 2PGJA 5AM5A 3UJ7A 1BHSA 1ZUIA 2Q45A 1YJ5A 3K0AB 2IYQA 1NOIA 3O3CA 4XLZA 3C98A 3NDIA 5KYYB 1GTL1 1L7RA 3MN1A 1Z9BA 3MTAA 5LQNA 4J7CA 2AN5A 2IZZA 2V8OA 3MILA 3IIIA 3OEEA 4D3FA 4RHXA 1G21A 1MO6A 3K0KA 1DAHA 4NU6A 3RUAA 5BWCA 3E9CA 3EPRA 3H9GA 4HPWA 4CV1A 3U7FB 3EQ7A 2FW0A 2O8CB 4JUDX 4Z9YA 5FNVA 2I66A 4PGMA 5HXAA 1U4OA 1XTTA 4G5RA 3EA0A 5E1OA 1X15A 2AZTA 1TK2A 1PO7A 5B4TA 3F90A 4C6HA 2X8LA 2WYIA 3EGIA 4LJAA 2QXUA 3KQVA 3ZGOA 4IGFA 1H9AA 4MCHA 3RYHA 1MTZA 2PRYA 3EGDB 3C8MA 1HM5A 3HR7A 2VQDA 5TQ0A 3DVQX 2HLHA 1U2PA 1UEJA 3QX7A 4NYMQ 4FTWA 2FUNB 1UL1X 2XGSA 3I1FA 4PAQA 1TJ5A 5FUXA 1A8HA 1Z4OA 4MR9B 5IUJC 5KZMB 3EXHB 5TE9A 1IBLB 2DETA 3GW8A 3M0EA 3X1YA 1IVSA 2FYTA 3F3SA 4YAEA 4DV6B 3SZGA 4V1CI 4J1TA 2IOYA 3L0SA 1U5BB 4CMCA 2CK3D 3OOSA 4NPAA 3NXKA 1TZBA 2YDYA 4BWYA 5FBWB 4PXYA 2QUZA 3KKZA 1TGVA 2R7NA 4YO7A 5E4JA 2EW2A 4DGSA 1GNLA 4F2GA 1U0HC 2I2BA 3PE3A 2EJBA 4XI9A 4FE4A 4I55B 1DG3A 4OQEA 3RPEA 2WMOB 4L9WA 3ZCPA 4HO1X 5EIWA 2CXSA 3I1JA 1AM4D 3A3KA 2JJ2D 2PUHA 3Q72A 3QTTA 3E9YA 2JARA 3MT7A 5I4IA 5A03A 2GFQA 4YJKA 3IUMA 5AJVB 4ALIA 7ABPA 2ZRDA 1WB4A 1EUCB 4DKJA 2GYVA 2HGZA 2QRNA 1TA0A 4IV8A 1AHHA 3BC1A 1PR6A 2M1XA 3WNCA 3OCUA 1RQXA 3VR6D 1VLLA 3VDNB 1MBZA 2WU0A 1WZ2A 3TLBA 3Q7RA 8MHTA 3GP3A 2B98A 1NJ8A 3WMRA 1ZIYA 3SXUB 1G8HA 2DKOA 1MJHA 2I91A 1MQ8B 4YR9A 1D9XA 3E7PA 4LYEA 5I5GA 5INTA 1S0UA 3L9XA 3LUJA 1KJ9A 1NNSA 1VHLA 2QQ0A 2JLVA 1JNXX 1P75A 4KLRA 4X41A 4O2AA 3EWNA 1W75A 1TQ2A 3NLLA 3OM1A 3UW3A 4YUZA 4EELA 1GSHA 2VOJA 3D31A 3DXFA 3R0QA 1BWSA 1E1NA 3BMOB 4LBWA 1DLJA 1YIOA 2UYYA 3K9GA 4DCTA 1JKIA 4KUGA 4BO4A 2QT1A 2QN8A 1KJNA 4YRCA 4EPVA 1JR3A 2NZ2A 2QRMA 1PZXA 2ZRQA 5C7OO 4EUKA 1ZR2A 3BM5A 1Q5PA 2H57A 4BFCA 1J2YA 1UKAA 4G8DA 3SOPA 3WNVA 3IIEA 7AT1A 2ECPA 4G0ZA 2PY6A 1R50A 3MBIA 1OTHA 1V1RB 2IH5A 1ZCJA 5B37A 5EIFA 5IJWA 4FFVA 1YR6A 1TVKA 1T0HB 1YR7A 3PUYA 4IX9A 5TF0A 3WYEA 3AM1A 2RHJA 4YQZA 5LLTA 4CF5A 2IK8A 4IHJF 5LQJA 4U3JA 3RYHB 1XMOB 4WLUA 1TEVA 2LE0A 4LRYA 2VWGA 4U2EA 2W6JA 3LXXA 3S4YA 4Y9UA 2WWHA 2CBGA 4A73A 1XROA 2OORC 1AKNA 4YRBA 4Z4CA 1E1CB 4DIDA 1GYQA 3OIDA 4ZJUA 2ZFUA 3EXHA 2O8VA 1XWWA 1VJGA 5A3QA 4UAGA 3H5NA 4ALLA 1CG6A 5BW4A 5ALVA 3PHBE 5KVAA 3RAEC 2AUTA 3ABOB 4ZMSA 1X7YB 4KPEC 4DYVA 1CC1S 2D0IA 4H7EA 2EEZA 3BN3A 3N2KA 4RPKA 3CV3A 4I66A 3FIUA 1WD7A 4BIMA 1LD3A 1N4DA 1ZHFA 2HUNA 2ZSAA 1EK1A 2ZI7A 4Y6QA 4PV7A 2VTDA 2QN3A 4WI1A 3WG9A 2WWWA 4QU0A 2HQ1A 1MABB 1ZXXA 2LUOA 3PQCA 3QXGA 4R2HA 5FYDA 4D5EA 2X2EA 4NCJA 4NI5A 2K5UA 3RR2A 4NHEA 1HR0B 2JJYA 4NCXA 4RHTA 3M5WA 4HG2A 3NHBA 5FA5A 2PRJA 4CLRA 3ZDCA 1OTXA 5EKXA 4RGVA 3WLFA 2ZJ0A 2B4RO 1K9SA 1Q7CA 3TTVA 2IP1A 1PZNA 3CKYA 5DYIA 4H1HA 4IBOA 4BGDA 1X1EA 3IPAA 1HT1E 2NUAA 3X43A 1W8DA 2QMQA 4PNZA 1PU2A 1GADO 4Y2XA 4NBNA 4I14A 3TSYA 1SUDA 3KQWA 1ATIA 1N6NA 1BXGB 3KWJA 1G5IA 4TT8A 3X1XA 4EG1A 3I6IA 4P4SA 2NO9A 3ZHOA 5BNIA 1VTKA 5KDLA 2GF9A 2WB4A 4DLAA 5EPUA 2OBBA 4PHCA 4PPYA 1XU4A 4UDOA 1WY5A 4Y1RB 4B09A 4Y2JA 5BQXA 3D3QA 4D41A 2HL6A 3QMPA 1ODTC 4QYIB 3Q87B 3K92A 5LOVA 2A9FA 4CCYA 2ZJOA 3MOSA 4EW6A 1RYFA 3KXLA 3IE1A 1VPWA 4GI3A 1DJQA 1E3MA 2B94A 3DB2A 3LTNC 1VCHA 1V3TA 3AVPA 1V45E 4TQUS 3ZHRA 3H87A 2OMKA 4TN1A 1NX9A 2DCUA 4MR7B 5BN3A 4NAUA 3I61A 1I9CA 3G7SA 4OHOA 4R51A 5DIFA 1QORA 5HBGA 1ZD1A 3KB1A 4FYWA 4R9UC 3UC5A 3UWMA 2OHIA 3GJ6A 2Y0PA 3QM1A 3SEZA 4DYDA 1QG0A 2FZEA 5B1IA 4EA9A 3AESB 4WMLA 2C98A 3VYRB 1Z5OA 2B3TA 2C4UA 3JWJA 5FUYA 1M8PA 3GOHA 5FTLA 3AILA 1TVKB 1IUPA 5HGJA 3S1AA 3UMFA 2CJWA 1YKGA 3F6BX 4RESA 3IA2A 1ZCZA 5JD6A 5K3OA 3VYTB 1SUSA 4NYMR 1N7HA 4YJ2A 1JECA 2WG2A 5EKTA 2ORVA 5FPPA 3ET4A 4S2UA 4GFDA 1NBEA 4HX9A 1H3NA 4ZQIA 4EHAA 4LDRA 1AF4A 2RHHA 3DFKA 2A5LA 5ADUS 4CEJB 1SCKA 5AIAA 3DOIA 4GM1A 3VM6A 3EH1A 3FYUA 1UPUA 4CLHA 5EZ6B 1NHGA 3WGLA 2P2YA 3ED5A 2PRKA 5EVCA 4EHKA 1GPUA 4H77A 10MHA 1B6SA 4QBFA 4RLQA 4V39A 4FHDA 1XV5A 3AZOA 4J0JA 4DFDA 3K72B 2Q9CA 2IYZA 3F4LA 3P2KA 4FYPA 5BYKA 4HWKA 4DEXA 5DLQC 4TKVA 1WSWA 1Q1QA 4O2BA 1VP9A 3DPIA 2IVZA 2QE7A 5HJ7A 1KEUA 4HUQA 4WZBA 1R4MA 4GZ5A 4JKOA 4NNOA 4YACA 4GPZA 4YRQA 4MI3A 1BKYA 1C1DA 4WESA 4ND8A 5BN5B 4AMGA 1V5EA 1R5NA 3EXAA 2BV3A 4HUTA 2AB0A 2FRVA 3F73A 2LTAA 4TXLA 3MC1A 5DMHA 2Z56A 3EXIA 1RWPA 2HRRA 3L6RA 4XTRA 2O7QA 2EP7A 2DJ5A 4QA9A 3RS5A 4ACAA 3AMVA 2ERYA 3JY6A 2RGNC 5B7PA 2G1KA 4UM9B 1WCXA 5GQSA 5BORA 2KI5A 3OZXA 3A04A 4X00A 2OFFA 4EEZA 2FP3A 3EXEA 4KSBA 3ASZA 2PPVA 3LP6A 4R1TA 1Q1NA 4BJ5A 2Q5OA 4M7RA 1C29B 2RBGA 2ZT7A 2W6NA 3IBCA 4N5NA 3I64A 1K75A 4J91A 4QVKA 1RHQA 2A3RA 3GFFA 5FBHA 3GA7A 4AYXA 6REQA 4Z53A 3TLJA 2JLRA 2HH9A 3L0BA 1P6XA 2DBRA 3KJIA 3GCGA 4GW3A 5KNCD 5FI0B 3AVXA 3LT0A 4C0QC 3ITKA 1DTWB 1UXOA 4MINA 4MGHA 1P0QA 2AFIB 3CZ9A 4YCMA 1M2FA 1N9GA 2X15A 4MW0A 1Y1TA 1D8TA 3ROZA 4FS8A 5MGNA 2O0KA 4RADA 2ZPUA 2RB5A 3CEAA 3H3XA 3E05A 3KOOA 4RSRA 1VJCA 2WTEA 3OWXA 4UCWA 1YA6A 1E3WB 4CTMA 1CQJB 3EGXA 4HATA 2QKYA 2BCGY 3CX7A 4Q7KA 4F56A 3T7RA 5L6LB 4N76A 2AJTA 3QG5A 1KHTA 4MW5A 5IDXA 3FCAA 1HDZA 5DFAA 4G01B 5FWNA 1WX1A 3FOAA 3FVRA 1JJIA 3BTSA 2RCYA 5J4HA 1NF9A 3DEJA 1KYIA 5D1NA 5DNAA 1W6RA 4RDCA 2BTOA 1RKQA 2R86A 4JYCA 4RC9A 4X60A 1Z47A 2VT6A 3GI1A 4BO2A 1R64A 3D9QX 3M4YA 2GO7A 4U2GA 3W5HA 3V2UA 2B92A 4N39A 1FUYB 1A96A 1KAHA 5IAAA 4G1MB 3ANXA 3RVSA 2R5FA 2Q5CA 2XKKA 1LDBA 3FYCA 1RPAA 3QVUA 4J76A 4P4GA 3TQQA 2BGUA 2I4LA 4QYTA 3V8PA 2EWVA 2ZJ3A 3K0CC 4Q6BA 2RB4A 2I33A 4J4HA 1LS6A 2C0QA 1A50B 2V5UA 3LQQA 1JHOA 5HF5A 4DA4A 3F9IA 4EDHA 3I32A 2CSXA 2GK3A 5HE8A 5F7XA 4ZARA 3UUEA 2PQ6A 5FLYA 4UHCA 4R2IA 3AERA 4FN5A 2P90A 4RHYA 5CT8A 3UXEA 4PYLA 1EK5A 1YU6A 3QU7A 4TKVB 5PNTA 4U6QA 1EPUA 4MUHA 2DPHA 2YCBA 3C6YA 4CQMA 2UVDA 3TSWA 1EFPA 3WJ7A 1U2RA 4AMBA 1DRJA 2O6HA 3B8EA 3DE0X 3KYIB 2FN7A 2QUJA 3JASA 3ZWBA 2B4AA 3BZBA 4UHBA 3LOUA 3SMVA 2E5WA 4JQZA 2UZAA 3T41A 3KE9A 1HY3A 3LY8A 3GNSA 3OZBA 3IUYA 4G0MA 4IHAA 4UHDA 2NPFA 4QLBA 4WVLA 1U6JA 1U8EA 4WCFA 1OPRA 4RSHA 5A7GA 4EG0A 5MFZA 2DWOA 1JMKC 1AKUA 4XDHA 5T8KC 4NFLA 1Z34A 4MQ6A 1VFNA 2AJLI 3PWSA 4J0EA 5CDGA 3IXMA 1UPTA 4X1KA 3BH6A 2EAUA 4KIFA 2XUDA 3WFJA 3VGJA 1EVYA 3VR2A 3ZE1B 4F8JA 5EJAA 3TBHA 1MJFA 3MRSA 3K6JA 5BSKA 1I5EA 5CMLA 2YN4A 1ZKDA 4OBBA 2O05A 2P0YA 4D79A 2HNKA 1T34A 1J5XA 2CHEA 1NVBA 1YL5A 2IUYA 3IVAA 2EGGA 3QYPA 4JQCA 3AP2A 3I4LA 1MT3A 3UT0A 2F3SA 2X0FA 1RAEA 1JYSA 1N9GB 3JQ8A 1E3EA 3D0OA 4GUDA 3RUDA 4E2ZA 5HQ3A 3NETA 3M4XA 1SXQA 2QMUA 4FGUA 3O7MA 3EQZA 1ZJ6A 3DMTA 4D74A 2NU6A 2PA0A 2QLNA 2RHDA 1QH0A 4LIPD 4NZOA 2DEUA 2R6HA 1XLTC 1SUIA 5K8IA 4MMZB 4O4HB 1YZUA 3AH8A 4EB6A 3ABQB 2W2VA 3EGCA 4OGWA 1ZVQA 3JPYA 4LF9B 3KDPA 4DRYA 1JN0A 2X3YA 2WZDA 3LOQA 4C6TB 2WJZB 1L7XA 1GPYA 1NJGA 1W94A 3EOAI 3V8EA 1FTGA 1FUKA 1GFZA 1SN7A 4MUIA 2YWDA 4QLAA 1SCQA 5DNEA 5EZSA 4A8JB 5ECDA 1OJLA 1JILA 1LSUA 2WTXA 5DGCA 3K9FC 1PUJA 2YBDA 1V9LA 1VLJA 2P67A 2AXQA 4FFMA 1VMEA 1MA3A 3O1IC 1Z0FA 3R7SA 4BX2A 5HYVA 3LC1O 1OLUA 1WV0A 1MO4A 3EZYA 1DEKA 1SNYA 3MAAC 1BCSA 1WMSA 2QRHA 2AHOA 3NWOA 4NCBA 4QASA 2A9RA 4JUBA 1OBHA 1MGPA 3NHWA 4PHGA 1KO4A 3L05A 5E6RA 5KYVA 1JHDA 1LPBB 3EVFA 3SE7A 4BFVA 5IASA 2B82A 3H7AA 1O0CA 1WMAA 1XZDA 2PIAA 1PR1A 2B1QA 3JXEA 3OF2A 1LSJA 2BEUA 2JEZA 1VLVA 4NJEB 3AVQA 2HBZA 3CMMA 3L4BC 4D8WA 3O1JC 3SS7X 3ZVNA 4JN6B 4HAOA 3UWDA 2FZCA 4YI3A 1CUSA 4HVAA 3ZHQA 1EAMA 2NSLA 2YASA 4LYFA 3JQBC 2NNLD 4B3JA 5TIIA 4Q9NA 3KQTA 2QXTA 3D6FA 4RD3A 2ZDGA 2NV6A 1U8UA 4WKBA 2GJ4A 1H94A 4DREA 3RK0A 2WRZA 4JROA 3JZIA 3KS9A 4G86A 1JI0A 1CIJA 2RAUA 2RG7A 2ATIA 3V2GA 3FDZB 3GUCA 3ZY2A 1CHNA 1EM8A 3IMCA 1L7NA 4N48A 1L8QA 2GSWA 3ZIAA 2GA9A 1WVMA 4UHHA 3IAFA 3V8NA 1AN0A 1RWMA 3GLUA 2VQFB 3EMDA 3HN2A 2BHRA 4AKTA 3E0XA 4R2KA 1JFLA 3HDQA 3L46A 4BE7B 2Y77A 1MB4A 4YGXB 2E6KA 2IV3A 3RI3A 4AURA 4CF4A 4CUZA 1SVNA 2I7CA 2QWXA 3JQ8B 1IQPA 3MELA 4KE9A 5EMNA 1HQDA 5B7GA 1RVDA 3DWEX 3AEKA 3ZQ6A 4RY2A 4DWOA 3DFIA 1F8FA 2C4VA 3FGNA 1CRWG 3KPVA 4DAOA 4ZMRA 3IMGA 4PN7A 4ZD6A 1XMSA 4Y30A 1B3RA 3EF0A 1N2CB 4Y9TA 2GBGA 4RTJA 4CKCA 3PXAA 1SVLA 1PR4A 2RGWA 4UE3S 4HDMA 4AY5A 1RP1A 3QPUA 5BWMA 3N39C 5AR1A 4MV3A 5C7LO 4EMUA 4ZOAA 1XKXA 4NCAA 1ONBA 1PSZA 1S8OA 4HWOA 5AYVA 2FXVA 1MC4A 2XCLA 4YBZA 1L5HA 1KDPA 3F78A 3S2SA 2CVFA 5EMHA 3I04A 5E8JA 4YCLA 1SZDA 2M6RA 2O3JA 1VKHA 2FKNA 3HCRA 3KNZA 4FX5A 2V7PA 4JELA 4Y98A 2HTFA 3DBLB 3OC6A 2ZRAA 3AL3A 5AI9A 3C1TA 3C3BA 4QXAA 5FJIA 3IUQA 4BQSA 4Z4QA 2PZGA 3JQRA 2XOKA 3U3OA 3V55A 4EDFA 3EC2A 3MBKA 4E32A 1N5MA 3P52A 2WAOA 5DSZA 4FILA 1BCSB 4TOIA 2PSHA 1IOLA 1G63A 3DZGA 4LDAA 2ETVA 2GASA 3X2SA 2ZXUA 2A88A 2VQ6A 3AEQB 3LP8A 3QPCA 4F7WA 1VJRA 1Z8NA 1X39A 1EXWA 3GJYA 2BFPA 2IELA 1TFUA 1LDYA 2CJYA 3X44A 3V7WA 1ZDMA 3L7YA 2BHLA 4WBSA 5EJ7A 4AKHA 4W7IA 2B2CA 1PS8A 3TFQA 2PRZA 1RKBA 2IZOA 1HURA 3Q0IA 4FHEA 4IJMA 2YVAA 1KYXA 5IG2A 4IGAA 4LXQA 4S1TA 4E1AA 4YMVA 4HNTA 1RHKA 2XQIA 2WLSA 2BGNA 6CHYA 1WSDA 4XE5A 5ALDA 4EFDA 3FF1A 1QG4A 2H7YA 3P2MA 2Z6UA 4PAWA 2YV3A 1U2QA 1SBIA 1ZGAA 4EY6A 3DLBA 1NBWB 1T8TA 2W2KB 1DBWA 4MICA 3K9CA 1GWNA 2WKSA 3SZRA 3W4JA 3WGYA 3WMXA 4RZ2A 1GP2A 4KR3A 3T3PB 1V11B 3JATA 2DERA 1D03A 2ONKA 1QG6A 2PT9A 1NVFA 2HIGA 2VEOA 4U7TB 1O5TA 3SM9A 4E15A 4U2DA 1W1UA 4FGZA 2YXDA 1V4BA 4G5HA 3SVZA 1AO3A 1XAJA 1YK1A 1TIKA 3K0EA 2F1RA 5KX5B 2P3OA 2EQBA 4RJIA 3GAFA 1FOEB 2GAIA 2Q8PA 3OHSX 4DNQA 3PSAA 4BO6A 1NVAA 2P9QA 1TAQA 4ZEXA 2P9HA 2VJOA 2YRFA 5HIKA 3D81A 1L5RA 3PJGA 3FB1A 4G07A 1JKMA 5HWSA 5KEIA 4GHWA 1ZNXA 4IUCS 1X38A 4KQIA 2O6LA 3P9KA 1T1GA 1YJ8A 2FK7A 1QDUA 2JDIA 3AEUA 3K94A 5GONA 1J07A 2R47A 3UY4A 1UC8A 2WJGA 3ILHA 2IZ5A 1SG9A 5H16A 1DIRA 3E3LA 3UXYA 2JFOA 2RHMA 1MPTA 1M73E 1SB8A 4XQCA 4CKCB 4OI2A 5AJZA 1OV6A 5H70A 5IUKC 2EC5A 3TECE 5EE0A 3HDVA 1J56A 1MXHA 1P7CA 1XDWA 1XLTA 1AGPA 1YB5A 2W6MA 5TQVA 4CHTA 2C4TA 4ZDKA 2ZRIA 1BRTA 5AKLA 1XTKA 1L4KA 2YN2A 3PEVA 1KOFA 5DHQA 2HKIA 2XUFA 4EPYA 3WWZA 4PU0A 1P29A 5FI3A 4WOJA 1PHRA 1VG1A 1W29A 1P2GA 1T8WA 5GM1A 4TWBA 1IEQA 2BMJA 3DAFA 4UZEA 4GI1A 5H83A 5TB5A 1XQXA 2ZAGA 3RIGA 5ALNA 4U7DA 4B76A 2VP0A 5D84A 1K9VF 2FDRA 3I09A 1KVRA 1YRQA 1H05A 2FFBA 2VHXA 4HNRA 4OI4A 4OJMX 3B1KA 3HJHA 3NBMA 2XF2A 4WKOA 3S8MA 1I9GA 4AJIA 1DSSG 4G5SA 1GU1A 1OWPA 1RWKA 1R16A 2C4KA 4K6KA 4IEFB 5AHOA 4HUJA 3CR8A 1DNPA 3VTFA 4BMPB 4E51A 3QVVA 3NGMA 3WYGA 5HW0A 4O1IA 2DWUA 1J8VA 4HAIA 4R8SA 4KK3A 5KOHB 2PGOA 2ZRKA 5LPNA 3IELA 3WLEA 1AN9A 2PWBA 2QRVB 3EJ6A 3W9BA 3FM9A 4NEHB 5FWXB 5DK6A 5CK4A 4QUHA 4BVHA 2GS9A 4B32A 4EUSA 3O84A 4KZKA 1VCNA 1Z7EA 2OMEA 4FI3F 3DOEA 3S7ZA 2HJ9A 3VFDA 4WY2A 2QL7A 3ZCSA 2X0KA 4AJNA 1AQNA 4LVNA 4YBRA 3UB3A 3I2FA 4LF8B 1NN0A 3C3EA 5COBA 1B74A 3ANNA 2Z4TA 4EJ2A 3VO9A 2H16A 5D6NA 2V6FA 1F06A 2H7XA 4FE3A 3UTDA 1IXKA 4DLUA 4MUFA 3MUFA 3WISA 4BWVA 1PBNA 3WMWA 4RTNA 4WLFA 5LZ2A 3MWDA 1ULZA 2ODEA 3HVUA 3R76A 2W4MA 3DDCA 2VYQA 2W2KA 1U2ZA 2JD0A 2NTEA 2DQKA 3IP5A 3I12A 4L0CA 1GRQA 4ML3A 4RVDA 1N4AA 1CQPA 4LXHA 3RWOA 3L4KA 5BOVA 5KINB 4G5QA 1U28A 2ZK7A 3V1UA 4L8LA 3MINA 3V00A 2F6RA 3X2EA 2EARA 3LSYA 1RQGA 4B3SB 2IU0A 3E9MA 5FTWA 3M6WA 1NNUA 3FCEA 1G20E 2F43A 1EWRA 3BL8A 4XD7D 4IJUA 3ZK8A 3G02A 1R4NB 1UADA 4C4SA 5KYTA 2H63A 3NCHA 1RKVA 5LA6B 5IVHA 4DXHA 4I1VA 3MJDA 2JI7A 2OUIA 2FSVC 1EGMB 4H1UA 1ANKA 5C5IA 5E6SA 3MF4A 2VP2A 3QF4A 5H9WA 5KTTA 1BYIA 1XPOA 3FTEA 4J7UA 1M75A 1XJ0A 3M5CA 1D5WA 1RBYA 2ATEA 3IPLA 1X9IA 3D6AA 3GK3A 4WA8A 4WINA 1O96B 4YMSA 5FPKA 2WT4A 3CUUA 3MCWA 1ESMA 4XKJA 1J7JA 3SX4A 1GCIA 3WB0A 4RVFA 4QDOA 5DBOA 2HF9A 3NH6A 5IDWA 2JGAA 4BWFB 3DL4A 3RTEA 2RH5A 1OT3A 4CG0A 5IKPA 2GESA 3MCTA 3K1JA 1I4DD 3W2IA 3EGWA 2J45A 2CFIA 5AHWA 4QBTA 1Y3BE 1E2BA 4DMCA 5A5DA 1ZISA 3PX7A 3EC1A 4GM0A 2R8ZA 4MV0A 4QSMA 4G6ZA 4B7UA 5DI9A 3BD8A 2HJRA 4KLZA 4BAGA 1P77A 2P9ZA 3QYAA 4E22A 3DAPA 5IN4A 2C7QA 3AINA 4KNYA 1CEYA 1XTSA 2FA9A 3T0IA 2ZSKA 2W6OA 3LQ2A 4UULA 5AQ1A 2CD9A 4D9JA 1RW4A 3NWJA 2QI9C 4AS3A 1K88A 3ESBA 5GADl 3TEJA 1HE5A 1ZP6A 5CAEA 4HB3A 5FLKA 1QHYA 4F92B 2GK4A 2ZI5A 4LY3A 2WF7A 5HIJA 1MNQA 3OM0A 3EGVA 5CIYA 1I7PA 1ODSA 1UJ6A 2C2XA 3SSMA 3VU1A 3GEGA 5BWNA 4HGRA 1C3VA 2UU9B 4Y2VA 5AKEA 4A92A 2HTEA 2KB0A 4HDOB 2IBSA 1XEWY 2XUGA 2ZB4A 2DJIA 2F8SA 1G8KA 2XB4A 3G8YA 4UM7A 1JSCA 4WK0B 4CJXA 3GU3A 3RV4A 2LKCA 4AS2A 1R88A 4B3BA 3AF4A 3P4YA 2VKTA 4C6SA 2DPYA 3K2EA 4OQXA 3WR5A 5JS6A 5KPJA 4QDKA 1JSZA 4DPKA 4HZUB 3PDHA 3K96A 2K2QB 3MCVA 2OWDA 4EF5A 2WIAA 4LV5B 2P9EA 4XWAA 4QGSA 4JC8A 3QV2A 1WUTA 4G24A 1LPSA 1Q1BA 2M6LA 3U4MA 1RMQA 3UFXA 1WKBA 2GCEA 3BORA 3CKLA 3A9UA 4XJVA 3U3JA 3U3DA 2OO3A 2CXNA 1ORHA 1MMFB 3LUHA 2VNAA 1LJUA 3LD9A 3LCVB 4AXXA 2ZKIA 4CMJA 5B6IA 3KSZO 3IUNA 1VG0B 1LV8A 4BX0A 1BXRA 3UH0A 4JMPA 5E6SB 3VNQA 3JYLA 1TAUA 1QF6A 4WLVA 3OICA 4PEVA 4QRHA 2M6SA 1JDBC 1N7GA 4QUKA 2PJUA 1TO1E 4F1KA 5ALOA 2R60A 3KYDA 2C9BA 1USUA 2BDEA 4K9SA 4QARA 4CKWA 3QLTA 4ADSG 1QP8A 4H18A 3TWOA 2VPYA 5CEEA 2VBIA 1UXIA 3A25A 3AXSA 1XTQA 4Q48A 3GAAA 4NE7A 1IY9A 3QMVA 5JCZA 1KXZA 2P62A 1N3IA 1Y7LA 2AKAB 3TCNA 4CV0A 4JLSA 2FX5A 3TKAA 4F2DA 2VTVA 1U1FA 3GLFB 1P45A 1BKDR 4B0OA 4DMLA 4DUZB 1KAGA 1P7YA 4MUMA 5JSYA 1CKEA 1D04A 1XP5A 2BFCA 4IOKA 3OLWA 5DLEA 4FOPA 3TXAA 1S5PA 5F76A 2W98A 2WR8A 4PR3A 5K5EA 1GFWA 3F96A 4H1VA 4L4SA 4QBKA 1RRPA 1E9DA 4RJTA 3FHLA 3LQFA 3ZU2A 2VIIA 4B9EA 4OXKA 2Q6IA 3SQDA 2C9ZA 1PX0A 1D0VA 1LFAA 2BBSA 3I01M 5EVJA 3V4PB 3F71A 5IC4A 2JFGA 3K15A 4MK4A 2EJVA 3GGPA 1VPEA 3RYIB 5JIBA 1JB9A 1VXRA 3GRPA 4JYBA 3UT6A 4B3DA 3QW4B 1U3DA 4H16A 1VSVA 4I4NA 2QXYA 3NBYC 1MVNA 3FAKA 3HV2A 1TECE 2EZTA 4UNSA 4W1RA 3ZHYA 4I6EA 1W1WA 4DHEA 2F3TA 1HF3A 2O1XA 2QUKA 1C9YA 1DO2A 2FEXA 4GS5A 1MA0A 4R6XA 1LSOA 1GL9B 4QWWA 5AW1A 3ZKWA 4P81A 2RGGA 4IIFA 3L0DA 2VNSA 3LTEA 2Q6KA 3R6TA 4MUJA 2A0XA 1VE5A 3ZTYA 4KDEA 4PX2A 3CXUA 3VBEA 4FR5A 1GSIA 3CF0A 3DF7A 2JC3A 4MIYA 4YECA 4EJSB 4ZAGA 1N2XA 3HKDA 1I1NA 4TMTA 3O73A 1I5RA 4HN2A 4CMEA 4NEGA 1DS6A 3TSAA 4UATA 3AZPA 1K8RA 1OKKD 5LB4A 2HJSA 2MINB 4CKBB 1SHZA 1WEHA 1MB3A 3UAYA 5KYGA 3UGTA 3OT1A 1JH8A 5CYPA 1KAMA 3UFXB 5BQFA 1ZS9A 1C2TA 2ZSFA 1XRQA 1NMEA 2WM3A 4D9MA 2P2ZA 3TTUA 3FJOA 3ZIUA 3AKYA 3L77A 1E61A 4HQLA 4O4JB 5HIAA 4X65B 1XZQA 3CONA 2YHIA 4WJKB 4ZYVA 4FGJA 4D26A 2P2LA 3KAJA 4BMZA 1PK9A 3B2NA 1HYGA 3Q8WA 4O4IF 3HJTA 1P7ZA 4HRVA 4HCJA 1E60A 4ZEVA 3DTNA 4RACA 2XB2A 3AI2A 3PNYA 1VSUA 2E1RA 3O47A 4X20A 4X90A 1BMQA 4H35A 3EPKA 1EGVB 1SQ6A 4HLUA 1VE1A 5EUCA 4L9SA 5ILQA 3HZRA 3TLMA 4CDGA 1R74A 3LZ6A 4ZOLB 2PUEA 3ZDZB 1RFLA 4JI4B 2XTJA 4S1PA 4CV3A 3WAGA 1V26A 1Y4ZA 3EZ6A 4L9RA 4MPPA 1CY0A 3C8HA 5E1MA 16PKA 3TW8A 2VPQA 1F48A 5K3BA 5ALJA 4XQEA 1BMFA 2RIPA 4N1AA 5E9AA 1PWXA 4L75A 4MB6A 5ALEA 3NONA 2X23A 3VI3B 3G8CA 3R5SA 2PYIA 3DFFA 4MGEA 5CFPA 2GFHA 4G8BA 3CU5A 3NTOA 2D54A 2H5IA 4P7GA 1FNBA 1CUGA 2H9AA 3OIFA 3P0FA 3PI6A 2NSHA 3QEMA 1A1VA 3ZXYA 2FUG6 1CZLA 1WUYA 4ENUA 1USKA 2XBUA 1GZSA 4I55A 1C3OA 1X2EA 3P5BA 2DVMA 6ABPA 4P53A 5TQ2A 4GWLA 5JARA 2EBFX 4RIGA 1AU9A 4R69A 4TUYF 3QTBA 5EEGA 3TEFA 4D9GA 5ARBA 2W58A 4UTXA 1AHIA 3HMQA 1GVHA 4QYXA 4PXAA 4C0LA 3D5TA 2KM1A 3WQQA 3WLNA 3HJNA 4FW9A 5AVRA 1V5IA 1UT5A 1KK0A 3QVTA 4OGGA 2FLWA 2V58A 1I0LA 5ENVA 4REQA 4J6EA 5ETJA 3SXUA 3GROA 2FW7A 3OETA 3BS4A 1WP4A 1IXRC 3FWNA 4OBXA 5CVEA 1I7DA 2N3ZA 1GN9A 5IULC 4WCDA 1RRFA 4YRJA 1L9XA 2B5VA 2X86A 2Y93A 3G2IA 2YMLA 4TT3A 2FFQA 2GN1A 1GLNA 4EJSA 3A9CA 2VYCA 1H6DA 1RWNA 5AXCA 4JJKA 2VCEA 4MVJD 1UDRA 2H1OA 3PWKA 1DU4A 1Q74A 1D4FA 3QU5A 2D5BA 5TMEA 1NUSA 1Z5PA 1ZC4A 1PW7A 3OBIA 1GPH1 1RAHA 2HO4A 2J7KA 4OFBA 3RS8A 1YAHA 5KTYA 4GR5A 4DV3B 3VOAA 4BKPA 5IM4A 2OCIA 1VOTA 5LBTA 2V74B 4GR4A 1TE2A 4M9RA 4YT8A 1FMTA 1T1JA 4KR2A 4RKFA 4UUQA 5A71A 1JWAB 4F3TA 3TNJA 3IKJA 1G0NA 3CEMA 2R4UA 4INAA 4L95C 4ZIRA 1IEXA 3I5XA 4X3CA 3H6KA 4EWLA 3M3HA 3LHFA 1Z62A 2YIVX 4KK4A 1RJFA 4AD8A 1KGSA 5AM4A 4A1FA 1QGED 2PDAA 1DT3A 3H18A 2PK3A 4FDUA 1Z7WA 4A6XA 2HU2A 1M83A 2A1UA 1PN3A 4P0TA 4YLEA 2ZIFA 1DAFA 2FSHA 1NVXQ 4XZ3A 1YCFA 4KPUB 1W2HA 4D42A 1F6BA 1FF9A 1S4MA 1EFAA 1GXSB 4LOJA 4A82A 1UR5A 5DM4A 1CY2A 1F20A 2QAJA 1IXSB 3CZQA 5CVJA 4AXBA 3OLQA 3CLHA 3PRYA 1MXFA 1U9IA 4MRVA 4UBLA 5J2TA 2JVIA 4RWZA 4RORA 5L3RA 2QM8A 4ARIA 1H6AA 3PDIB 2OO5C 1Q1EA 2BFEA 2AE1A 2AMLA 3NHKA 4GNKA 1MABA 1RWVA 3LLUA 3PUIA 5LCXA 3BE4A 4ZI5A 5LYJA 4JJEA 2YC2C 1R5OA 4Q66C 3V48A 2RJNA 5DTJA 3FRIA 4RH3A 4WSOA 5FBQB 3ZHUA 5A6SB 1RAAA 4COOA 4WRRA 1LBTA 1OI3A 4MJ7A 5JBNA 2GZRA 4E94A 5C5EA 3MJVA 1R7RA 3VNSA 1HYQA 2J3IA 3F3KA 4QRDA 1MQSA 2XMPA 3F4KA 4BNGA 2BBWA 4ZAVA 2QK4A 3AVOA 4YLGA 2VLIA 4ZOLF 1TZ2A 1QRUA 4H3KB 4NJMB 1LX6A 3NW9A 3GJZA 2ZJ5A 1GNQA 4B47A 4FB4A 2GCOA 5LXTB 1VPTA 1FUEA 1GZHB 1L5VA 1O87A 2B9VA 3DV0B 2GT1A 4HQFA 2NNWB 3MMXA 4OGLA 4AF6A 4FXPA 1RVV1 2Y6UA 1Z5ZA 5BPFA 3A28A 3N3AC 4R7ZA 1SA0B 4LWZA 2J5BA 1CX9B 3SKXA 1JKJA 1JRLA 1QZZA 1WULS 1Y5IA 2ZBDA 5BXYA 5KS2A 2WYWA 4OH7A 4YDRA 4B8ZA 3F2IA 3SKVA 3R5FA 3HFSA 2ZIXB 3RG2A 3DKPA 3LVBA 4TZ6A 1YR9A 2DRIA 1ODKA 2BH9A 4CN9A 2YKGA 1SMKA