2A5GA

Cholera toxin a1 subunit bound to arf6(q67l)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
molecule keywords ADP-ribosylation factor 6
total genus 53
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5gA00
2N46A 1Z08A 5H8WA 3F3YA 3PV0A 5FOVA 4KO8A 4B34A 2D2FA 4MUAA 2X77A 5CYPA 3CRMA 1FQJA 1FX0B 3PJRA 4KVGA 4G5SA 4MKIA 4BFSA 2W58A 3U6KA 1HA3A 1U2RA 3KKOA 2GXQA 2HYIC 4PC3A 1TQDA 1IN7A 3NBFA 1D9XA 1KDRA 1NLYA 3RNLA 1E1QD 1F2UB 2DFKB 2XZOA 2OSBA 4G01B 1O3YA 2FV8A 5CK5A 1OHHD 3E5HA 5AUNB 2O8EB 2QI9C 3VKWA 1KMHB 3IIKA 3W5JA 2ZI6A 3I62A 3AP1A 1UEJA 1BOFA 3Q5DA 1ETUA 1Q1ZA 4LJ5A 2WOJA 2WVJA 4BLTA 2IUUA 2NQ2C 3A37A 2KI5A 3JVVA 3RS0A 1X8JA 2JLVA 2BMFA 3RC8A 4KFRA 2AK2A 2Q21A 2V7QA 1KI9A 4PAQA 2GJ9A 4C0KA 3TBKA 1D9ZA 2WJJA 1NL3A 1N0UA 5CJ2A 2QAGC 1DO0A 1NIPA 1GRQA 3PEVA 3T15A 1G9XA 2WHXA 2QQEA 3T12A 4MGIR 1ZD9A 3VR5A 1OSNA 4KV9A 2OG2A 1FP6A 1YQTA 2IA5A 4Q9IA 4XTRA 2PH1A 4JT2A 2IK8A 1KO5A 2H92A 2HV8A 4LPSA 2ZPTX 5EE1A 3DM9B 2A5JA 1DG3A 4LYJA 4CEIB 1MV5A 4PPQA 1T3LA 2NPFA 4EPRA 5FBWB 4B47A 4LHZA 3K8YA 3EIQA 4I1UA 1CBUA 1AQYA 3ND9A 4PAOA 1R4AA 2QBYB 2CNWA 4W5HA 5KUTA 3K09A 2KBFA 3M1IA 4C0LA 4PO1A 4GPTA 1XTSA 3GLIE 2GCOB 3NG1A 1FMLA 2WWIA 5EXSA 1KTVA 2BCGY 2WJVA 5EE0A 2E9SA 5FUXA 5TARA 4R71A 2O8DB 3Q9LA 1XMJA 4NYJQ 4E22A 2BKUA 1ZMXA 2P65A 1ZYUA 4OHZA 2JLZA 4JL5A 1TUEA 2AXNA 3OFND 4OJKA 1NRJB 1W49A 2F1RA 3BFKA 5DHFA 3RLFA 1YKSA 2OCBA 3NWJA 3L8ZA 1CJKC 1SXJB 4RKEA 4LBVA 4PQFA 3TR0A 4RD4A 1G5TA 3CZQA 5EP2A 1Z63A 1MT0A 1ZBDA 2VP6A 4Z8YA 5JWRA 1QHHB 4QBGB 1NBMD 4O25A 1KJYA 1MKYA 2IYQA 2OFWA 4C9BA 2Q9CA 4ILEA 4LJ6A 1UM8A 4DIEA 3R7WA 1G4AE 2GBLA 5KSPA 1A2BA 5FTJA 1F3OA 3FDIA 3IILA 4MGKR 4Q4JA 3DOFA 5F9HA 4AKIA 4PC6A 1N6KA 1IXRC 2ZUDA 1KSHA 5TVKA 4WVFA 1C1YA 2BOVA 3QKUA 2AHOA 2JJ1A 3B1YA 3GJXC 3MMPA 2ZVQX 1IJEA 2ZSEA 2ZE8A 4U02A 1G19A 3LO5A 1Z6GA 3CR7A 2FA9A 2HUPA 2Z83A 3PG5A 2IUSA 4QBFA 2J0UA 3PUYA 1WBDA 2BBSA 3R8FA 1Z29A 1KSJA 4TZ0A 1Q44A 4DUGD 1SVWA 4B3XA 2MSEB 1HT2E 4Q9JA 1TEXA 2IYRA 3ND8A 2EWVA 4JYCA 1G64A 2BVNA 4RY2A 4DEXA 4US2R 1QRAA 4Q1EA 2QQ0A 4TMZA 4M1YA 4PZYA 4YQFA 1IONA 2W00A 4ZCMA 2CJWA 4LV6A 5B58C 1AKYA 3U61B 3VKHA 1N6IA 1S1MA 2J5XA 2GF0A 3MSXA 4NL4H 4PR0A 2F9MA 4BPBA 2I4IA 1BS1A 1M8PA 1UADA 2CXXA 3SZRA 2ZRPA 4JLAA 4HATA 1WA5A 4NHOA 1XP8A 4M9ZA 2R9VA 4B32A 1VTKA 3KQUA 1OYYA 2YNMA 2QNRA 2YC4C 5DGXA 2VP9A 1ZM9A 4A15A 1KI7A 4PC7A 5AJVB 1UAAA 4QGFA 4IDHA 1E4VA 3R9IA 1TMKA 4JBWA 4CEJA 4JLKA 5JJIA 4HAVA 4TMKA 5H70A 1KK3A 2FEOA 3CUEF 3IBGA 3DO6A 4BZXA 2IS6A 5JI3E 2O8CA 2GEUA 3QUSA 4BLRA 1ZNXA 1R5OA 4BEBA 3B13B 4MRSA 4W9MC 2DYKA 1YU9A 3WP0A 2ZU0C 4FMDF 1TAGA 3B8HA 4CZ2A 4M1TA 5L3VA 1QVAA 4L9WA 1OT3A 3MWYW 5JS8A 3B1VA 3Q8XB 3AUYA 4PQYA 3SBDA 2ERYA 2WWWA 2H16A 4JBYA 4BUJA 4G3XA 2GWHA 3DDCA 1COWA 4KSBA 1KDOA 3O8RA 1FZQA 4BE7B 2GK6A 2HT1A 3RS2A 2FWRA 2H8KA 5SZKB 1DEKA 4EJSC 3OF5A 5DIFA 3LVRE 2YKGA 2FZLA 3BGWA 4V0LA 4A2QA 3L0PA 2JJ1D 2NIPA 2J3EA 3L0SA 2OZEA 4B6EA 1CKEA 4RSGA 2GJKA 3B9PA 4DDTA 4LYAA 1IXSB 1RRGA 5DYGA 4RD3A 3CPJB 4CRWB 3QENA 3PEYA 3GJ3A 4URYR 1AN0A 4ZDIA 1IY1A 4R2HA 2BJWA 3IHWA 4NCNA 4GZMA 2PCLA 3W34A 2ZIAA 1E1RD 4KHZA 4BGDA 2CMKA 2JJ2A 4DSOA 2G88A 1LNZA 1JXMA 1KI6B 1OPXA 1OIWA 3IQXA 3SFZA 3C41J 2YC2C 1NMZA 4JLVA 4KJZA 3BXZA 4F7WA 2ZJAA 4JIMA 5CIWA 4B74A 1FTSA 1GG2A 2QGZA 4Q9KA 5EE9A 3RWOA 2FN4A 2ZE7A 5EZ5A 5FTMA 2G77B 4ZV4A 4M9XA 5G41A 2BJVA 4AYWA 3N5CA 4BFWA 1I2DA 3H2YA 2XZLA 1UKEA 1G8YA 4WZ6A 3HU1A 4E07A 4A36A 1U0HC 1YZNA 1XMVA 2SHKA 4B73A 1E9BA 4JVMA 4HUTA 2IYSA 1E6CA 4HEJA 5CDFA 5E3HA 4HLQB 1LFDB 1BYIA 1VPLA 1JEDA 4EPVA 1KKMA 5GJCA 3CRRA 1DAIA 3B6EA 2VH5R 4GBMA 3P1JA 4Z51A 1E2LA 3KXIA 1HT1E 3V00A 2ZE6A 4ITRC 5EP1A 2ZRBA 4TL6A 1GRNA 4A0RA 2YZ2A 4BZQA 4I4LA 5JMTA 5J47A 3OFNA 4JT4A 4F38A 4M1OA 3THYB 4LYHA 2JLYA 3UATA 2ZR7A 1Z0AA 3U44B 3X1YA 1UKVY 2OHFA 1Q3TA 1YR6A 1OV4A 2VIIA 1P72A 5JS7A 4E09A 2H5EA 4Q01A 2AWOA 3K70B 1KOFA 3OE7D 1Z83A 4TT3A 2O8EA 4OI2A 1T0JB 4HAUA 2QM7A 3ICEA 4Q4AB 3HU2A 2C77A 5BW8A 4NYMQ 3GLIB 1IQPA 3QIAA 5DYIA 4PO8A 3U4QB 3AM1A 3L8YA 2XZPA 3I32A 3LY5A 2DHRA 3VHXA 5AK0A 2MMGA 1P2SA 2WMOB 2VQSA 4CT4B 1E2EA 1G3MA 2ZYUX 2ODWA 4RVCA 1XCGB 2ZS8A 1NBME 1SXJE 3LFUA 4OQLA 2EU8A 2ZRAA 3QKSA 4EDHA 1GL7A 3D7MA 3I73A 2IWRA 4I1VA 3VR6A 4LOAA 1M7BA 4HUQB 5DN6D 4OQMA 3M6AA 1T9HA 1E0AA 1A7JA 4HLUA 4TN1A 1NLFA 2JAQA 3GMTA 2OLKA 1YE8A 3TW4A 3KL4A 1DBSA 4LUCA 5FOXA 3BC1A 5HCIA 5KDOA 1UFQA 5EE3A 3BE4A 1GAJA 4GMXA 4LGMA 1E2IA 1W0KD 2LKCA 1IOZA 1L7VC 1TQ6A 3EASA 1QHGA 5D3QA 5K8TA 1JR3D 4FMCF 1FPMA 1E9AA 2CL7X 3FHCB 1UKYA 4DWJA 4LPKA 3ZDQA 4WOPA 3WYGA 2F9LA 3LVQE 3GLGB 1OH8A 5LD2B 1GP2A 1M2OB 4US0R 2NZJA 2R8RA 1L4UA 2Z4RA 4JLMA 1OYWA 3JZAA 4IVQA 1W0KA 3KKNA 5J4HA 2PZGA 1FNMA 4G1UC 5FBRB 2NTYC 3D31A 3WYFA 4B48A 2CK3D 2PLFA 4IXMA 1MRSA 1MOZA 5JBQA 1DPFA 1HH4A 4MYCA 3VR3A 2I1QA 3Q7PA 3BB3A 4N0DA 2AKYA 3NIBA 4A2PA 5DI3B 3NC1C 2B21A 1E9EA 1R0ZA 2A5DA 2HT6A 1P75A 1OH6A 2IYZA 1Z2CA 2QE7A 5LDDC 1UBFA 1ZM4A 3QF7A 1COWD 3RRMA 3BK7A 4TWZA 3AVTA 1LF5A 2ATVA 3KTAB 4TYPA 2R44A 3AP3A 4L4UA 1KO8A 4B3FX 4HYYA 1GZSA 2Q3FA 1P3JA 4ARZB 4KAXA 5EZ6B 1N6HA 1XJQA 2ZR9A 3MJHA 1KY2A 3OIUA 3W3AA 4OQXA 2R62A 5AJYA 4F4JA 2JJ8A 1ZNWA 3OHMA 1E0JA 1CTQA 1E2GA 3FMOB 4D4KA 4DLSA 4DDUA 5C46F 2NPIA 1QHIA 2ZI5A 5D3MA 2F6RA 2WJHA 4QC2A 2BBOA 2BCJQ 3ZVMA 1ZM7A 2IEYA 2P5SA 1E9RA 2XTNA 1UDXA 3UKDA 4QHYA 3QKTA 1II8B 1OFTA 5JEEA 3ASYA 2ASEA 4FI3C 4IHQA 2FF7A 2C9CA 3BFVA 1E3MA 3ONWA 1NKTA 3BH0A 4TL7A 1JI0A 1NN0A 2JATA 4I1SA 4OI1A 4CEHB 2X2EA 4NMMA 4UNQA 4LJ8A 4YC7A 4A92A 4WXRA 4XVQA 5FPYA 4DJTA 4BFUA 3TVTA 5JJLA 2X1VA 3SDZA 1U8AA 4NE2A 4U5XA 1S9DA 3DZDA 2UZIR 4GOKA 4JLPA 2V9PA 4Q02A 4CT5A 4Q21A 5JSZA 1YJ5A 1S4QA 2QEQA 4MYUA 2GF9A 1HYQA 1LB1B 2YINC 1X6VA 4KCGA 3LW8A 4LY6A 2RH5A 3KXLA 3FE2A 4PSVA 4RJLA 2Q3MA 4L16A 5KSYA 4RD0A 4NKRA 5J4KA 4RFSA 1UPTA 2XB4A 4NYIQ 2IYUA 1MABA 2PMDA 4DKXA 1D2EA 1G41A 1RW4A 3Q85A 2IYXA 3NDBB 5E95A 3EZ6A 2J0UB 1E4YA 3V9PA 4ASUD 1RYFA 4L5BA 2PJZA 2XJ4A 3VHLB 3QOFA 1CS4C 4V0ME 1B23P 2ECKA 3C8UA 3IDQA 2VP0A 3I92A 1W44A 2P6RA 1GNQA 4ESHA 3DPUA 2B7CA 2F3TA 1NJGA 4A6PA 2QAJA 4TT3D 2NO7A 2E87A 3BS4A 2H17A 3WMEA 4Q03A 3A1VA 1W4BA 2WAXA 1KKLA 1CXZA 4QHTA 5KDLA 1JAIA 2YYZA 4G0NA 1UEIA 3SYKA 1OKKD 1Q12A 3A8TA 4C0QC 3PEWA 1M6NA 1ZCAA 1SKYE 3ZS8A 3AV0B 4LBZA 2BM1A 2R6DA 4V02A 1NMYA 3ZD7A 3RANA 4E5UA 2WSSA 3I8XA 4FWTA 4J0QA 1EWRA 1K6MA 5F2EA 1XPUA 1EFRA 2FSGA 5FTLA 4KYUA 3AB3A 1R10A 2Z0MA 5UKDA 1GNPA 3TLXA 3ADCA 1XEWX 1N5JA 2IEZA 5TDHA 2XXAB 2ANBA 4QG7A 3MAAC 4Y0VA 2IYWA 1HV8A 2FE4A 4DC9A 5BXQC 1GIAA 4FN5A 4Q4AA 4PC2A 1N2CE 1XBTA 3GJ5A 3QXSA 1NVUQ 2CHQA 2BMJA 2QU8A 1WF3A 1CRPA 4ZO4A 3BD9A 5FBLB 3ZJYA 1U99A 2BV3A 4ARZA 4GZLA 1EESA 5DISB 2BDTA 3CRQA 3PUXA 3EZFA 1GFIA 5CLLA 1W36C 1EWQA 4GT1A 3P4XA 3TR5A 3Q72A 3VR4A 3WMFA 1GM5A 1ZUNB 1SVSA 4RZUA 1E2QA 5GJWC 2RGNA 4US1R 5G53C 2O8BA 3VAAA 3D3QA 1XF9A 4M21A 1PUJA 1DVRA 4HB0A 3AUXA 2GRJA 2H1LA 3T06B 1JEEA 1NSTA 1M74A 2RMKA 1RRFA 5E7IA 2ZYVX 5E7JA 1KJWA 2WWXA 1EFHA 3NEYA 4PHHA 3JZMA 4A6XA 4AG6A 1A4RA 2REBA 1W1WA 5JZVA 2GAAA 3OAAD 3SJZA 1KJZA 2P5TB 4KI0A 4NCHA 4P0TA 4TYYA 2CCJA 1W47A 3LH5A 4A8JA 1GOTA 3KZ1E 2PZEA 1TF2A 2GETA 1XX6A 1XD2B 4S2EA 5DO9A 4M1SA 2ZJ8A 1NKSA 2E1RA 3EPHA 1CULC 1P4SA 3B85A 1G3QA 3K0AA 1ESNA 1XEWY 3EZ2A 4LC0A 4NCIA 1OHHA 2GZAA 3DVLA 3VQTA 5EUQB 3T1OA 4C0BA 2XJ9A 2P0EA 3N70A 4XOIA 3NHAA 5B2ZA 2OAP1 1G1MA 3VX4A 2XXAA 1UJ2A 1NVXQ 4OQFA 4JSTA 3SFVA 1UBCA 4YMSA 1G21E 1Z3IX 2QAGB 4TLBA 2WKPA 4IW3B 4X8OA 2F43A 4JZKA 3W9YA 1QHNA 5HKKD 5KNCA 3HYRA 2JLUA 4KSCA 4TMXA 4II7A 1DOAA 5CM8B 4MRNA 3PXGA 2N42A 4LX0A 3QKSB 2R6GA 3E70C 1IBRA 4MKHA 4TMTA 2QT1A 1OXSC 1BMFA 2AFIE 3VR2A 3PIRA 2YHSA 1YR9A 4R9UC 1GSIA 1MO6A 2OESA 1G17A 1XJ0A 2GBLC 4Q7MB 4P31A 2GVZC 3CWZA 1DAMA 3VR1A 2C04A 3IQWA 2BIFA 4RZ3A 3LNCA 1ELOA 3HJNA 3A1TA 4GSYA 3CX8A 1AS0A 3BB4A 4BWYA 1II9A 1ZM3A 4N3NA 1TX4B 1VG1A 1ZUHA 3QXHA 4LJAA 1VG0B 1NF3A 2QP3A 2J1LA 2ZS7A 2OM2A 4YMVA 2W2XA 4CF7A 5TB5A 5JCPA 3FFBA 3NHBA 2N1BA 2QTVB 1ZAKA 4P32A 4EKDA 2O0JA 4DXAA 1VYTA 1G20E 4D81A 2FJUA 2GXSA 2IXEA 1XD2A 3CX7A 2PEZA 4WZBE 3QKRB 5F98A 2JLSA 2OCPA 2DWQA 3ZVNA 1BIFA 5FR2A 1DARA 1JBKA 4PXAA 5JRZA 1UDWA 2BC9A 4EQ6A 3IPXA 4DRZA 1RRCA 1U90A 3LRPA 3KUCA 1HQYE 1E1RA 1I2MA 1GKYA 5L3SA 2X2FA 3LQQA 2AL7A 3GJ6A 4KFSA 5JSZB 3U60B 1L4YA 2IHBA 2C2HA 5DI3A 2RHDA 1QHHA 4AC9A 1R7RA 2QZ4A 2ZI7A 2ZS9A 3FVQA 4NDZA 5KPDA 2V6JA 2OXRA 2R6CA 1DAEA 4EFNA 2ZRCA 3B1WA 1KAGA 4FMBB 1XZQA 5AJZA 4IEIA 2GESA 1WXQA 1OH7A 5FBQB 3WY9A 4RKFA 3TSZA 3BIFA 4AWXA 4D6PA 4C0AC 3R9XA 3A4NA 4OHVA 2ZTSA 3THXA 2OBNA 4AKHA 4Q18A 1E9CA 1TUIA 3U7EB 2O8DA 1CJTC 3P20A 5M04A 1PZNA 1P2UA 4IFEA 1AJEA 4D0LB 1DAFA 3Q7QA 4ZDWA 4KITB 5KU1A 3FKSD 1OF1A 4GNKA 3T1VA 4UKDA 1D2NA 1C9KA 2W83A 1N3BA 1KYIA 3IIMA 2R65A 4MRVA 1VMAA 3AVYA 1PV4A 3W6NA 1KK0A 4B2LA 1Z07A 2WPDD 4CGZA 4C2TA 2HEIA 5HPYB 1E79A 2J0VA 4LHXA 2VHCA 4LDJA 4N0EA 3W3ZB 2FSFA 4EPTA 3CLVA 3K0FA 4JMPA 1R2QA 4DDWA 1MABB 4FCWA 3WHLA 1E96A 4A8JB 2P6UA 3EC1A 4M4SA 4TMWA 2IBMA 1R8QA 4TQAA 4O2LA 3OEHD 5JHHB 3UWKA 3K9GA 4YXWA 2OBMA 5IRCD 1QVRA 4EPWA 5JEDA 4Z1MA 2GJSA 1QG4A 4XVRA 2YV5A 1CR0A 2V1UA 5KYKA 4Z8XA 2P6NA 3RSOA 2FFAA 4DCUA 5JHGB 4P3YA 2ZE5A 2ZJBA 5C1BA 1DE0A 1KHTA 1M1YE 1QHYA 2D7CA 2ZI9A 3N2IA 4MYHA 4ACAA 3U3JA 2FFBA 2KJQA 2OO7A 3C14C 4MKGA 1AS3A 1GL9B 2JLRA 2WBLC 4JYBA 4M1KA 3KQKA 2ZQ5A 5EJEA 3QJYA 2QAGA 4LCBA 4WW0A 4IOJA 5KDDA 4M9QA 5HKKA 1Q0UA 3CX6A 2F7SA 3REGA 5A5GA 1QBKC 1EK0A 2BMDA 1QZXA 3GLGA 3TUZC 2C96A 4FINA 4DLXA 1FW6A 2PL3A 2KBEA 1P62B 2Q0HA 2Q9AA 3UPUA 2HYDA 1Q57A 2WV9A 1P2TA 4V0NA 4WBSA 3AVUA 3IPYA 1H8ED 4LHYA 4ABYA 1R6BX 2FH5B 3PITA 4G5GA 1N5KA 2VP4A 2ZEJA 5G40A 4AYXA 2F1HA 2QY9A 4I99A 1X8LA 4XH9B 2F55A 1E2JA 4QM6A 2ZRJA 1SVMA 4HB3A 2FDCA 3O8BA 4DB4A 3U3RA 2NMVA 2CLDX 4JS0A 3T34A 5IHPA 3AF0A 4D26A 1G8PA 3DMNA 5JWOA 5DNYB 1LV7A 2IWHA 4A2WA 4ERNA 4WZAE 1W5SA 2ZI3A 1X1RA 2G6BA 2CDNA 2ZSBA 2WZQA 4QBHA 1CR4A 5J5CA 2O0KA 4KFTA 4ZIRB 3WRYC 2TMKA 3O8CA 2BEJA 3V4RA 2IS2A 2IF0A 1LF0A 2GA8A 3FTQA 1SKYB 2QENA 5KTYA 3AKCA 2CJWB 3K0EA 1W7AA 3FHTA 4C7OA 1S2MA 3JVUA 4FIDA 2QP9X 2Q3HA 2YOHA 2EVWX 1Z5ZA 3I3SR 1OJLA 5L3SB 1XFAA 3E1SA 4YMTA 1KAOA 4F4CA 5EXXA 2G9NA 2O8BB 1ZP6A 3Q3JB 2QROA 2GDJA 5JWHA 2GVDC 2J7KA 3ZZTA 2GNOA 2NO9A 3QSYA 4PSAA 2XSZD 2CL0X 4QHSA 2WKRA 1LTQA 1I4DD 1M7HA 2EFHB 1J70A 2XOKA 3CB4A 2ZYTX 1KZGB 2C5LA 4BLSA 4HZIA 3NH9A 1Z0FA 1ZM2A 2NO0A 2J7PD 3NKVA 1JR6A 1G6OA 2CHGA 1N0VC 4RFSB 4Y0AA 4EFMA 4LRWA 4UXHA 4K46A 3GEEA 3U44A 5G3YA 3KB1A 4D4MA 2MSCB 2HCBA 2H7VA 2DCUA 2KB0A 3X1ZA 1ZW6A 1OFIA 2GEVA 3A1UA 1IN8A 3IUYA 4XWAA 2CEAA 3O47A 4IDNA 1S1CA 4D82A 2NO6A 5FTNA 1OXTA 2YVUA 2D7DA 1FX0A 4OL0A 1W0JA 1SXJA 4UNPA 1F48A 1NY6A 2ORWA 5AUQA 1AM4D 4Q00A 2XAUA 1GNRA 1CLUA 1QHSA 4IDOA 4Q66C 2DFTA 1NVVQ 1OIXA 1NMXA 4AYTA 1G3UA 4NP6A 1TU4A 2YOFA 1NN1A 2OT3B 2CK3A 1W5TA 1F6BA 3EXAA 3MJRA 2ZAMA 1GRRA 3H0KA 1U0LA 4FW9A 3T1TA 2IL1A 2C78A 5BYKA 1Z22A 1XEFA 4Q7LA 1NY5A 4DLZA 5C4MA 1DAKA 2D3WA 2IX3A 2EYUA 3QEJA 4OI4A 3ZGXA 1AA9A 2JCSA 2HXYA 4IVRA 4MH0R 1RVDA 1OE0A 2FZ4A 5DLQC 3B5JA 5HCNA 1CJVC 4P4SA 4IDQA 4YLGA 3AVOA 4G5OA 1ZVQA 1Z6XA 2C99A 4PZZA 5TV2A 2D2EA 1VCNA 1KK1A 4TL9A 2GTPA 3FFAA 3I1FA 4X8MA 4D0NA 3TIFA 5L3QB 4ESVA 4URWR 2FPKA 2GCNA 4Q1FA 1V43A 1ZC3A 2IYVA 3THXB 3MG9A 3VFDA 5FUWA 2QMUA 4JLJA 2ORVA 5LB2A 4DCSA 2D4HA 3HPQA 1PLKA 1UBGA 2RGCA 5JLJA 1E0KA 2V6IA 3HPRA 4LK2A 5KSOA 4JLDA 1ZD8A 1T3SA 1VKJA 4QFMA 4C30A 2QM8A 2V1XA 1OFHA 1O87A 3WNCA 1XEXB 1A1VA 1ODFA 4JL8A 1E79D 1AKEA 1KGDA 1US8A 3ETLA 3MWKA 4R2IA 5DE3A 2RB4A 1AGPA 4LYFA 2GCPA 4PSKA 1KI3A 2Z43A 2QPAA 3Q5EA 3AF4A 3KKQA 1JJ7A 1KO1A 1G16A 4PX9A 1JNYA 3L2OB 1DS6A 4ASUA 2ZRMA 4XWKA 4JVSB 5LD2C 2QMOA 3CO5A 4LSGA 2IF2A 1UKZA 3BOSA 2O8FB 3LV8A 3LBHA 4B2PA 2DFLA 3TK1A 4M1WA 4QXAA 1CEEA 2VSXA 4DSTA 2YWEA 1JJVA 3CF6R 1YZKA 3GCGA 3IBYA 2OCYC 3SI7A 2ZU6A 3EWAA 2ZANA 3TQFA 2G0NA 4P33A 3U7FB 1IHUA 1KSFX 2ORIA 2OFXA 1SVOA 3EX7C 3CR8A 4L15A 4Q7JB 3CPHA 3ZS9A 2V8OA 3GJ0A 4LHVA 3G82C 1EFRD 4BLPA 1T6NA 4F91B 1EFUA 2HCJB 4Q5IA 4C7OB 4OBEA 1FTNA 3CKLA 4R98A 4AY2A 3DMDA 1RE0A 2AK3A 3OEEA 4POAA 1HURA 3IGFA 4IKEA 3LXXA 1RIFA 4AIIA 3AKYA 2WWFA 5JRJA 2W6JD 1G8FA 5J4VA 2F43B 3PR1A 2WOOA 2FSHA 2J9RA 3D8BA 1P9NA 3IO5A 2C98A 4HUQA 3E2IA 4Q19A 4UXJA 5AUPB 2CHVA 4OJQA 5HR5A 4DSUA 4CW7A 4AKEA 3H84A 3TH5A 2G1JA 4B33A 2FGKA 5SZJA 2PBRA 3K0CA 5IDVA 5IF9A 4NH0A 1Q20A 3PUZA 2JGNA 4C0HA 1Q21A 4URUR 1W4RA 3GLGE 2WJIA 2B92A 3PQCA 4LWZA 1YRAA 4FCTA 4OQNA 5P21A 2ZAOA 2XNDD 1IM2A 4QJ5A 4C2UA 4LC1A 5HZHA 4HB2A 1GKIA 1PLLA 4DUGA 2AD1A 2BWJA 3ICQB 1VCIA 1SVLA 2JASA 2GHIA 2B6HA 3AKDA 4TLEA 5FPKA 1S0UA 1KY3A 3EAQA 1GL6A 1PVOA 3A4MA 1E32A 2L0XA 2YJTD 2ZREA 4YXWD 2BM0A 3R7WB 2WMNB 4B71A 2ZRLA 1E9FA 2GAOA 2ZRNA 4JVLA 5EUMA 3THOA 1AK2A 2GXAA 4MDEA 3X1WA 1DO2A 3RDPA 1N5LA 4H9GA 1WRBA 4KYIB 2DWOA 2B8TA 1T91A 1XNJA 3GFOA 3KB2A 3RABA 3UANA 4IOLA 421PA 4A82A 1DG1G 1XZPA 3NH6A 4FCVA 4I81A 1ZC4A 3LDAA 1F5NA 2WIAA 3OIYA 2AXPA 1KDPA 5LBIA 4YMWA 2IYYA 4DLYA 3FMIA 2W0SA 2G83A 4M2LA 1J99A 3TGPA 3EPLA 1XD8A 5FUYA 2C03A 3K9NA 1D8TA 1U94A 4B44A 4TTPA 3SYLA 3AVXA 4CEIA 2W2VA 1ZNZA 3T5GA 1FUUA 2XB2A 3T35A 2ZRGA 2O52A 1SKQA 5D3MB 4KBGA 2QBYA 4KLNA 4ZI3A 3X1XA 2C9OA 1HQCA 2LWIA 4DDVA 4AURA 1E0SA 5DN6A 2X19A 1E2HA 1FFHA 2VF7A 2WSMA 1TQ4A 3AGPA 3DZ8A 3EW9A 4JLBA 1K5DA 1A5TA 3TUIC 5KNDA 4D25A 4XJXA 1XXHA 3B2EA 4PHTA 1T5IA 1G7CA 4HI0E 4Q4HA 4OYHA 2ZI4A 1ZIPA 1WCV1 2NZ8A 3B1XA 3U6BA 2V3CC 3M0EA 1TQ2A 3SEAA 2IUTA 2CL6X 4XVUA 1KMQA 3K0SA 5IK2D 2J0QA 3NBXX 4WA7A 5DSZA 3QF4A 1KI4A 3QBTA 4PPGA 1RJ9B 3LXRA 1NN3A 1VYVA 1X1SA 1XXHE 1P9RA 4RD6A 4TSFA 4A4DA 1ZD1A 3AF3A 3MWLA 3LLMA 3WMGA 2IYTA 5LB4A 1RKBA 2QMEA 4MGYR 4GOJA 3UG7A 2HJVA 5CJPA 4URZR 4OHYA 3GJ4A 4B3GA 3ZYCA 2QG6A 3VTKA 1A2KC 4DLTA 3PEUA 5HZKA 1S8FA 3K70D 821PA 4JJKA 3SJAA 3TUJC 5G3ZA 4PTLA 1W36B 3SE0A 3CIOA 4TYNA 1XB2A 3G5UA 3R9WA 4F92B 3UMFA 4EIWA 1TNDA 5FPSA 4HSEA 4DSNA 6Q21A 2QPOA 1W46A 3AVWA 2WM9B 1U8YA 2PCJA 3EIHA 2RHMA 4DCTA 4EPXA 1Z0DA 3GJ7A 3LQRA 2CE7A 3ZIAD 3X1DA 5AUOB 3G0HA 3VNUA 1ZINA 2FMXA 1B0UA 1SXJD 4B43A 2QRZA 3IO3A 3QI2A 2RCNA 4HDQB 3MRSA 4RCYA 3DKPA 3H4MA 2WTUA 3A1SA 4M9SA 1F2TA 1K5GA 1OXVA 3CRW1 1Z47A 2ONKA 2J59A 4JBXA 1GKUB 5AWFC 3SHFA 4WIAA 2PX0A 2J0SA 4BEJA 4KBFA 1XTRA 2C8VA 4B3DA 5BN3A 3SN6A 2I3BA 4CEHA 4CEJB 2VRWA 1KK2A 2EFCB 2X8AA 5DHAA 3I61A 3P4YA 2ZJOA 1P7CA 3ZD6A 3J81k 2VLIA 521PA 4BASA 1JQLB 2FEMA 3EZ7A 1XDBA 1VCOA 3K53A 1II8A 3NTUA 2ZM5A 5FL3A 2CBZA 5GJBA 3I5YA 5EXPA 3GLHE 4V0OA 2GCOA 1HY3A 4HZUA 1W4AA 1X3SA 3OESA 2QPTA 2CVFA 3BRWD 4ZPXA 3U4QA 5FOTA 3RS4A 3EC2A 4V0KA 4HB4A 4XWOA 3OIWA 1CRQA 2VP2A 1CU1A 2PJRA 1EX7A 3FMPB 4DZZA 1G3IA 1W36D 4QGGA 2IS1A 4TLCA 1ZU4A 1OIVA 4CYMA 1OB2A 2FFHA 4GOXA 1BYUA 1IY2A 2QUZA 3C5HA 1RC8A 1IN5A 1KI2A 1Z28A 3KJIA 3W6OA 3AVPA 1QHXA 2EWWA 1G5PA 1E9DA 4Q1AA 3BERA 3PVSA 2DFNA 3RWMB 4JKYA 4YMUA 3MUFA 5FOSA 4OKSA 4CDGA 4I1OA 3K09C 4XIGS 1NVVR 3K9HA 2VP5A 2ZJZA 3NDPA 2D62A 3KUDA 3WBJA 3SQWA 4AI6A 3DEFA 4BFYA 4B76A 5TMPA 2NO1A 5C18A 3U3OA 4HDCA 3TAUA 4C4PA 3R8CA 2J87A 4DLWA 3CRVA 1W2HA 2Z5FA 2QA5A 4ACBA 2VSOA 5HTKA 4MKFA 4Q1BA 5L8VA 4O3MA 5FL7D 3VMFA 2A78A 5B30A 2Z4SA 4BLQA 5GJVC 1VIAA 5B57C 2JLWA 2JIZD 3KXKA 5KHOC 2PZFA 1IN4A 1HE8B 1N6LA 1T5LA 2QRNA 3AKEA 3FKQA 1VHLA 3KX2A 2CNWD 3L0IB 3W8RA 1OLOA 4GP6A 3CM0A 4Q9LA 2GZDA 4Q1CA 3BJIC 2VHQA 1Z6YA 4TMVA 4QGAA 3SNHA 4QGHA 3UK6A 3TJZA 2O8CB 2ZRHA 4HAXA 4M0LA 4TYQA 5FFMA 4BFZA 2JIZA 5CB6A 1NVWQ 1YRBA 4B75A 8OHMA 3B60A 1ZIOA 3EPKA 5KO2A 1CIPA 1KIMA 1TADA 3DL0A 2BMEA 4L8GA 1NP6A 5JJKA 3QEOA 2VEDA 2RGGA 4DVGA 1OW3B 3KTAA 4QNRA 5E4FA 4GFDA 1Y3AA 1LY1A 2ZRFA 2FOLA 4JSYA 3W5IA 3QG1A 2V7QD 4KU4A 4C3ZA 5FOWA 1RRPA 5K8IA 4LHWA 1BH2A 2W6ID 3UG6A 3CNNA 5F3WB 2JLXA 1DTSA 1NBMA 4QOSA 4NBSA 4AKGA 3FYHA 1G8GA 1S9HA 3WNDA 1JPNA 2XX3A 1GILA 3GP8A 3HWSA 1JECA 1KDTA 4X8HA 4BECA 2WPDA 2ZJYA 5DH9A 4ON9A 2REXB 4A9AA 1AZTA 2JLQA 4GRAA 5TY0A 2ZXUA 1KI1A 3GPLA 2H18A 4G5RA 5FR1A 4KLZA 1N0WA 1OXXK 4NCJA 4TL8A 4RFVA 1KNXA 2VTKA 2ANCA 5CIQA 3WHKA 1P2VA 1D2MA 2FPLA 1Z0IA 2Y8EA 621PA 3H1TA 1UF9A 1KMHA 2K5UA 3MGCA 3RS7A 3AQ4A 4FMDB 2DB3A 2QTHA 1H8HA 1XU4A 1F2UA 4Q4JB 4A8JC 4BZPA 3N2EA 2ZSDA 2XITA 5KPJA 2A5GA 3DM5A 3THYA 4GDFA 3LD9A 4LJ7A 4JLNA 1HTWA 3WRXC 3QPUA 2AFHE 121PA 1PLJA 3GLFE 2QP4A 3KQHA 2D06A 2AR7A 3KFVA 2ATXA 4ZI2A 1R5NA 3HR7A 2BBWA 3TNFA 4IFBA 5FTKA 4A1FA 2CLSA 1WE2A 3BB1A 4UQOA 3RRZA 4DLVA 2AWNA 2WICA 4KXFB 4DIDA 2G0TA 3AF1A 2HLDA 2OE2A 3THWA 4OK3A 2RGNC 1DELA 2UZ3A 4QNMA 4K81B 2G1KA 5EP3A 3ADKA 2BBTA 4PO9A 3V4FA 4RZ2A 4EFLA 3FPAA 2WWYA 3KKMA 2Q9BA 2FG5A 5JCZA 5EP4A 2IT1A 3CNLA 4GP7A 1DADA 1RFLA 1H8EA 2XNSA 3WNBA 3I4LA 3OIVA 3ZVLA 1G8HA 4B3CA 2CVHA 2DPXA 4JJZA 5A0FA 3PUWA 1U0JA 4XSGA 1C4OA 3B82A 4IJMA 5KSZA 3TVDA 3KJEA 3SJCA 2O0HA 1BKDR 3WP1B 2XSZA 3C15C 5DI9A 1AS2A 4OHWA 2F1IA 3IEUA 3BORA 3KJHA 3K0AB 1AIPA 2V54A 1NNEA 4WXPA 4IDPA 1RJ9A 4BLOA 1LW7A 3GD7A 2W6JA 4MGZR 1OH5A 1GVNB 1KI6A 1N6OA 2LKDA 2QORA 1EG7A 2B8WA 3B1ZA 4MRRA 2VSFA 1N6RA 4MITA 2EYQA 3A4LA 3AH8A 4TZ6A 4Q4HB 4FD2A 2HJGA 4ZIRA 2RGDA 4P4UA 1SXJC 1Z0KA 2AN9A 3IKJA 3QXXA 3ZVRA 2IS4A 3R20A 3ADDA 1MR3F 2Z6VA 4NCKA 4TLDA 3C7KA 4PZLA 5HE9A 5GVRA 1RYHA 4B6FA 1LS1A 3MLEA 1R0XA 1AQUA 3W8NA 1VECA 2W2TA 1JAHA 3HDTA 4LBYA 3LBNA 4B3BA 5FBVB 1M34E 1TPZA 2J7PA 1MH1A 2A2ZA 1AGRA 2KWIA 4JVNA 1R0YA 3GLHB 4M22A 3BFXA 2BHRA 1P73A 1VDZA 3LLUA 3FKSA 1J8YF 1U98A 5FPTA 1MO4A 2KSQA 3LX5A 4H1UA 5AJXA 4UNNA 1JR3E 4FXPA 3I8SA 1YZGA 4GI7A 1IAQA 1WQ1R 3F8TA 1I4LD 3CF0A 3RC3A 3U3MA 2EQBA 1IN6A 1S3SA 4TTRA 3HR8A 4XTCS 2XEXA 4UJ5A 1FL9A 4TTQA 1FOEB 2RGBA 2VPPA 2CE2X 4WAUA 3A58B 3UMRA 4UNSA 4D4JA 1KI8A 2H57A 1E2PA 2BKEA 1E2NA 1CP2A 1NN5A 4LI0A 5EE5B 2ZR0A 5FI1B 1HE1C 1XTIA 3KKPA 2GZHA 1U9IC 4TQUS 1Z8FA 4DEYA 2XGJA 2A3RA 2MMCA 3A1WA 4R7ZA 2AD5A 1EFTA 4Q48A 1NLZA 4BQSA 1Z6TA 2KE5A 3FGNA 4MYTA 5FH9A 1WMSA 3UMSA 4TYWA 2ZYWX 3K1JA 3CBQA 3MCAA 1T8UA 3GLFA 1W4CA 3B78A 3AF2A 2NGRA 1FMJA 1P60A 3DOEA 4PQRA 3UWOA 1N25A 1VIYA 4GMDA 2ZSFA 3GQBA 3EARA 5BQ5A 4URVR 2R6FA 1MO5A 2QGNA 2VHUA 3BBPA 4U7DA 1G4UR 1KZ7B 4EAQA 1F60A 3VU9A 2ZUBA 3WBKA 5KOYA 3DHWC 4W5WA 4HZUB 4GL2A 5FOUA 3VX3A 3HP1A 3T5DA 1QDEA 4X8LA 5H1YA 5E7MA 1G7TA 1SULA 1XMIA 3CONA 5IK2A 1YVDA 1JALA 2GJ8A 3GLHA 4QJ3A 4HLDA 5GVSA 4DHEA 1GDDA 3THWB 4BRUA 2IHYA 3LAWA 5BN5A 4HAYA 3KFXA 4PPNA 4QKQA 2RGXA 5GADl 1XTJA 2PX3A 4YDHB 2F3RA 1YHNA 4EJSA 4KVAA 3VKGA 2REOA 3WYAA 3EZ9A 4IEEA 4JLOA 1ZU5A 3TQCA 4AD8A 3OEED 3QPWA 1FUKA 1TL7C 1BMFD 4EJSB 3CZPA 3OZXA 4OI0A 4RD2A 2WWHA 2UKDA 3O8DA 2PMKA 3LX8A 3NC0C 3A6PC 2VYFA 2OCAA 3CH4B 4HLCA 2QSZA 5CDFE 2GK7A 1IJFA 3H86A 4NYMR 1LVGA 2IYLD 4MRPA 2G3YA 2OUKA 4XD7D 4AK9A 2RGAA 4P4TA 2R2AA 2HF8A 4TQ9A 3RHFA 5ELXA 3REFA 1I4TD 1K8RA 2A9KA 3P26A 3QKRA 3EA5A 1ONBA 4LV8B 1XJCA 2HDNB 1JR3A 4G5QA 3VU9B 3NBZC 2VF8A 4PC1A 4DCVA 1DAGA 3EWSA 3QBVA 2ZROA 3NEJA 2O8FA 2V4ZA 2ZETA 4OHXA 1NJFA 3SYNA 2QSYA 2ZJ5A 4PFSA 3RYTC 2QTFA 4DT1B 3GLIA 2JJ2D 1E9SA 2VHTA 1ZCBA 1ZUIA 4HLUC 2VL7A 4O2RA 3PCRB 2JDID 4JL6A 1E69A 4QRHA 1G7SA 1XEXA 3DKVA 4U00A 3L82B 2VO1A 1P6XA 1Q1EA 1E94E 4M53A 3TAHA 3C5CA 1Q1QA 1JQJC 3RSLA 2WJGA 3TRFA 3CWQA 4ZDKA 4PHGA 3KJGA 1EFCA 2RGEA 1XCMA 3ADBA 3QG5A 5JECA 1EXMA 5CYOA 3NVAA 3LW7A 5K8UA 1ANKA 1Z2AA 5J4YA 1IY0A 1T4GA 3QVVA 4B2IA 2MSDB 1XD9A 2HF9A 5FI0B 5TXGA 4UJ3A 1AZSC 4MDFA 1DAHA 1XTKA 1F2TB 5L3RA 1CJMA 1JB1A 1Y63A 3QXJA 1SHKA 2P3SA 2HXSA 4FWIB 4IXNA 3TMKA 2A5YB 4M8NE 1YR8A 2PEYA 1II0A 4JKIA 1XWIA 3B7GA 4N1AA 4W5JA 3K70C 5CITA 1FP7A 4QJ4A 2V55B 1NG9A 2F1JA 3BH6A 3LA6A 1ESMA 5C4GB 1T0HB 4MA4A 3U5ZB 1TTTA 4D0GA 4NTZA 4KFUA 2GEDA 5CK4A 3M4YA 1JXOA 4IRUB 4XD7A 5BWMA 1E99A 2FNAA 3MD0A 1L2TA 3P27A 2IW3A 1BO6A 3QE0A 2XTMA 3SQXA 5LPNA 3GLFB 1G7RA 3OAAA 1W0JD 2ZRIA 5EXTA 3K0CC 5CLQA 4PAMA 4AG5A 3UIEA 3BWDD 3HYTA 2OBLA 3AP2A 4NPHA 1CR2A 3SBEA 4IOKA 3TW8B 2QL6A 4E03A 2IXFA 3TSWA 4RZXA 4BFVA 1P61B 2NG1A 2YOGA 3MWJA 1YZTA 1G291 1V5WA 3ZQJA 3FB4A 4QBIA 5F9FA 4OK6A 2C9YA 4DBLC 1VYUA 2FX3A 3CNOA 1U9IA 4BFTA 4C0JA 5SZHB 5JI2E 5FUVA 3CF2A 3KQNA 3ECCA 4ZDJA 2ZVPX 4UXIA 3I5XA 3ZIAA 4ZKDA 2WWGA 3SS8A 1YZUA 2D74A 4ZCIA 1G5RA 1KO7A 4A0HA 4D2IA 2WAYA 3AVQA 1SQ5A 3F0TA 4YDSA 5EQTA 1XRJA 2EW1A 1L8QA 2JEOA 3K9LA 4HDOB 4Z54A 1HUQA 1FQKA 1NSFA 2W6IA 1VHTA 1WB9A 2J45A 1E2FA 4V03A 4MQBA 3SR0A 4LV5B 4DCNA 3NXSA 3I72A 1X86B 3SOPA 2OXCA 1CJUC 1H65A 1KO4A 2ODEA 4NYIR 3SC3A 3RAPR 4A0GA 2OAQ1 4NYJR 1XPRA 3IHLA 2OLJA 2OEPA 2C95A 2EFEB 2WJYA 1ZJ6A 2QE7D 4HAWA 5FL7A 1KNQA 1N6NA 2J46A 1OFUX 1VCMA 4IVPA 2VBCA 1P9WA 4BFXA 4F4IA 2QMHA 3ZH9B 2WSSD 1OB5A 3FHOA 3LBIA 3T1QA 2FU5C 1NG1A 5J40A 3CPEA 3P32A 1N5IA 1VG9B 2QN6A 2ODBA 1SVIA 5SZIA 3IEVA 2GKSA 2P67A 4CVNA 2DY1A 1S3GA 2GILA 2EFDB 5HE8A 3C4JA 3S1AB 2DWPA 4ZKEA 5BN4A 3A36A 1S96A 4LJ4A 5J4LA 1HEIA 2RKOA 2ZITA 1PJRA 1OXUA 1UBEA 4S35A 1XMSA 2OV2A 3QY0A 2XNDA 3AGQA 2QT0A 2UVQA 1W48A 1T3HA 3OE7A 3QQ5A 4Q7KA 2ZRDA 1WDTA 2AX4A 1TF5A 3RRYA 1Q22A 2XOKD 2FGJA 1GWNA 3EG5A 2CCGA 1E2KA 4LZZA 3RS5A 1A82A 3GFTA 3QXCA 4HAZA 2HLDD 3ZQ6A 3KQLA 1D6JA 3U3KA 1TEVA 2YWGA 2YWFA 2VA8A 2B7BA 1E98A 4RCZA 4TSFD 1US8B 2GXUA 3NBYC 3ASZA 4OK5A 2YWHA 3BH7A 1Z6AA 2A5FA 2P2LA 4D4LA 1D5CA 4D80A 4B35A 2WIBA 5JFGA 5CB8A 4NZYA 3QPVA 1M7GA 1Z0JA 3F5FA 3EPJA 4PHFA 4IOMA 4M1MA 1U81A 4LBWA 3GJ8A 1EX6A 1R8SA 3T61A 1XXHB 2FSIA 1E2MA 3VNVA 1ZNYA 1YR7A 5CM9C 1G6HA 4H1VA 5L3QA 4DB2A 3AVVA 2FFQA 1XTQA 4FMCB 4PPFA 2BEKA 3B9QA 2PLRA 1MRNA 2FPMA 221PA 1TU3A 2PT5A 1GTVA 3LWNA 3W6PA 3CW2A 1H8HD 3D6TB 3BAFA 4DT1A 4P4SB 1G3RA 1CF4A 1U8ZA 2CLCX 1Q3HA 1Z06A 3ZZ0A 4Q47A 2W0MA 1GUAA 2NOAA 1SVKA 4KODA 2ZUCA 4LJ9A 2GJAA 5BYJA 3SJBA 4XSHA 1R5BA 3GEHA 4W7SA 3TKLA 1KSGA 5IT5A 1NI3A 4LJYA 1E1QA 1FNNA 5B64A 2ZJ2A 1QG2A 3U7HB 1JPJA 4Q4LA 4DLRA 2XTZA 721PA 2PT7A 3QNUA 1QF9A 1SHZA 4Q1DA 4MUBA 3SU8A 1GITA 1WP9A 1P5ZB 3RS3A 1SGWA 3FMFA 2IXGA 1XCPA 3L43A 2J41A 5AR1A 2ONJA 2OFOA 3GEIA 1PUIA 2VHJA 4O0MA 4L9SA 1LS6A 3GFPA 1YZLA 2DBYA 1CR1A 2EFGA 2ERXA 3HU3A 4YONB 4QL3A 3TE6A 3U2QA 5H68A 4EUNA 2WKQA 3ZZUA 3L0OA 2DR3A 3KDSE 3OEHA 4RD1A 5A4JA 1RPZA 1N6PA 2LCFA 4EQ6B 3PFIA 1J2JA 3K0FB 2A30A 3W90A 2ZSAA 4Z1MD 4UNRA 1YZQA 4C0SA 5FPHA 4NU0A 3WXMA 4DLUA 4EPYA 1OKKA 1T8TA 5ANRB 4BRWA 1SZPA 2RAPA 1J7KA 3EIEA 1R0WA 1RZ3A 2O5VA 4TLAA 1WBBA 4Q9HA 3PUVA 3FOZA 1TF7A 3PENA 2JDIA 4V0MA 5AJWA 2Q6TA 3C16C 4K8OA 1XPOA 4A0FA 1J8MF 4URXR 5K8LA 3UXMA 3QVUA 2ZRKA 1J90A 4PANA 1IXZA 4QM7A 3FWYA 1MO3A 3S1AA 3QF4B 4F93B 4CIDA 2AKAB 1X8KA 5KNBA 1E2DA 2I1VB 3AEZA 1G18A 3ZLJA 1ZRHA 2JA1A 2R6AA 3CH5A 5C2JB 3U7GA 3EA0A 1EGAA 3X2SA 1Q1BA 3IIJA 4ZCLA 3SHWA 2IC5A 3RRNA 2OILA 1NIJA 3MFYA 1W2GA 2CCKA 4NONA 3RVBA 3TSOA 1VG8A 2ODNA 2A7QA
chains in the Genus database with same CATH superfamily
1U5BA 2DLDA 3PV0A 5FOVA 4LTMA 4PG5A 4QFBA 4GBED 2HGZA 5CYPA 5AXDA 2P2GA 3L0ZA 3R5XA 1EH5A 1P4HA 3BZUA 4AUNA 4GWGA 3EDCA 3WGKA 4G89A 2Z5LA 4ZMRA 3KKOA 4PBTA 5AESA 2M98A 2W6NA 1QB8A 3GF4A 1PGNA 1KF0A 1AVTA 1KDRA 2XUJA 3RNLA 4QLOA 4IHJA 1U6IA 1KP3A 3R6LA 1Q92A 5H83A 4JLUA 2R00C 4G01B 5CLJA 4ZHQB 4DILA 1J0CA 4HAIA 1H23A 3BAZA 5CK5A 3I0NA 4YRCA 4Z49A 1RSZA 2QI9C 3VKWA 5IWCA 5D00A 2ZI6A 2XF8A 4D98A 1Y1SA 5G4LA 2HMWA 1UEJA 1BOFA 3PQDA 2WVJA 1ISHA 2QU7A 2GLTA 2XNJA 3HXTA 4ZEXA 5CFZA 2AG8A 4YJHA 4FGWA 2ZSHA 5K6TA 3UHJA 3A37A 1GG9A 1X8JA 4P93A 3TTUA 1SU7A 3LTNC 1GUDA 2FKAA 2IY8A 2V7QA 4UPVA 1EXNA 1YBVA 2AE1A 3WHIA 4D9EA 2QZZA 1KTIA 3M33A 2JAUA 1NL3A 4MPDA 1VXOA 4U2FA 4B45A 4KR6A 1PCXA 2O6HA 2QAGC 2H0RA 1DO0A 3EDMA 4NVRA 1NIPA 3PEVA 4JX8A 1G9XA 2L2QA 2ZGVA 1PEYA 2WHXA 3EZLA 4GX2A 3VR5A 1FSFA 2VDLB 2Z1MA 1YQTA 3G5TA 5ERYA 4AWBA 4PRLA 2IH5A 2R7AA 4RQTA 4JT2A 3DVSX 4Z4FA 2Q5LA 2SICE 1BXRA 1KO5A 1AHIA 2H92A 2HV8A 3DTYA 3GGSA 5FB3A 4LFCB 1Y4ZA 4R1NA 3K6JA 1BE1A 2DULA 2HA2A 1Q0RA 1W76A 2ZBQA 3NAGA 2B5OA 5LQMA 3DM9B 2E5LB 3L84A 3HKCA 4PLFA 4PPQA 3OLZA 3T52A 3V2IA 1ZAYA 4EPRA 1KQ3A 4Z6KA 2DE0X 5HNKA 2YJNA 4EHAA 4CV1A 3ND9A 2YYAA 3HDVA 2KBFA 4MUEA 1EVQA 4IQ8A 1PEDA 1OU0A 2Z4TA 4IJVA 3GLIE 2G5TA 2HF2A 4H3VA 1OA1A 2WWIA 1R9JA 1KTVA 2A14A 3ETEA 4JC5A 4UATA 5EE0A 5FUXA 1Y3HA 3GRCA 2V3VA 3DAHA 3LZCA 5AJHA 2YWXA 5HP4A 1D1TA 1KPGA 1SIOA 3E84A 4OHZA 1G2QA 2GM9A 2AXNA 3D7RA 1VJTA 4DIKA 2QZJA 4K9MA 2P3LA 1LLUA 4MI1A 5DHFA 1DX6A 2Q7DA 1YKSA 4EA7A 4OYLA 2WAOA 1SXJB 5GZ6A 1WVIA 2BCEA 4HWSA 3WZMA 4ZAWA 1SZDA 3A6EA 1Z63A 3KBBA 4N9QA 2OPBA 1Y7IA 2H9YA 1E9VA 4O25A 1KJYA 1MKYA 2IYQA 1NR5A 2OFWA 3BMCA 3OZUA 3SKYA 4C9BA 4H60A 2BZ0A 3W9BA 4YAGA 4ILEA 1LC3A 3MMZA 5BQFA 2YWDA 4V1CB 4MA5A 1NQVA 4JA0A 5ITSA 1N9ZA 1VE6A 1A2BA 1Z4IA 2FSPA 5CXUA 3K2BA 3FDIA 4MDYA 2XTJA 5JAPA 2AN4A 1U5CA 2GAJA 3D8TA 5DLYA 1Q0QA 4PC6A 3CUYA 2R79A 5TVKA 4R7GA 1CB7A 2HPHA 2EJUA 2NLOA 2D54A 2JJ1A 2R751 1MMFB 4M7RA 3GJXC 3MMPA 4J75A 4FJ0A 2Y9MB 3RTDA 1QRDA 1NFFA 2XIJA 1KOLA 5C8ZA 1NLUA 2PPVA 4LHSA 2DSNA 3F98A 1WHTB 3GUCA 4U02A 5MN6A 3AY3A 2HUPA 2Z83A 3B20A 3GDFA 2IUSA 3R0JA 2C2WA 2WG0A 5EXEA 2H85A 3AFHA 4X61A 4Y2JA 1LPBB 4G4IA 3MT7A 2YXPX 5AH0A 1LDMA 1SVWA 3OFVA 5F51A 3R0IA 1WOYA 4OP1A 1NUAA 5B53A 5LOVF 4FDAA 3EEFA 1DG9A 2EWVA 3I6IA 1M2VA 1Z34A 2BVNA 3D3NA 1V7PC 3L41A 4JYCA 5H7XA 1ZL2A 1N2CA 3CY6A 2QQ0A 5TT1A 4BNFA 1YAHA 2E49A 4M1YA 2FWPA 2HF7A 2CDBA 2AXQA 1XEAA 3U61B 3Q8MA 3IOEA 3ITEA 2OQ2A 3VKHA 1N6IA 2J5XA 4D9HA 1JDZA 2AGVA 2YCLA 3JSXA 5HJ7A 1TA9A 1VRWA 2CV0A 3FOCA 3MCVA 2GFHA 2I4IA 1BS1A 4WKNA 3W2IA 2CXXA 1JNXX 1GCUA 2Q46A 3SZRA 3ORRA 1C29B 2I6XA 2VCEA 2HA0A 3NVKI 4HATA 3E58A 4I2NA 4AZTA 3UFBA 4BNLA 1WA5A 1EUDA 1XP8A 1HX7A 1N7GA 1JHOA 3SD7A 3ZC3A 4B83A 1C4WA 2EZ8A 2ID8A 4QARA 5EL0A 1EWYA 1L7MA 2JEYA 2VP9A 3GRKA 3HA2A 3SVTA 3EW7A 4IDHA 4Y2UA 4JBWA 4YP6A 4L4ZA 1IL0A 2VDOB 3U62A 1KK3A 2QLLA 3WK8A 2W6QA 4UOQA 4X41A 1Q7CA 1NT2A 3DO6A 1JDBC 4ZMBA 5JI3E 4X84A 3ZCPA 2O8CA 2CBXA 4DBZA 4HDMB 2J9FB 4J91A 3DEAA 1NAHA 1W34A 3BSYA 1R18A 5ELMA 5ADWA 1YF3A 3P96A 1GV1A 3IVRA 3WP0A 3B8HA 3OTWA 4IIJF 4RJIA 2EHDA 4M1TA 4TS4A 2XD9A 1H5NA 4KXUA 5IW8A 3QYJA 2IE0A 5BV0A 4E2WA 3NC4A 4PSDA 2CWDA 3EUAA 3WQBA 4B7XA 1UPBA 1TYAE 1EP2B 1VE9A 1WUIS 2P6OA 4BO0A 2B0CA 1KFKB 4BV8A 1Y5LA 2H16A 2JD2A 4NDNE 4RUKA 2RH9B 4QDTA 3ZKAA 1OGJA 4BUJA 4YUZA 1IMJA 3B51X 2GWHA 5AJUA 5CXQA 4YJ2B 3AHFA 4CLDA 4ZOLB 4F97A 5EIFA 4NV3A 4F6CA 1WCIA 1UP6A 5E9JA 2HT1A 3RS2A 3PPWA 3E9YA 2JI6A 3O95A 4R1UA 4OQQA 3RYIB 1YQQA 2JFQA 2P4SA 4P58A 3RVMA 4QEDA 3FBGA 3WICA 3FRHA 1TOAA 3OBBA 4EG8A 3EDOA 2YKGA 5KYTA 4DGQA 4PIVA 1SXHA 4KVFA 1N78A 3HDJA 2AIRA 4AUMA 2J3EA 2WFAA 2OZEA 2PVSA 3L0SA 3S99A 4PN7A 4RSGA 5H81A 2WD7B 4LYAA 4Y6OA 2Z1NA 3FIUA 4R2JA 3V6LA 3S2GA 3BD6A 3QENA 3RVDA 3ZXYA 4CRWB 4EVSA 3HXQA 5A7FA 3PEYA 2OP1A 5L6LB 1IY1A 3RSZA 2GHQA 3WLEA 5JSKA 5LSAA 3H3FA 3TQOA 1P29A 2VTVA 2CVPA 2PCLA 1DIGA 2J6IA 4IGIA 4BGDA 2Y05A 4MLCA 1BRMA 3H2GA 3OLVA 2XA1A 1RC0A 1VLQA 4EJMA 2YC2C 1XTVA 2V0GA 4JLVA 4KJZA 1CRZA 4P92A 5EJ2A 2PNJA 4D8YA 1PK9A 3OMWA 4DGSA 2HLHA 1XVLA 1DKPA 5KYYA 3MLBA 4MGEA 4Q9KA 3DXZA 4PIPA 2WHPA 3ETGA 3QBJA 2ZE7A 4ZI5A 4UUBA 1ORTA 3EIUA 3K35A 4Q9AA 1JKXA 3GUYA 4IFIA 5G41A 2IH2A 3VHQA 1ZCFA 2O1EA 4NS4A 4AJ4A 1YVRA 3H5NA 5CFQA 3ZEIA 1I2DA 3H2YA 4OFWA 2XZLA 1UKEA 1UJNA 2AF3C 3VR4H 1HNXB 2KPOA 1G8YA 3HU1A 1J56A 5CGZA 1DQRA 1YRQA 3GLVA 3ZN2A 2XHZA 4PYLA 3VPAA 4QPPA 1P0MA 1U0HC 1YZNA 4KPFC 3JWHA 2R68A 4HUTA 2C5SA 1MQ9A 1OAOA 1RP7A 2IYSA 5DYNA 5EWMA 3TBHA 4NF2A 2Z2YA 4YRSA 4XQCA 4HLQB 1A96A 4WFIA 4FOSA 2CUTA 1T3GA 4BLUA 4DM7A 1JIUA 1KP9A 1JEDA 1WABA 2PMWB 2I4RA 3LCRA 1BVYF 5GJCA 4AM8A 3CRRA 1DAIA 3BMOA 3CW8X 3BX1A 3MMXA 4MV6A 4GBMA 4AXBA 2GAIA 3P1JA 4EG5A 4Z51A 3HMQA 3L7NA 3KXIA 4AKSA 1HT1E 5H3LA 5C3MA 2ZE6A 5EP1A 3FBWA 3TL2A 1FY2A 3K71B 4PYNA 4Q3AA 2G40A 1SNYA 5GM2A 3IA7A 1P6UA 2JF0A 3OCYA 4PRYA 1WDKA 5J63A 5J47A 2G9ZA 4L95C 3CXRA 3GPBA 4JJ6A 1ZA2A 4QATA 3WIOA 4NESA 1AT1A 3ANSA 3MBOA 3OPMA 4J7CA 4ITVA 3UATA 2WHEA 2Z08A 2ZR7A 2K7ZA 3HLYA 1U2DA 3UJNA 1ODIA 2TSYB 3Q2KA 3RKSA 1WLSA 2NW6A 1P72A 1CEYA 3DOCA 1BMQA 4DLBA 4RVFA 5IT9A 2AWOA 4YV2A 1W8DA 2Q41A 1KOFA 3OE7D 5H80A 3QTLA 3L1KA 4W7IA 3OJWA 4WBNF 3D3EA 1PD0A 1DB3A 3NFRA 1X0XA 2QM7A 3ICEA 1HDCA 2COUA 3BEDA 5CFOA 2Z09A 5BRNA 3HU2A 3T7KA 4ZAVA 2QD1A 2VWHA 4P3PA 4YX9A 5BW8A 5FULA 5BYAA 4NYMQ 3QELB 1SEPA 4PX3A 4E11A 3FWKA 3C24A 5ALZA 5EYPA 2NSHA 1QS0A 4AL4A 3EDRA 2DHRA 3VHXA 2O06A 3UT5B 2KS6A 1V7CA 4BBZA 4CT4B 1ACLA 2JJMA 2NPOA 3TOZA 2VZ9A 3NO4A 1PYGA 2ZYUX 1OJ7A 4UHDA 1JDTA 2ODWA 4R69A 5B3LA 1TU0A 2H1HA 2HU8A 2ZYIA 2ZS8A 4BDSA 3IESA 4IX9A 1BMDA 1MAVA 2EU8A 4HGQA 4U7WA 1JEYA 3I73A 3I58A 3GXBA 5DN6D 1WVMA 3AX6A 2AC7A 3LTEA 3LLVA 4OQMA 4P53A 2GCIA 4B6QA 1ECJA 4OYRA 5IBPA 2ODAA 1ZD3A 2OLKA 2R1TA 5EPOA 4FFDA 1C8LA 2PQ0A 4ZCSA 5KHLB 1ENYA 2YMPA 5FBKA 1NPTO 3BC1A 3TNLA 4WEQA 2ZOSA 2ZJ1A 3ZGYA 5G1NA 2ZBGA 1H2XA 4LFAB 4GMXA 4KIJA 4D9BA 4CM9A 1IHPA 4KXNA 3RFXA 1IOZA 4ND1A 3WWDA 1XAJA 1B8OA 2R0QC 5CA0A 4LDRA 1TEZA 5F2OA 1RXWA 3IULA 1E9AA 1KRWA 2QXUA 1RBMA 3FHCB 3H8VA 3P8ZA 4LPKA 3FHJA 1Y8QA 4WOPA 1CFJA 3GLGB 3I9FA 1OH8A 5LD2B 3HVUA 5AHWA 5U4XA 2E89A 2ZBEA 1GQQA 2MTBA 1XAHA 1G60A 1A77A 1OYWA 1PJQA 3JZAA 4IVQA 4P4GA 4YDRA 4IXTA 3VC2A 5HOEA 4KC0A 3ZU6A 3A7DA 2WU1A 2P2CA 4OHPA 4G1UC 1ST3A 5FBRB 1X70A 5DIZA 1DO8A 1OZHA 2PLFA 3KZNA 1OBOA 3WV5A 1MRSA 2OMKA 3HKEB 1DPFA 5AHXA 3RM3A 3NAZA 3ICWA 4KXXA 4Y2TA 4S04A 2I1QA 3ZKWB 1XKTA 2FMUA 5BWLA 4HNUA 1FVHA 2WZCA 1Q5PA 1UP7A 3HVHA 3ISJA 4A2PA 1CVRA 5DI3B 1D2AA 3COVA 3KDPA 5I7VA 1QU2A 3OT1B 3IXMA 4DMRA 4GF5A 1QGED 4H6PA 2HOQA 3WS7A 1PKXA 1ZM4A 5HKOA 2O3TA 2PBZA 3O31A 3D6NB 2OHHA 3ZD8A 2L17A 3BK7A 2CHUA 5DEIA 5CFMA 2VPIA 3AVTA 3BMNA 4TYPA 3T54A 1VGRA 5HF5A 2X8JB 5KVVA 4FFWA 1P3JA 2HRDA 2JFZA 4G0YA 3PGJA 3N8GA 3NHRA 3FLMA 1FZTA 3HL0A 2HW8A 1ADYA 3T99A 1LI7A 3HCBA 4YRDA 3DFUA 5AKHA 1ZNWA 5TMDA 2HNBA 4IHAA 4QU9A 3GRPA 3RHZA 4E6PA 5HUHA 1E2GA 1CTQA 1Z56C 3FMOB 4D4KA 1LRJA 4DDUA 3UGJA 2PTGA 4ZT6A 1K8XB 2ZLBA 1Y3CE 4O2BF 1IOWA 5D3MA 4QC2A 3ZVMA 2BCJQ 3W9SA 1VJRA 3A2NA 2F2TA 2HAEA 1D4FA 1UDXA 2AW3A 2XTNA 1A8QA 1Y33E 2GN4A 1LEHA 1TFRA 2WIKA 1KE2A 1II8B 2RC5A 3PRYA 2UVPB 2Q3DA 1Y1PA 4J1QA 5D3ZA 3ONWA 1NKTA 1A7AA 3BH0A 4IQ0A 3U17A 1OGIA 4OXXA 1V16A 1SUDA 2G4CA 3A3OA 3HEAA 1N9GA 1G55A 1QE0A 1U2PA 2C5AA 4OQ4A 2JATA 4QFCA 4OI1A 2P2NA 4FONA 3S2EA 3VYRB 2CUNA 4UNQA 4A92A 2JFNA 3HABA 3V4VB 4XVQA 4CI9A 1Z5VA 5WRFA 2BFFB 1ZQ1A 1C9EA 2FRXA 4U5XA 2OKCA 3J7AC 1F4LA 2V9PA 5TR9A 5AVWA 4GPIB 1CUGA 2TMDA 1CUSA 5HQ3B 4EYSA 1MUUA 1S4QA 2GF9A 1HYQA 2PQ2A 1W0CA 3IAEA 4ID3A 2MT9A 3UXEA 3ZE7A 1LB1B 2NUPB 1X6VA 4JITA 4LY6A 5HDBB 2QTCA 4EATA 4PVCA 3IOCA 2NQ8A 2VHVA 3N2ZB 2WTNA 4QQFA 3OEWA 2UV8A 4NKRA 3AINA 4BNKA 4KE7A 4DNFA 4NYIQ 1ND6A 1BE6A 3ZCUA 1MABA 1ZMOA 1I9GA 2A88A 2JFPA 5EXDA 4XVUA 1SKMA 2VG8A 5C7OO 3OQHA 4IMPA 2GZ2A 3MLAA 3CN9A 4YN3A 4ZJZA 4KLRA 5DFAA 4G4JA 3DFIA 1S3FA 2JJQA 1S8NA 4EYQA 3GMIA 1GZ7A 1RYFA 4JJAA 5FNVA 4BRSA 2XJ4A 4R5HA 4DC0A 1E3QA 3KD2A 4PLYA 4TKUB 1B23P 2V3WA 3H42B 4F85A 3C8UA 3NFYA 1TK3A 5IYZA 3HJHA 2WG1A 1YL7A 2MSWA 4L1KA 1GNQA 1ACJA 4JDPA 3DPUA 4R6WA 1Q1NA 1P91A 2ASVA 3AEKB 3PDIA 3HN2A 5IDXA 4OXRA 1IHOA 1YB4A 2PL1A 3FF1A 1L6RA 1ITZA 3G2MA 5IDWA 2JH3A 1YRWA 4NSNA 1AF7A 1Z2EA 4ZO7A 4G0NA 2AW5A 2VI5A 1OKKD 2A0XA 1O5OA 4M9UA 4TKVA 4B4KA 4LBZA 2BM1A 2R6DA 4V02A 4RHTA 3TG8A 2OLEA 1JA1A 3QX8A 4ZYZA 1THZA 5E8RA 1KZ6A 3CLUD 2WSSA 1USIA 3GAMA 4V3BA 4QVGA 1BX1A 4U39A 5L4SA 3A26A 2F9FA 4J0QA 5B58T 3UW1A 5JY1A 2FSSA 1XPUA 3ADCA 2Z0MA 4G5FA 1GNPA 3L4JA 2RHLA 3IT2A 1QO0D 2C3PA 1VIVA 1JG6A 3TLYA 3FPSA 4CLOB 2UUPA 3Q98A 4Y0VA 3ZTWA 5T6BA 4L4YA 2FE4A 4ZCPA 4D5EA 5BR1A 5BXQC 4Q4AA 3EBLA 3ZDRA 1YQDA 3P2EA 4PC2A 1N2CE 3QXSA 1NXWA 2YHAA 3BJZA 3VU1A 2O7RA 3BSWA 3E9DA 4XPIB 3P0FA 2D7JA 5BW5A 1QUEA 3BD9A 5FBLB 2RHWA 1DQZA 4MLZA 4C6TB 3GGJA 5HXAA 5A2QA 4WOKA 1EESA 4KQCA 3EGXB 5ALNA 5ICCA 3HEBA 2ZP1A 4BKQA 3NPMA 4XGNA 1RZUA 1W36C 5F76A 1P4JA 3KLMX 4LWPA 2R7MA 1YA8A 5IVPA 2ETVA 1E2QA 1QIJA 3IFSA 1D4ZA 1Q74A 2RGNA 3EPRA 3N1UA 2VUIB 1GN9A 4KMMA 3RBVA 1SCAA 1YCHA 4D99A 3KSBC 3B6MA 1Q19A 4HB0A 2H2GA 2IDZA 4P82A 5CH5A 3DOUA 1SO8A 3CMCO 2DLNA 4FYMA 1JEEA 3U9SA 4I0WB 5E6SB 1VJ5A 4A8TA 3UHOA 2OECA 2WDZA 1E1DA 1IFXA 3NEYA 4PHHA 1F1BA 4CLXA 2B20A 3ZOZA 3WL3A 2IDJA 5KTNA 1KJZA 4KI0A 1PJSA 1L4NA 4JIGA 4TYYA 4OHRA 2ZTMA 3M6WA 4QUGA 4E32A 4IWNA 1IRXA 4OYYA 3L8CA 3UGTA 1URPA 4L5JA 3PT5A 1SIWA 1PGPA 3EXIA 1GOTA 3KZ1E 3NWBA 4IQGA 5LZ7A 2VPZA 4H1WA 3Q8LA 5K0LA 1I4WA 1XX6A 4WQMA 5DO9A 4L0MA 4UDOA 5FQNA 3P5SA 1BKYA 4HS4A 3UM9A 3ZWNA 1K1EA 3TB4A 1U7UA 3WIBA 1LSOA 1R4NB 3AZQA 5AVSA 2XCOA 4UNIA 1ESNA 4NJMA 2EC5A 2CXTA 1EVKA 1Z4LA 3K9FC 3VQTA 2WG2A 5I8WA 4Y9RA 5LP6C 4RW0A 3T1OA 4M99A 3KJNA 2Z9BA 1LQTA 1NU6A 3GUZA 4N0MA 4UAJA 4D02A 2P0EA 3N70A 1O94C 1TZ2A 3NHAA 1G1MA 1E8MA 2CLIB 2VATA 4RK4A 4ZK6A 1PG5A 4KGDA 1H66A 1ZSNA 1IIBA 4JR2A 5FKJA 1MHPA 5GWXA 3HO1A 1PZEA 2R1TB 4REQB 4ZO6A 1FF9A 1G21E 4IW3B 5KNCA 1DL5A 1EE9A 3L7DA 2ECPA 4JGIA 1EXWA 4KSCA 3SF8A 2QI9F 1MNQA 4BV9A 1XTTA 2N42A 4LX0A 1CZNA 3QVGA 1X1EA 3Q3HA 2GBCA 1GA6A 2EQAA 2TRSB 3PDHA 5JIBA 2AFIE 4K3VA 3VR2A 2ZIFA 5SYMA 4UTZA 4E2YA 1YR9A 5AK4A 2IY9A 2OESA 1EFPA 1XJ0A 2YJZA 3CCFA 1V8ZA 4ANFA 1ODKA 2Y27A 1V16B 2WR8A 3CWZA 3G7UA 4NAHA 5T4BA 3IQWA 3SSNA 5BUCA 1ISGA 4MJXA 4NMHA 4RZ3A 4WFKA 4BB9A 3IELA 3V1MA 4QXPA 1R9NA 6NULA 1GQOA 2JCGA 1TM5E 4LDZA 3TQIA 4BWYA 3IT0A 3FW1A 2OORC 2O59A 2I03A 3JAKA 2OQRA 4NQZA 3Q9SA 4J90A 4ZJPA 4IMRA 1NF3A 4C2AA 2ZS7A 2X7HA 1P2DA 1XZDA 2W2XA 5CLIA 5F7JA 2I3AA 5C8YA 1CY7A 3VPFA 3EMVA 1FFDA 3NHBA 4QUEA 1YXMA 4HBZA 4LHEA 1JVSA 2P1DA 2GPBA 2ZXFA 4OAPA 5CAEB 3FYTA 4Y2SA 1WZUA 5FA8A 4JT8A 3NWOA 2Q49A 2W7TA 2IXEA 1RQXA 2P8SA 1EINA 4YY3B 1F6WA 5CAEA 4DSZA 3DNPA 2OCPA 2VJBA 4QOIA 4WLEA 4YRFA 5JPDA 2FJPA 3UOAB 1DARA 5LFAA 4PXAA 4EGAA 4J0GA 2VHEA 3CZAA 4WFQA 2OR3A 3JQAA 4EQ6A 4MVJP 5A3QA 4K6MA 4ZVVA 4L3VA 3RH0A 1MJFA 4ZT2A 2XT9A 3M70A 1KH3A 3H87A 1GKYA 4QOFA 1OWPA 1U7ZA 2X2FA 3EGDB 3GJ6A 4HGPA 2PGLA 4G8JA 4XA8A 2C2HA 4A5SA 1QHHA 1R7RA 1JFFB 2QZ4A 2ZS9A 4NDZA 4PE5B 1G5HA 2V6JA 2OXRA 4KQXA 4EYGA 4EI8A 3F4LA 4UU1A 5H4GA 1MQSA 2X2PA 2IP4A 1Y4SA 2XMBA 2AFIB 1UAGA 2Z5GA 3B1WA 1Q2XA 2P7IA 4M8SA 5TF4A 3IEPA 2WV7A 2XECA 3FCSB 5KVAA 3SPXA 2GESA 2FW9A 1RYDA 2PXXA 1OH7A 4WKOA 3TLZA 2PL5A 3DTVD 4RKFA 5JH7F 2POCA 3BIFA 3H99A 2XWPA 4ZRDA 4AWXA 4D3FA 5IZCC 1JBQA 2OBNA 4IIBA 1EK6A 5FTJA 1RLIA 4MJ3A 3DYBA 2O4UX 3BZBA 3FM9A 4L8YA 3GG9A 3O7WA 4X9XA 3NHPA 3R0XA 1GCOA 4F3TA 3PI7A 3NASA 5DF1A 3KSDO 4PU0A 4BEWA 4KITB 3FKSD 3PNQA 1OF1A 1QLHA 3NR2A 4W9RA 3UYLA 3T1VA 3N0XA 3TLEA 1D2NA 1L7BA 2W83A 1KYIA 5AKKA 3W6NA 1NATA 2HMSA 5BQXA 4QAQA 2WPDD 5KWJA 3ESXA 4C2TA 3F49S 1P5FA 2QTVA 1RWNA 5FD8A 1J7JA 2PK3A 4LDJA 1Z33A 2JAPA 2R4QA 3W3ZB 2ODPA 4O0LA 1DCMA 1JLSA 1M8KA 3CLVA 5CXSA 4JMPA 4MCHA 4OV6B 3TMYA 1EUZA 3RROA 4F9FA 4DDWA 1GDTA 3WWCA 1MABB 5BNIA 3HDHA 1J2YA 1DIOB 2R85A 1Q0LA 3C8DA 3UTDA 3G0HA 3SEQA 1Z45A 3BIXA 1P1IA 1SURA 4M4SA 4TMWA 2VNAA 2P30A 1FDRA 3JYOA 4UAVA 3IKLA 4IYJA 1B14A 5JHHB 4PCAA 2B8JA 4HNGA 2DERA 1IWPB 5IRCD 4URFA 3OTIA 3STXA 4E51A 1WTAA 4EPWA 1BKSB 4XVRA 3OTOB 2CXPA 2YV5A 4JOSA 3H2JA 5KYKA 1QS0B 5TEVA 4BO2A 4M9CA 4Z8XA 2P6NA 2UYYA 3IQZA 1NQXA 1ZG3A 1B0ZA 1QLWA 4OUDB 2D7CA 1VOTA 1QHYA 3BD7A 4GKKB 1DJMA 5HW0A 4ACAA 2FFBA 4YCJA 4ENRA 4J7AA 3KALA 4MKGA 3NBUA 3K8QA 2JLRA 5KNDD 2JD0A 4IJQA 4DQ0A 3JX9A 1HDGO 1MGOA 1K6JA 1X7ZA 3JVIA 4CMAA 3KOOA 3QJYA 1V37A 5KDDA 4M9QA 3E8MA 3CX6A 4DR7B 1RS0A 4RSHA 2XPCA 2BMDA 3D3KA 1INLA 1WKCA 1T5HX 3AFMA 3BD8A 5CTJA 3TYXA 3WNVA 3WRWA 3S29A 2WTBA 4FINA 1RYBA 2AT1A 2OVFA 4BMSA 3UPUA 3DUWA 1P2TA 4KPUA 2OV4A 3IPYA 1H8ED 1MG0A 3WAJA 2ZT7A 3B5EA 4KUGA 4ETWA 1N5KA 3DW1X 3EVNA 4RY9A 5G40A 5K0NA 2QY9A 3K92A 5KJ1A 1X8LA 2E4YA 2WUEA 1JW9B 1G1AA 1B7GO 3DWIA 2AHRA 3IAUA 3PCTA 1W30A 4HB3A 2BFPA 3O8BA 3U3RA 2PLNA 2FDCA 4B3SB 4RJTA 1NW4A 1S8AA 4W8OA 1HGXA 3DMNA 4JI8B 2IWHA 3URMA 2BE7A 3RIEA 3G7SA 2ETXA 4WADA 3RS9A 4EA9A 1W5SA 3DR5A 2G6BA 5FHQA 1ECCA 2BT4A 2D4AA 3IP6A 2WZQA 1RIIA 1TKRA 5LUAA 3L7YA 1ZJZA 2O0KA 2OAGA 3E7XA 3WRYC 1COZA 2TMKA 3V4RA 4FVTA 2QN9A 1W85A 5LU9A 2EEZA 2HH9A 3RSSA 3PJEA 2G9RA 1TVCA 2BEWB 2DPYA 3AKCA 3KEGA 3L06A 3MS2A 4R8LA 1XOIA 3THSA 3ZBTA 4FOLA 3BYZA 4I5IA 3ZCRA 5B1EA 2RGRA 2NVOA 4UHKA 4FIDA 3RAGA 2YOHA 1W88A 3CEMA 4AVYA 3ACDA 3WLMA 1V45E 5FL7D 2PBLA 3E1SA 3JQGB 1C14A 1OTYA 4OQPA 1WOMA 3ZHSA 5EXXA 2VBGA 1ZKDA 2G9NA 4ZPJA 1FPQA 2O2DA 3Q3JB 1KORA 5JWHA 3V80A 1L5MA 2RKWA 1N2ZA 1YFJA 1Z7WA 5TMBA 1AX9A 4BP9A 2WNIA 4OQYA 2XSZD 2CL0X 3RFFA 1JQAA 1LTQA 2PS3A 2WKRA 4YA6A 2EFHB 4R2HA 4GBGA 1BAPA 3BUSA 2P9HA 2XOKA 3JWEA 1YL6A 1OX4A 3WGIA 5TJHA 3HGQA 3LXMA 1Z0FA 4IGEA 2BDEA 2J7PD 1F38A 3ZLBA 4K9PA 1N0VC 4R1OA 2X76A 3QH4A 3NBAA 3DMFA 4CV2A 3GEEA 4TS3A 5JDIA 3TF5A 3G23A 4AU1A 2DT5A 2WYWA 1ZZGA 2DCUA 5A7GA 2Q28A 2AMVA 2GEVA 4OB7A 5K7SA 2C5FA 4YH1A 1QANA 4F2GA 2CEAA 2J5KA 1V6CA 1FP2A 2NO6A 4R3UC 1K9VF 5EKSA 5H9VA 3T3PB 3FTNA 4YT5A 1EVZA 3UWSA 4L5AA 3G59A 3FDJA 2TS1A 4PV7A 1F48A 2H0AA 2J32A 4D8VA 4MKRA 1U04A 1AM4D 3LUBA 3FUWA 1GSAA 3IUQA 4IDOA 1ZXLA 3A6LA 1RQPA 3CE9A 4QEZA 1G3UA 1OQAA 2X9NA 3UJ6A 4A73A 2O8FB 2IZ5A 1G8SA 1NN1A 1QYDA 1N3LA 4O4IB 5B3KA 1WXHA 1W5TA 2PT9A 2XMCA 3P9KA 4K87A 5G4KA 3T1TA 2Z3WA 4HRYA 2AF4C 2C78A 2R87A 4L4SA 4CR7A 1XEFA 4FGZA 4IO1A 2L19A 5CNIA 2P2SA 3PU6A 5JH7B 1QVWA 1RWXA 4OI4A 5GY7A 1IHXA 1WMBA 1WS6A 1QR2A 3Q12A 2XUOA 4MV0A 1TDJA 5AHRA 1N92A 1ZRSA 2FSUA 4GLFA 5TS2A 3ZY4A 3MTIA 3G2QA 2O3RA 3B5JA 1YT5A 5A3RA 2C97A 3R23A 1JHVA 1Z6XA 3P5BA 3ABSB 1P44A 2ECQA 5TV2A 2CC2A 1VCNA 3VSCA 4WKPA 3RU7A 4CI0B 4RK5A 4D0NA 5BUSA 4AF8A 5B7NA 3PD7A 5KOJB 3QMMA 5F1YA 5IJZA 4MW4A 1V43A 1HORA 1T2VA 1RWPA 3HB9A 2QMUA 3DBVO 1R5JA 3O1LA 2NV6A 3HPQA 3DDOA 1UBGA 5JLJA 1E0KA 4KQ9A 1AE1A 1E92A 2FUEA 4D97A 1C1HA 1YZ3A 1AG9A 5F21A 1MG5A 3TOCA 3U26A 1OFHA 4C4TA 5ETJA 4ZVLA 4EZIA 3FAZA 4D3YA 3C6MA 2AI3A 1UMCA 2W11A 4I4TA 1FCJA 4O4JF 3UT6A 1US8A 4NBTA 3L0DA 1DSSG 3IKVA 3QJ5A 1I6MA 4HDKB 4R2IA 1E1NA 1JSXA 2RB4A 1ZZEA 5DE3A 1AGPA 1U8FO 2GCPA 1MB4A 3NDIA 4JB3A 4PZDA 3PIIA 5L45A 1KO1A 1I7NA 1H5UA 2VDWB 4XVHA 1DS6A 4JJFA 3DC2A 3EFOA 1MEJA 4NFLA 3CO5A 4MB2A 4LSGA 2IF2A 3BOSA 3ZWDA 4B2PA 4NC9A 4YI3A 1Y34E 3AUJB 2DFLA 4ETNA 3ENVA 3K4QA 4QXAA 1EG2A 2IBTA 1GVHA 1M2OA 4R3NA 1SU8A 4WXEA 2RDMA 2YWEA 3O4RA 4U7JA 1GGFA 3SI7A 2ZU6A 4GC9A 4YAUA 2XMDA 4H7JA 1XO1A 2FEPA 1M0SA 3QLVA 3SQDA 3OWOA 3PXCX 1JE1A 2ORIA 3AFNA 2IEBA 3IQGX 5EPUA 3N87A 3SY8A 2O20A 3SIRA 3GUVA 4WSOA 1PI3A 2G06A 3EZYA 4CLOA 2AVNA 3PJDA 2AG1A 3G82C 1T9DA 3O2JA 4NZ9A 4RDCA 2W2PA 1EFRD 4BLPA 3WAGA 2H07A 2HWWA 1E5TA 3IHKA 2B7LA 3LQYA 1U7OA 1VI2A 2Y1OA 4OBEA 4Q5IA 2G04A 3RCBA 1GXSA 2I87A 2RH4A 3OI7A 4V3CA 4AY6A 1WUKS 4FEGA 3CA8A 4RZHA 4WESA 3IGFA 3EBPA 4IKEA 3LXXA 5LQJA 3AKYA 2G9UA 4EKEA 3K9WA 2JGEA 2W6JD 4EG3A 1G8FA 4CKBB 3W6ZA 5ILQA 3GLRA 3SZLA 3D8BA 4Y1RB 3U3DA 4G36A 4C1NA 4OCZA 1L7DA 2W6OA 1SCNE 2CHVA 3LC7O 1P1JA 2VF5X 1YAJA 1I2BA 1L4KA 4EO7A 4B33A 4MW0A 3K0CA 5IDVA 2FZ5A 4QWWA 5HS6A 5IN5A 2PO5A 2AI2A 1ZR4A 2VDMB 4KLAA 1QQ6A 2AS0A 2JGNA 3P2JA 1G5IA 3VPHA 2QVYX 4QGSA 3TEJA 4URUR 1W4RA 3DSRA 4F5WA 3GLGE 4YP7A 1QAQA 1DV1A 1HWYA 1UM9A 1YRAA 2DKOA 2X5JO 5P21A 3BJMA 3LDHA 1YDHA 4QJ5A 1NFRA 3HSYA 1GKIA 3HP4A 4DUGA 5KINB 5COBA 3QTTA 3BE5A 1GSOA 2JASA 4XPZA 4FUQA 1TZJA 4U4AA 1H2RS 4I1YA 1L1EA 3EAQA 4UHHA 3VUEA 1G63A 1EVLA 3A04A 3FHLA 1PVOA 2BH2A 5D86A 4BMOB 1JJIA 4C5BA 1E32A 4ENSA 3LPAA 1XDUA 3MTBA 2BM0A 3AY6A 2WMNB 3DYIA 2B4QA 1PP4A 7REQA 2IRWA 4FDVA 3VPBA 2ZRLA 2W6ZA 5HILA 3WYDA 1PQUA 5B2FA 1K2WA 2AN1A 1AKRA 3THOA 2AFRA 3OQ6A 4MDEA 3X1WA 3NCTA 3AEQB 3RDPA 1N5LA 3QOYA 2E85A 2OMEA 3ILXA 4GVPA 3B48A 3Q9NA 4WZAB 2X5KO 4EY4A 5DNCA 2Q27A 3KB2A 1XNJA 3G2OA 3WLIA 5ALDA 2LTAA 1G8JA 1XELA 1XZPA 2PFGA 2XQJA 3NH6A 4I81A 4JJIA 4P1ZA 1XZEA 2WNSA 3W8EA 3AU8A 2GZMA 3EGXA 3GVHA 3VZSA 1Z4MA 4QDKA 3L46A 4H6XA 2KM1A 2CLHB 5LBIA 3TFOA 4YMWA 4UASA 1WMAA 3FMIA 1K7YA 3G6KA 4XX1A 2A9OA 1Z4NA 4AZ3B 2W0SA 3R4VA 5EKTA 5CMLA 2M6SA 4M2LA 3UHFA 3TGPA 4MPJA 1CQWA 1XD8A 2HIHA 2Q5OA 3LWZA 3K9NA 4V0RA 4Y9TA 3VVLA 3HWRA 1U94A 5BSKA 3HVIA 4KE9A 1T1RA 1OBCA 1J9GA 2QYSA 5TQ2A 5E0OA 5C80A 1P33A 1EDOA 2OENG 4G1VA 4GQIA 3DL4A 3X43A 3DNMA 1U3GA 4Y2HA 4KLNA 5K0BA 3DONA 2JFWA 4HN2A 4PXSA 1P1CA 1RWBA 3H7AA 3NU1A 1EJ0A 4ZAGA 5J59A 1FFHA 2VF7A 3DFZA 4NBWA 4E6EA 1TQ4A 3DZ8A 3BMQA 2WFLB 1U28A 3COPA 5TQJA 5KNDA 1ZI8A 4N5HX 3B2EA 3NOOA 4PHTA 4TOIA 4HDAA 2YVLA 3MOSA 5FUQA 1BGXT 1ZIPA 3B1XA 4O4HB 1H2YA 3X3HA 1M66A 1N4AA 4I3HA 1J07A 1Y6ZA 3BTVA 5I9IA 4TRRA 3NHFA 4CMEC 5IKEA 1ZFNA 2QQGA 1RADA 3A3KA 3IQHX 3T4UA 4D9MA 1NHWA 4QD3A 2RI6A 5F77A 3BXHA 4PPGA 3C8MA 3PL1A 3MILA 1M8FA 1RJ9B 3LXRA 4RHCA 4XGIA 2Q7XA 2I34A 3OM1A 4RD6A 4TSFA 3WHPA 1ZD1A 4CIBA 2Q45A 5AXBA 5JXGA 2IPMA 3P0HA 2IYTA 1BEEA 3B38A 4KKXB 2NU7B