2A5GA

Cholera toxin a1 subunit bound to arf6(q67l)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 6
publication title Structural basis for the activation of cholera toxin by human ARF6-GTP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/transferase
total genus 53
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a5gA00
4Q19A 2FA9A 5CLQA 2H8KA 1Z06A 3BERA 4G5RA 1NIPA 2E1RA 3NBXX 4PHHA 2ONKA 2NZ8A 1CJUC 1I4TD 1NIJA 2GNOA 3D8BA 2W2VA 5L3QB 2WMNB 5JS8A 1WB9A 2IUUA 2G1KA 1AGRA 1FP6A 3ICEA 3I73A 3REGA 1P62B 4MGZR 421PA 3EZ7A 2CJWB 3ZH9B 1XFAA 2O8CB 2WJYA 2C77A 2QM8A 2RGCA 1XTKA 3BOSA 4DSTA 4NYMQ 4C2UA 3K70C 4ASUD 4HAYA 1G64A 1G3IA 1PUJA 5KNBA 2XOKD 1CJMA 3TE6A 4ESVA 1G1MA 1HY3A 1ZJ6A 1JECA 2F1RA 3KKNA 2H16A 4R2IA 4PQYA 4UXIA 4YMUA 4AYWA 1X8JA 3RRYA 5J4KA 4M1KA 4CT5A 1NSTA 1VG1A 3C5HA 1I4LD 4R9UC 1G21E 1M7BA 2RB4A 2GTPA 2KI5A 2ZTSA 3C5CA 3N5CA 5JSZA 2XB2A 2ZJYA 5AJYA 3H84A 5DE3A 4LV5B 4QGAA 2CHVA 3AQ4A 1VHLA 5DISB 3QF4A 3TGPA 2ERXA 4R2HA 1FL9A 3E2IA 1G8GA 2C04A 2FSIA 4BRUA 1NJFA 1S0UA 3A4LA 2ZJOA 4IEEA 4MA4A 1XD2A 3CPJB 3EIEA 2WJHA 4V0NA 4DB2A 1E99A 521PA 1KMHB 4FCTA 2ZIAA 1R5NA 1P61B 5FUYA 4QXAA 3AF0A 3IDQA 2ODWA 1Z63A 3M0EA 3OEED 2C96A 2GK7A 4URXR 2ECKA 3I62A 1Z6TA 3TSZA 2ZYVX 1QZXA 1Z47A 2WJGA 2HT6A 1HUQA 5JWOA 2CL6X 1TEVA 1Z6XA 3MCAA 1D8TA 2PCLA 4FMDB 4ZI2A 5CIQA 3ZJYA 2H5EA 1ZU4A 5L3SA 2HLDD 1Q44A 5JBQA 1XPUA 4GMDA 3P20A 2BJVA 2OBLA 1E2GA 2B21A 1E98A 1LTQA 1SXJB 3CWQA 3TNFA 2D3WA 2QSZA 1Z0FA 1N5IA 4W9MC 1GG2A 4UXJA 4DUGD 4UNRA 1CBUA 5DN6D 5DYGA 3T34A 1TU4A 1J2JA 1E69A 2ZE8A 4OHZA 4HZUB 2OILA 4K46A 2WJVA 1AKEA 4NH0A 2EWVA 3N2EA 4WVFA 2CL7X 2JLXA 1FX0B 2QBYB 3TSOA 2P3SA 4KVAA 2ZSEA 2QZ4A 3EX7C 2QP3A 2WWHA 4URUR 1GUAA 3WBJA 3KXIA 2NQ2C 1US8A 5JCZA 4NDZA 1RW4A 3U7FB 4IRUB 1QDEA 1QF9A 2JIZD 4M1SA 2IEYA 1Z0KA 5IK2A 4RFSB 1MO4A 1C1YA 2AWOA 2CLSA 3B1VA 4JVNA 1ZM9A 1QVRA 5HCNA 3U61B 2A5FA 3G82C 5CDFA 3W90A 1SVOA 1KY2A 2QMHA 5D3MB 2H1LA 3W3ZB 1UBCA 3Q7PA 1NN5A 5FI0B 1ZMXA 3RNLA 3RS5A 4AG5A 2WPDA 3Q9LA 4LYJA 4TSFA 4JL8A 5H68A 3KXLA 3R8FA 4DLZA 3THXB 4KBGA 1XZQA 3LRPA 2V6JA 2EQBA 1FP7A 2DFKB 1J8MF 5AJXA 3V00A 4WA7A 4ACBA 2DWQA 1VKJA 1JAHA 2GA8A 4D4MA 3AF1A 2HYIC 4OI4A 1G6HA 2V9PA 5KSYA 4Q1CA 1KHTA 5TB5A 3AKDA 3O8RA 3W6PA 1T6NA 1KI4A 4A15A 3JZAA 4N0EA 1KOFA 2CLCX 3L0OA 4M22A 3OHMA 1NL3A 2C78A 2FPMA 3UG6A 4C0AC 2VF8A 3PEWA 2WVJA 1W7AA 1E0SA 3EW9A 4LJAA 3TUZC 1FUUA 1YZQA 3NDBB 3ZVLA 2V55B 5JWRA 3IIMA 2FFAA 4K8OA 1Z08A 1EX7A 1IONA 1W4AA 1N6RA 3DL0A 2QTFA 1OFTA 3CIOA 4MYCA 3H86A 3THWB 4O0MA 1FMLA 4FI3C 3X2SA 1OW3B 1OYYA 2J3EA 1HE8B 4WZBE 4Z1MD 3GFTA 4JLJA 4AYTA 1Z6AA 1E79A 3ZGXA 3D3QA 1M7GA 2NPFA 3HWSA 2ZRCA 3KX2A 1XCGB 3A1UA 5B2ZA 1MO5A 4M8NE 3GQBA 4JT4A 3M4YA 1A5TA 1G3QA 4R7ZA 3K70D 3MWYW 1G7SA 2OAP1 3B82A 4KO8A 2WBLC 4C0SA 4DCNA 5B64A 1E9AA 2BMEA 4WIAA 1NLZA 2ZQ5A 3OIWA 4LSGA 4JMPA 4DDTA 1KGDA 2CL0X 3T1TA 3U60B 621PA 5HPYB 4QGFA 3TQFA 4A36A 1JEDA 2DCUA 1Q22A 5KHOC 1CJKC 4FMCF 1E2PA 2YZ2A 4H1UA 4B6EA 1Q1EA 2BVNA 2OLKA 2QL6A 3NIBA 1E9RA 3CRMA 1XXHE 4YC7A 2WSSA 2Z5FA 2GCOB 5H1YA 4LJ5A 3I3SR 3HDTA 1NVXQ 4LRWA 5TDHA 2WWXA 1ZM7A 1R0XA 2ZE7A 1Y3AA 2B6HA 4MGYR 1GP2A 2IS1A 2ORIA 3PENA 3P4YA 1VYVA 5EXTA 3TIFA 5FPKA 4ZDWA 3ADBA 4F4CA 4U5XA 1SVMA 1PLJA 3BB3A 1VIAA 1UADA 2IYSA 3AKYA 3THOA 5TMPA 1LW7A 4Q9KA 3U4QB 1EESA 2PX3A 3R7WB 2ZSFA 4Q00A 2ZITA 2A5DA 1RE0A 3AH8A 4KLNA 2DFLA 1JAIA 2P0EA 5C4GB 2CE2X 3KQNA 2A9KA 5CJ2A 5J47A 4NYJQ 3PUXA 5IRCD 3HU2A 4B2IA 2ATVA 2O0JA 2XXAB 5H70A 2G3YA 2ATXA 1E1RD 2GJ9A 1G7CA 3PV0A 2GXQA 1P5ZB 4EJSC 2C5LA 4Q7LA 4II7A 1XTQA 2J0SA 1YZNA 4GRAA 3THYA 3FHCB 3T1OA 4DB4A 2MSCB 2QGZA 1E9FA 3GJ5A 2OCYC 1K8RA 1VIYA 4P31A 3TJZA 4ARZA 2G0NA 3X1WA 3LVRE 3A4MA 1GNRA 3SJCA 3GJ7A 1XJ0A 2J0UB 2IXGA 1FPMA 2O5VA 4LZZA 5IHPA 1Z22A 4URZR 4LK2A 1IM2A 3CX7A 4KODA 1XMJA 1CLUA 4DIDA 3LH5A 1GOTA 1XPRA 4ILEA 3CRW1 1T8TA 5J5CA 4EFMA 3U3RA 4NTZA 3FFAA 4DLWA 1P2SA 3VHLB 1KI8A 1IOZA 4S35A 2R2AA 1FTSA 2H92A 5EXXA 3ETLA 3RANA 1T5LA 1ZAKA 1S4QA 4HAZA 4MKHA 1NVUQ 5GJCA 1VCOA 2D4HA 1H8HA 2ODBA 3I8XA 1UKEA 1NG9A 3G5UA 1E2FA 3UKDA 1JR3D 2VPPA 5EZ5A 2VEDA 3ZDQA 4CEJA 2Z43A 1KDOA 1EFTA 5DHAA 1M7HA 4ZCLA 4EPWA 3ZQJA 1Q20A 3A37A 3CNLA 3KQKA 2C95A 2BKEA 3DDCA 3KDSE 1KDTA 4JLAA 2J46A 2AK2A 3V4FA 4B48A 3U7GA 3NH9A 3VU9A 5CJPA 3AVXA 1J8YF 1R4AA 3O47A 4UXHA 1D2MA 4RSGA 2P67A 4Z8XA 1P2UA 1D2EA 2IYTA 2ZRKA 4MQBA 2GZDA 1CS4C 2QRZA 4MRNA 2XTZA 2ZRGA 1RZ3A 1YVDA 2G0TA 1L2TA 2O8BA 1EFRD 1KI9A 4L8GA 2REXB 2BJWA 3IHWA 4TYYA 3BB1A 4CEIB 3T5DA 4D25A 3DKPA 5AK0A 5FUXA 3WYGA 1EWQA 5FPHA 1Q3TA 4RD6A 3AVWA 4OQLA 4IDNA 1E3MA 4Q9IA 1LB1B 1E1QD 1NKSA 1NLYA 2ZI7A 3OF5A 3QG5A 4Q7JB 1OJLA 4DEXA 4OK3A 3ASYA 2PCJA 2UZ3A 3W3AA 3RS0A 3PIRA 1W2GA 1IN8A 2LKDA 3B9PA 4KSCA 4ZDJA 1EFUA 3EWAA 5HKKA 2F1IA 5HZHA 1AN0A 4Q4HB 5FL7D 2GK6A 3ZZUA 3C7KA 4PPFA 4BZXA 4PXAA 1LS1A 2LCFA 1DO2A 3CF6R 3SJZA 1AIPA 3EIQA 2EYUA 2GXSA 3ICQB 5B30A 2XITA 4C0JA 4V0MA 4C4PA 2H17A 3ND9A 3RC8A 3UG7A 3FDIA 1GKYA 1FTNA 5A0FA 2ANCA 5K8UA 2JJ2A 1BYIA 4HDQB 4TLDA 3EPKA 4L15A 2CK3D 2AD1A 3KUDA 5LDDC 3QENA 2GETA 3EPHA 5EJEA 2G83A 5EP1A 3RRZA 4PO9A 4HAUA 4HUQA 3TRFA 2E87A 1SXJE 4M9SA 3FWYA 3I8SA 4CYMA 2V3CC 3GPLA 4UQOA 3T1QA 2GEUA 2AFHE 2KSQA 2QEQA 1TF2A 1W1WA 1ZUIA 1YZUA 3RSOA 4V0KA 1M6NA 2IYRA 3RLFA 2LWIA 1I2DA 2BMDA 1GDDA 1XEFA 1G20E 1N6KA 1R6BX 2AKAB 2UKDA 1GILA 2G9NA 1AGPA 4XVRA 3GLHA 2IF2A 2C98A 4GZMA 4MH0R 3TW8B 2PEYA 4HLQB 3LWNA 3MRSA 5ANRB 1J99A 2ORWA 2PJZA 1BYUA 3QI2A 3C8UA 5JZVA 1NP6A 3I1FA 1U0HC 1T3LA 1VG0B 4GOXA 4B73A 4OHWA 4EIWA 1AZSC 1COWD 1YR6A 1XD8A 1P4SA 3MLEA 4YDSA 3LV8A 4PAOA 3U3MA 3RRNA 1AS3A 2EYQA 1Q1ZA 1KK0A 1HQYE 4TZ0A 2HXYA 3N70A 1SHKA 4TTQA 1G3RA 2PX0A 1II0A 2ZI6A 3B78A 4Q4AA 2I4IA 5LBIA 4AKEA 5DI3A 1HA3A 4IW3B 4IFEA 1LNZA 4P4TA 3IBGA 2ZYUX 3S1AB 2AKYA 2FG5A 1CTQA 4NYIQ 4A0GA 3CPHA 2RGEA 4BEBA 1ESNA 4XVQA 1KI7A 1L7VC 4A0FA 1NBME 4PSKA 1CRQA 4UJ5A 4X8LA 1M8PA 1KO1A 2V4ZA 5FUVA 4X8HA 1OXUA 1EX6A 1RJ9B 3V4RA 2OFWA 4URYR 2I3BA 4IDPA 4US1R 5HE9A 2QI9C 2JLWA 1TX4B 3W6NA 2OT3B 2P6NA 3LLMA 2HYDA 4L16A 4DDVA 3QKTA 1W5TA 1E94E 1LFDB 1S1CA 1JPJA 4FW9A 1KAOA 2DWOA 1XDBA 3X1XA 1A2BA 2W6ID 1BMFD 3BH7A 5H8WA 1O3YA 1N6NA 1M74A 1X6VA 1XU4A 2Z0MA 5KOYA 3WRXC 4LJ7A 1YZLA 1Q1BA 2FE4A 5AWFC 1ZD8A 3IIKA 1L4UA 4TYQA 5E7IA 2IYUA 2WKPA 4D4KA 4JKYA 2N46A 3CRQA 1OV4A 2FGJA 3NC1C 5LB2A 3G0HA 3VX4A 1RRCA 1N5LA 1FQKA 5JJLA 4DWJA 3CPEA 4DLTA 5KSZA 3SFZA 2OM2A 2F9MA 2QPTA 5BQ5A 2QMOA 1PVOA 1S9DA 2P2LA 2VRWA 3SYNA 1OKKA 4QBHA 4IOMA 3SYKA 3VR6A 5SZJA 1NLFA 4LJ4A 2IYZA 1ANKA 3SYLA 5CYOA 5L3QA 1YZTA 3SE0A 2OSBA 3K8YA 4GOJA 1BH2A 4ZDIA 3DMDA 1CJTC 1G9XA 2CNWD 4JLDA 3I92A 3MJRA 3AKCA 3FPAA 4RZUA 4PHTA 2GESA 3LBHA 4BUJA 2VQSA 3AVYA 1DE0A 1DG3A 4LDJA 1XXHB 3I4LA 4JLPA 4AC9A 3IEVA 4TYNA 2F1HA 5B58C 2O8CA 3B2EA 3A1WA 3L0IB 2FFBA 1AQUA 3OE7D 4M1OA 3BJIC 1CEEA 3U3KA 2XB4A 3QOFA 4WZAE 2ZR0A 4EJSB 4AK9A 1XEXB 1KO5A 2DBYA 4OHVA 4EKDA 1U81A 2BBSA 4DXAA 1U9IC 3TLXA 1UDXA 1DVRA 1Z0DA 4G1UC 1JJVA 2ZM5A 4N0DA 5FOUA 1A2KC 3K0AB 2ZXUA 1FNNA 2DFTA 3IPXA 2IL1A 1E9CA 5FOXA 2CCGA 2Q6TA 2JCSA 2X19A 4QKQA 1GITA 1RVDA 1UAAA 2PZFA 1SVSA 2KJQA 1KMHA 1OH8A 1ZP6A 4XTRA 1AA9A 3KFVA 1E9SA 2BOVA 4G5OA 1QHXA 1HQCA 4G3XA 3V9PA 5JFGA 3BE4A 1G18A 1PUIA 4LBZA 5KPJA 3HPQA 1HTWA 4QJ5A 3LLUA 5FTKA 4M1TA 2O0HA 4LYHA 4TQAA 4A9AA 4C30A 4NPHA 5KSOA 4DSOA 3D31A 3GLGE 4HLUC 1SXJA 2ZREA 1JALA 4B3BA 4YMTA 3CM0A 1KYIA 1RRPA 3PUZA 1UEJA 1XWIA 4QNRA 2IUTA 1ZC4A 1OIWA 1J7KA 4LJ6A 1I4DD 3Q7QA 2RGNC 4HZUA 3FB4A 2IA5A 5BWMA 4TMWA 1T5IA 2C03A 3LX5A 4JIMA 1GIAA 1RYFA 1FX0A 1K6MA 1KKLA 3F5FA 2AX4A 2ZI4A 2QBYA 2F6RA 2OUKA 2O52A 1N0VC 4HDCA 1NSFA 2GJKA 3MSXA 5JJIA 1ELOA 1U8AA 3C4JA 2RMKA 2QN6A 2JLQA 1MO3A 4B32A 1Q1QA 1KY3A 121PA 1X8LA 3IGFA 3VMFA 1NJGA 4UJ3A 4B43A 4A82A 1NVWQ 1E9DA 4RFSA 4B6FA 5FTLA 5F3WB 1GRNA 4MRPA 4Q9JA 4E03A 1ETUA 4JJKA 4PC3A 1KZ7B 2EFCB 2R6AA 2ZRMA 5D3MA 3CWZA 1XJQA 4A0RA 1UKVY 1KO4A 4PZLA 2W2XA 1WDTA 3CRRA 2A7QA 2RAPA 3PVSA 4HAXA 4TMZA 4UNNA 3LBIA 2REOA 4I99A 4KSBA 5FBWB 3THXA 2F3TA 3NG1A 3AM1A 1P73A 4OJKA 3DMNA 3TMKA 4CEHB 1S96A 4JLOA 2GJAA 1P75A 1NBMD 2XZOA 1S3GA 2O8EB 2IW3A 3FKSA 1P9NA 3HJNA 4TT3A 4JVLA 2FOLA 3WP0A 4CIDA 3QEJA 3ZIAA 4JBYA 3ZVRA 5KDOA 2QENA 2A2ZA 1ZINA 2QE7A 2O8FA 1PV4A 1VHTA 5FR2A 1F3OA 2ODEA 4ZIRB 4DC9A 2O8DB 4NYIR 1HE1C 1MOZA 1XB2A 2NO1A 2W83A 3MD0A 1E9BA 4C7OB 1X8KA 2QM7A 2NTYC 1WQ1R 1F2TB 1GAJA 2UZIR 4BLPA 3AF4A 1LF0A 4FMBB 3GEEA 4E5UA 1MV5A 3KL4A 4RKFA 4D2IA 4C0KA 1ZVQA 4IKEA 4DKXA 4RFVA 2YV5A 1SVWA 4ZCMA 1N2CE 4XH9B 3ND8A 2GRJA 2V54A 2ZYTX 4IDOA 3MMPA 4I4LA 4V0LA 2BDTA 1E2JA 5JRZA 4EPRA 5FUWA 1WBBA 2NG1A 3FFBA 4OQNA 2PBRA 4DRZA 3OEEA 1R0YA 4HB2A 4F4IA 2D2EA 2WZQA 3L43A 2D7DA 4GPTA 3UXMA 4BFYA 5BXQC 2C9YA 4TTRA 1S3SA 3IQWA 1U8YA 4QBGB 2FSFA 3QEOA 3OIUA 4G0NA 3QXSA 1MABB 3KB1A 2ZR7A 4PHGA 2QPAA 4XTCS 5EE5B 1QVAA 2ZRLA 4DUGA 1EG7A 4AYXA 1TNDA 2YYZA 3QQ5A 1QG2A 2WWYA 4FMCB 3X1DA 2GCOA 3HR8A 1VECA 1RRFA 1DPFA 6Q21A 4B2LA 4IHQA 4ZCIA 3WP1B 2YINC 2NO9A 1T9HA 1P2VA 3K09A 1QG4A 4BGDA 1UDWA 2JLYA 1JR3E 1KMQA 4U7DA 1CKEA 2VH5R 3RHFA 1P3JA 2HCJB 4X8MA 5EE9A 3U4QA 5AUNB 1F2UB 1M2OB 3SC3A 5JEEA 1D5CA 1MR3F 4KXFB 1YKSA 3QPUA 5IK2D 4XSGA 4PANA 1RKBA 4QHSA 3ADCA 4DDUA 4XSHA 1W4CA 4OJQA 3GJ4A 3NBFA 1C9KA 4Q18A 4LV8B 3CH4B 5JMTA 4F4JA 1X86B 2JJ8A 1OF1A 2XXAA 1N0WA 1RYHA 2FSGA 3T06B 4EPTA 3KXKA 2NO6A 4ZKEA 4TSFD 4DEYA 2TMKA 4B33A 4DLYA 4Q1BA 1JEEA 1Z8FA 3AP3A 1XJCA 2OLJA 2R44A 1OFIA 1OHHA 4WZ6A 5AJZA 1Z0JA 1JBKA 1YR9A 3QG1A 3BH0A 4URVR 2YKGA 4BZPA 1UBGA 2J0UA 4BPBA 721PA 1W36C 4M1WA 1OE0A 2W6JA 4AD8A 4IJMA 4BLSA 4BWYA 2IHYA 1KSHA 2ZJZA 3CLVA 1FNMA 3BC1A 2HJVA 3LBNA 1KK1A 1YZGA 2BCGY 4IOKA 1Z2AA 3SBDA 1KDRA 4YXWA 5KDDA 2FGKA 4B74A 1XPOA 5EE0A 2X1VA 3AUYA 1TF5A 2PLFA 2WAYA 1AK2A 3RWOA 5EXPA 1NVVQ 1WXQA 2PMDA 3GJ6A 5CB6A 2Q0HA 3NH6A 1CU1A 2VHQA 1XMIA 1W2HA 5TY0A 2ZPTX 1E79D 2XAUA 2G1JA 5G41A 1SQ5A 4FINA 5E3HA 1S2MA 4D0GA 5BYKA 2JLRA 3AEZA 1XD2B 1QHGA 3A36A 4EAQA 4CDGA 4LHZA 4RD0A 1W0JA 4M53A 1NRJB 4GOKA 4UNQA 2W00A 3LY5A 4CGZA 2CEAA 2Q3FA 3QBVA 2RGXA 1VCMA 1KJWA 1GNQA 2OCBA 1CR4A 3PG5A 4LPSA 1R0WA 4MUBA 1Q12A 2R65A 3HP1A 4S2EA 4WXRA 4JBXA 3FYHA 3L8YA 4EPYA 5BN4A 3IIJA 1WE2A 1XMSA 4QHTA 3F8TA 1P6XA 4BLQA 4KITB 4LCBA 3UWKA 3GP8A 2OHFA 5E4FA 2QT0A 3B85A 2ZSBA 5AJVB 1XTJA 2BWJA 2QU8A 5EQTA 5JS7A 5EE3A 3CF0A 4CEIA 3TBKA 1VG8A 4GNKA 2KWIA 3PR1A 4RD3A 3B1WA 5HTKA 3GD7A 1DAHA 1KAGA 3P27A 1KI6B 4F93B 5D3QA 1HV8A 2A3RA 3GJXC 3T35A 2GZAA 4FCVA 1MT0A 1KSFX 3AV0B 1IXSB 1V5WA 2FN4A 2QQEA 1EXMA 3KKQA 1MO6A 1NF3A 2J1LA 5CYPA 3SBEA 5F2EA 5K8IA 2QG6A 2J0QA 5J4YA 3M6AA 4JT2A 4Q1EA 4Q4HA 1P7CA 1YHNA 1G8YA 5FH9A 2F43B 4A8JB 1OB2A 4KYUA 3B6EA 3ZVMA 4LV6A 5JLJA 1B23P 1E0AA 2H7VA 2WKRA 1SVIA 3QXCA 4HAVA 4UNSA 4GDFA 4QBFA 4FD2A 1H8EA 1CXZA 2XNDA 3RAPR 2GVZC 1E1RA 2ZYWX 4PPNA 3NBYC 4RKEA 1EFCA 1LS6A 1IN5A 3Q3JB 2MMCA 1KIMA 3U6BA 4GZLA 3N2IA 3QKSB 4O25A 4MKGA 3BFKA 2FPKA 3PEYA 1OB5A 3KUCA 3GMTA 3VX3A 1M34E 3QKRB 3R9XA 3GLGB 4KFSA 4KFTA 3GLIE 1QHSA 4DDWA 2GBLC 4LOAA 4Q4LA 3EA0A 3MWJA 4W7SA 5IT5A 3EWSA 1W5SA 2V7QD 4HZIA 3FVQA 3ZS9A 5DNYB 4QOSA 5M04A 1EWRA 4UKDA 4YMSA 5JEDA 3R9WA 1W47A 3QJYA 1ZNZA 2BEJA 3P32A 2XSZD 4RCYA 2HF9A 2GAOA 3PXGA 2ZE6A 4U02A 3ZLJA 1U90A 1JXMA 4B2PA 3RS2A 5GADl 3JVUA 2QAGC 4AI6A 2J7PD 3AVPA 2GEDA 2ZI5A 4LJ9A 2A5YB 3VFDA 3K70B 4KCGA 5ELXA 3U5ZB 2QY9A 4HI0E 2IHBA 4JLMA 4RD2A 1OH5A 5EP4A 4WAUA 1TQDA 2VP4A 5E7MA 4I81A 3O8BA 1IXZA 1W36D 5KPDA 2JDIA 3LW8A 4FWIB 2F9LA 2O0KA 1DBSA 4GBMA 1JJ7A 3FMOB 4HLCA 4PR0A 3SQWA 3WHLA 4Y0AA 2FPLA 4TMXA 4AURA 2F1JA 2QPOA 1W0KA 3W5IA 2BMFA 4MRSA 3S1AA 3VAAA 2FDCA 5JWHA 4MDEA 4HB3A 4LY6A 5FTJA 3X1ZA 1N6LA 3CB4A 4A6XA 2C9CA 1EFRA 5EP3A 2IWHA 3BH6A 3I72A 3OFNA 2OCAA 2Q9AA 1RJ9A 3KTAB 2ZJAA 5CITA 2QTVB 2VSXA 4OKSA 2FFQA 4OK6A 4A4DA 4M21A 4XWAA 3QVUA 2F3RA 1ZNXA 2WHXA 2EWWA 1PLKA 2P5SA 4D6PA 2I1QA 2FNAA 2PEZA 3EZ9A 3HR7A 1JB1A 4URWR 2NGRA 1TPZA 5FBVB 1E2MA 4JVSB 2YNMA 5FOSA 4YONB 3B1YA 1XD9A 3IHLA 1ONBA 4KBFA 4PSAA 3SR0A 3QE0A 5HKKD 3AKEA 4OHYA 1Z0IA 4M2LA 1HT2E 3IKJA 2JASA 3H1TA 4QGGA 4B75A 3I61A 2EFEB 2OESA 4AKIA 3GJ8A 2SHKA 5FOVA 5AUQA 3DO6A 5HE8A 2J5XA 1J70A 2H57A 3DHWC 3A1SA 3K9HA 2D2FA 1E2IA 1Z28A 2B8WA 3AGPA 2C9OA 3SS8A 1BO6A 1NVVR 4G5GA 4OQMA 4MYUA 4PPGA 3QXXA 1ZYUA 2JJ2D 3OEHA 3NWJA 4GFDA 4JSYA 2WV9A 1GL6A 1IJFA 1ZIOA 4PQFA 3A1VA 1DTSA 1TQ2A 1E2HA 3E70C 2PZEA 1W46A 2BM1A 3Q85A 2R6GA 2GDJA 1QHYA 5DGXA 3QF7A 1XXHA 5J4LA 4MGKR 4DLSA 5L8VA 4NBSA 3DOEA 3MWLA 2HF8A 2QTHA 1UFQA 2C8VA 2DWPA 2HV8A 4LBWA 5CK5A 3UMRA 4P4UA 2XZLA 2WKQA 1KJZA 4KYIB 3TUJC 4TWZA 5DH9A 1Q21A 1XEXA 3CZPA 1OYWA 1SKQA 1UM8A 4ZV4A 2VTKA 5F9FA 5C18A 1GM5A 2B7CA 3HU1A 1IN6A 4OBEA 2JATA 4IDHA 2B92A 3K0CA 5A5GA 3MFYA 3KJEA 4JLBA 4LX0A 4Q4JB 2C2HA 2FFHA 2OXRA 2PZGA 4YQFA 4QM6A 2DY1A 1KDPA 1TADA 2VP9A 1YRAA 4TYWA 4P3YA 2RGAA 4R98A 1ZM2A 4C0BA 2GHIA 3VNUA 1OLOA 3LAWA 3OAAA 3JZMA 2G77B 5KTYA 2XZPA 3B1ZA 2GKSA 3EXAA 3BD9A 4MYHA 4HB4A 4P4SB 5CM8B 3QPVA 1JPNA 2A30A 1GRQA 3F3YA 1Q0UA 4TL6A 3DEFA 3K1JA 2WWFA 1VTKA 1KK3A 3PITA 4LJ8A 3WXMA 2J45A 3CR8A 4KU4A 3MWKA 2ZS7A 2RHMA 1E2NA 2O8BB 1OPXA 5AJWA 1T0JB 2QGNA 3VKWA 1WP9A 1K5GA 2CCKA 2GVDC 1FUKA 4JLVA 4HSEA 4DCUA 3FKQA 2RKOA 1Z5ZA 1ZD9A 2YHSA 5FPSA 1H65A 1SZPA 3QIAA 2WAXA 3TH5A 1ZNWA 4P0TA 3U44B 1S1MA 1Z29A 4KFRA 4QRHA 1Y63A 4QBIA 3FGNA 3DKVA 1OXTA 1VMAA 4QNMA 1Z2CA 4LUCA 1SHZA 4OQFA 2R6DA 3K9GA 3T61A 5FOWA 4ACAA 2BV3A 4XJXA 3TW4A 3U2QA 2JJ1D 1I2MA 2LKCA 3L0SA 2X77A 2ZVQX 4M0LA 1N5KA 3B8HA 1DOAA 1N25A 2XX3A 4LC0A 3CW2A 3SOPA 1KZGB 2AXPA 4DCSA 2VLIA 1ZUHA 3J81k 1R2QA 1UEIA 4QG7A 1DO0A 5JRJA 1E4YA 4B44A 3PQCA 1E32A 2IUSA 2ZU6A 3WHKA 2Q9BA 1E2LA 1E2KA 4E09A 1ZW6A 1OKKD 2XJ9A 3LNCA 2WM9B 4ITRC 4DHEA 4F91B 2CJWA 1F6BA 2ZETA 2AL7A 1C4OA 3LQQA 1LV7A 1W4BA 4HUQB 3KQUA 4JSTA 1G5TA 3GJ0A 1P72A 2O8EA 1JNYA 2E9SA 5G53C 3IQXA 2DYKA 3IILA 8OHMA 3T5GA 1OFUX 4GT1A 3SHFA 4DLVA 3B1XA 4DZZA 4TL8A 2OO7A 4IXNA 2JLZA 4A2PA 2IXFA 4ZIRA 3RS7A 2NPIA 1DELA 2O8DA 4LYFA 3TAHA 2V1UA 5E7JA 1BOFA 1ZCBA 1F60A 1ZM3A 2P6UA 5FOTA 1KSJA 5K8TA 3CX8A 3I32A 2ASEA 5KUTA 2HT1A 4V02A 4QGHA 4ZPXA 3WYAA 1N6IA 1G291 5BN5A 1NY5A 3UMFA 1W44A 3KQLA 4TLBA 4W5HA 3EPJA 2A5GA 3AGQA 1M1YE 3RRMA 3TKLA 2F55A 5CDFE 1TUEA 1B0UA 2XTNA 1CP2A 1DAEA 2IYWA 3OIYA 4DT1B 1VPLA 2OE2A 2MSEB 4HAWA 4LGMA 3REFA 5JJKA 3WMEA 4CT4B 3CZQA 5CK4A 2FEMA 4TQUS 2VHTA 2ERYA 3EZ6A 1G6OA 3IUYA 5DSZA 1QHNA 2QAJA 5F98A 1GZSA 4NCIA 2QUZA 3U7EB 2I1VB 1BS1A 2D74A 3TQCA 2QAGB 3K09C 1HURA 2R8RA 2ONJA 3GLIB 3BS4A 1II8B 2ANBA 1OH7A 2X2FA 4LI0A 1FZQA 2F7SA 1XTSA 3MAAC 1G5PA 5FBRB 1TF7A 5K8LA 2P65A 4D26A 3BBPA 3RWMB 5AUOB 3F0TA 3H4MA 3K53A 1Z6YA 4Q01A 4B47A 4BECA 4BZQA 3BFVA 2WMOB 3GJ3A 1XP8A 1RPZA 4HB0A 2YJTD 3NTUA 1E4VA 1KTVA 5EXSA 2IT1A 1P9RA 1GRRA 4WBSA 4BLRA 4A0HA 4YMWA 1PZNA 1ZC3A 4Q66C 2RH5A 1WMSA 4XD7A 4JJZA 4D81A 1VYUA 1OSNA 2YC2C 2CVFA 4I1OA 4L9WA 4MRVA 1F2UA 5FFMA 4WW0A 2G6BA 2DB3A 4MITA 3TR0A 2ZROA 3VR1A 2ZSDA 1IN4A 4M1YA 2WOOA 4TLEA 4HUTA 4I1VA 3DM9B 2CCJA 2QMUA 4Y0VA 5J4HA 1UKYA 4BFSA 4NONA 3QXJA 3QXHA 2C99A 3EG5A 1SKYE 4L5BA 1A1VA 1FFHA 1R5OA 2PLRA 4J0QA 4NZYA 4O2LA 1NBMA 3TAUA 4MRRA 4Q21A 1XTIA 2V6IA 4X8OA 3P1JA 1JR6A 1G3UA 4D82A 4MDFA 4ASUA 5KU1A 3R20A 1DG1G 1XX6A 2XOKA 3FKSD 4NP6A 4XWOA 3MG9A 1XEWY 4TT3D 1G4AE 4FCWA 2R9VA 1DS6A 2CMKA 2BHRA 5GJWC 1R5BA 3ZIAD 1F48A 3FMFA 3EASA 2QE7D 1TQ6A 4E07A 3THWA 2IYLD 2ZVPX 4LJYA 3GFOA 2YWEA 2YC4C 3PCRB 3LVQE 3EAQA 2J41A 1XMVA 3AVOA 3SI7A 1NN3A 1ZBDA 4DLXA 1GNPA 4EQ6B 1NN1A 1Z07A 2ZRHA 3AVTA 4OHXA 1XF9A 3MUFA 4NHOA 2VO1A 4PAQA 5FL3A 5FPYA 3SJAA 2BC9A 2KBEA 3KB2A 2VP6A 3GCGA 3GLFB 4D0NA 4PTLA 1CR2A 4AIIA 2EW1A 2JLVA 1A82A 1CULC 4TYPA 3ASZA 4B3CA 2IX3A 2XEXA 3K0FB 4CW7A 4DSNA 2NMVA 3W34A 2IYYA 3EZ2A 3A6PC 4Z51A 1T8UA 2BBOA 5TXGA 2IC5A 5KDLA 2ZS8A 3CR7A 5LPNA 3SQXA 2HLDA 5P21A 2WSMA 3W6OA 4W5WA 1DAFA 1U9IA 1ZM4A 4H9GA 2BEKA 5AUPB 3NKVA 4NL4H 2FX3A 3MGCA 3ZS8A 4QHYA 4Q03A 2NO7A 5DN6A 3WNCA 3IBYA 4JLKA 3DM5A 1RIFA 1YR8A 2EFHB 2YOGA 2VP0A 1ESMA 3L2OB 3UANA 1N6HA 2OBNA 1QHHB 4RZ3A 3SZRA 4PAMA 2X8AA 1RFLA 1TQ4A 1BKDR 1D9ZA 2HUPA 1NMYA 4RVCA 5KYKA 2MSDB 1KI6A 3HYTA 4MUAA 3RSLA 4IVQA 4AKHA 5EE1A 1DADA 4Z54A 3L8ZA 2JIZA 2BIFA 2R6CA 3ZZ0A 4PFSA 3SHWA 2D62A 3UIEA 5C4MA 3NXSA 1CJVC 2KBFA 4KJZA 4NCJA 3R7WA 2GWHA 2QQ0A 2WWGA 4YMVA 5GJBA 4TMKA 3RDPA 3SU8A 5KNDA 2AHOA 2NIPA 3AP2A 1G3MA 5FR1A 1YJ5A 2OFXA 1ZD1A 4GI7A 4LBYA 2AXNA 2Q3HA 4Q47A 1FQJA 4HLUA 4K81B 3VTKA 2F43A 3QVVA 3SEAA 4WXPA 4FXPA 4A8JA 3L82B 2WPDD 2CDNA 5HZKA 1E9EA 3GEHA 1ZCAA 4BE7B 3ZVNA 4Q9LA 3CF2A 4MGIR 5FTNA 3O8CA 2RGNA 2MMGA 5LD2C 3DOFA 3B13B 4JYCA 4DSUA 3NEYA 3GFPA 1OXXK 2GXUA 1TUIA 5TVKA 1VDZA 3PEVA 1E96A 3QKSA 1X1RA 4TL9A 4BLTA 2AFIE 4ZDKA 4EFNA 1N0UA 4BASA 2HXSA 2ZJBA 5JI2E 4PZYA 3EIHA 1EFHA 3QKRA 4KI0A 5JHGB 3GLGA 1HYQA 2YWHA 2ZS9A 3WBKA 1OHHD 4Q9HA 4EUNA 3K0SA 4JL5A 2FV8A 3L0PA 3EARA 4H1VA 1O87A 1TTTA 2GAAA 4B35A 3LXRA 4MKFA 1NMZA 2O8FB 3A58B 1P9WA 2W6JD 5JSZB 1IJEA 2W0SA 4IEIA 2JLSA 3DVLA 1JQLB 4Z1MA 3NDPA 2VIIA 4LYAA 3WY9A 2GF9A 3Q8XB 2BCJQ 3QF4B 1DAMA 2ZJ8A 4I1SA 1OXSC 1PJRA 4YXWD 4YLGA 3BRWD 4D80A 1HH4A 3H2YA 1YZKA 1BIFA 1TMKA 1VCIA 2PT5A 3CUEF 2VP2A 3FHTA 4QC2A 1U0JA 3VKGA 1E2QA 2FSHA 3U3OA 4LPKA 3WYFA 4V0ME 3UMSA 3K9LA 2OCPA 4PX9A 3Q72A 4FMDF 2W2TA 3D7MA 3ZQ6A 5JCPA 1ZU5A 2WICA 3VR4A 3I5YA 2QT1A 1TEXA 2J0VA 2WJJA 3SDZA 4KV9A 2VBCA 1D2NA 4BFTA 5IF9A 2FJUA 1G8HA 2ZI3A 3B5JA 2OXCA 1W0JD 3BFXA 1UKZA 5C1BA 3CX6A 2XNSA 3SN6A 5F9HA 1U98A 5L3SB 4PQRA 1EGAA 2PH1A 3QBTA 4Q7MB 4YDHB 4D4LA 3TR5A 1VCNA 1Z83A 2XJ4A 4KAXA 3RC3A 4ERNA 2QMEA 4PHFA 2ZRDA 1E2EA 1XTRA 4CF7A 4XOIA 4BFZA 1D9XA 4TL7A 2CXXA 4Q5IA 2WJIA 1IQPA 3HPRA 2GF0A 1YRBA 4D4JA 2WSSD 5CIWA 1K5DA 1UF9A 4BFVA 3P4XA 1HEIA 3KTAA 1Z0AA 4TMVA 3EC2A 1IBRA 3K9NA 1IY1A 2AWNA 2FZ4A 2DFNA 3JVVA 2IS6A 4DIEA 1IY2A 5KSPA 2IWRA 3E1SA 1NNEA 3GLHE 2K5UA 1S9HA 2CVHA 4NCKA 4CVNA 4IVRA 1D6JA 1US8B 2YWGA 2CBZA 3FTQA 4NKRA 4C0HA 2Z4RA 5HCIA 2G88A 1GKIA 5TV2A 3C14C 2VL7A 2REBA 5DIFA 1UBEA 2RGGA 2ZI9A 3LD9A 4BEJA 4RZXA 2NZJA 2ZRAA 1DAKA 3CNNA 3ECCA 4NYMR 4JBWA 1J90A 2WOJA 1EK0A 4GP7A 1YQTA 3CO5A 3KKOA 1G7RA 2DHRA 4BFUA 2FWRA 4QM7A 2IYVA 1CR1A 4RD4A 4IOLA 2L0XA 3H0KA 1G19A 1TU3A 4HATA 3VHXA 3FMPB 1H8ED 3C16C 2XNDD 3R9IA 3W8RA 4LHXA 3SFVA 3PUWA 1G8FA 4RCZA 3PFIA 3AF2A 2GEVA 3U3JA 2VP5A 2RHDA 2AK3A 1FW6A 5JHHB 1T0HB 4Q1FA 4E22A 2ZJ2A 4LBVA 4O3MA 3C41J 4C2TA 1G16A 4B3FX 3CBQA 1AJEA 2DPXA 3T15A 3WRYC 3B60A 3K0CC 3WMFA 3IPYA 4PPQA 5SZKB 4M1MA 2V7QA 1IXRC 4IFBA 3ZYCA 1VYTA 3NVAA 1E6CA 5EUQB 1DAIA 3U7HB 1KK2A 2P5TB 3BGWA 1XCMA 1ZRHA 2XSZA 3NHBA 4V03A 2GXAA 3UATA 1N6PA 4QJ3A 1G4UR 2HCBA 4B3DA 4G5QA 1N5JA 1RRGA 1W48A 2Q21A 4EPVA 5EP2A 5TARA 5BW8A 1JR3A 5CM9C 1H8HD 3TSWA 1AS0A 2WWWA 1KI2A 2FF7A 2J7PA 2ZEJA 1UJ2A 3UK6A 1X3SA 2ZRBA 1HT1E 2ZAMA 2OAQ1 2PL3A 5SZHB 4LHWA 3KJIA 4Z8YA 2VHCA 3CKLA 3O8DA 4OL0A 3HYRA 1GTVA 3Q5DA 4Q4JA 4KVGA 1R0ZA 2ZUBA 4ON9A 3UWOA 4PSVA 4POAA 4EPXA 4M9ZA 4B76A 2JAQA 3QKUA 2JDID 2UVQA 4IXMA 3WMGA 3OESA 1CR0A 2IF0A 2A78A 2KB0A 1CF4A 1LF5A 3QY0A 2ZJ5A 4MKIA 2ZU0C 1SKYB 4JKIA 5JI3E 1SULA 2FEOA 2VSFA 2WTUA 4WOPA 2ZE5A 2R62A 3AP1A 3KKPA 1IY0A 4OI1A 4P4SA 2ZRPA 4W5JA 1W0KD 3CH5A 4GL2A 2CLDX 4NU0A 3QNUA 3IO3A 2V1XA 1L8QA 1E1QA 4TLAA 5FTMA 5EUMA 3FMIA 1S8FA 2ZANA 1QRAA 4B34A 2QSYA 2WIAA 4EDHA 5C2JB 2DR3A 2NOAA 4A2WA 3OFND 2BBTA 4RZ2A 4A1FA 1OH6A 2ZRIA 5B57C 5DYIA 1GL7A 5JECA 1T91A 2EVWX 2N1BA 1U99A 2IS2A 3D6TB 4GP6A 1MRNA 2IXEA 5FL7A 3U44A 1ZUNB 1GL9B 4B3XA 3NHAA 1CIPA 4I1UA 4JLNA 1G7TA 4PO8A 3KFXA 1IAQA 1OXVA 4DLUA 1R7RA 4TTPA 2VHUA 2BM0A 3GLFE 1YE8A 4RY2A 2J7KA 5DO9A 4C3ZA 3KJGA 2PMKA 4NE2A 3TVDA 4ZKDA 3BAFA 4O2RA 5FI1B 5CB8A 1TL7C 2B8TA 5G40A 4OK5A 4TLCA 2B7BA 2CK3A 5E95A 3RVBA 3WNDA 5J4VA 2JA1A 3LX8A 2BMJA 2IK8A 3U6KA 2GJ8A 4F38A 3QSYA 3THYB 1IHUA 5SZIA 4D0LB 1R8SA 4M9XA 5FPTA 3AUXA 3ONWA 4ARZB 1XRJA 4XWKA 5KO2A 2YWFA 1G5RA 2V8OA 1KKMA 1MH1A 2FU5C 3C15C 3LFUA 2JLUA 2XGJA 3RS3A 1MKYA 3TK1A 4LHYA 3OEHD 4DCTA 2QP4A 3DPUA 3PUYA 1NMXA 3ZZTA 1GKUB 1U8ZA 2VSOA 4NMMA 4CRWB 4HDOB 4JYBA 3ADKA 4U00A 2D06A 2YVUA 1KNXA 1T3SA 4CZ2A 4EJSA 4ZI3A 1GVNB 3AVUA 3A1TA 4PO1A 2J9RA 1AQYA 2FZLA 2QA5A 1VG9B 5L3RA 3PJRA 3ZD7A 2ZAOA 4ABYA 5LD2B 2Y8EA 3KZ1E 4DBLC 2VYFA 2IBMA 5DHFA 1LY1A 2D7CA 4JS0A 3K0AA 1COWA 2OEPA 1AM4D 1OFHA 3NEJA 4DLRA 1XEWX 1WA5A 3A4NA 4A92A 1E0JA 1V43A 3RYTC 3RABA 2N42A 1W36B 4DCVA 4CEJB 1T3HA 4P33A 2WIBA 3VKHA 1SXJC 4L9SA 4QFMA 5FBLB 4M9QA 5C46F 2HDNB 3LW7A 3QUSA 2GBLA 2J59A 1JXOA 1Q57A 1W49A 1P60A 4DJTA 3GEIA 3VU9B 4DT1A 4ZO4A 2VHJA 1WRBA 3FHOA 4EFLA 3KJHA 2EFDB 1W4RA 1E0KA 1QHIA 1ODFA 3BWDD 3BIFA 1WBDA 2BKUA 3BK7A 2ZR9A 1UPTA 2HJGA 4RD1A 4KLZA 4NCNA 2P6RA 2PT7A 3OAAD 1GFIA 4IOJA 2KE5A 1U2RA 3PUVA 1DARA 4BRWA 1NI3A 3VR5A 3E5HA 1KSGA 2QAGA 4M4SA 5LB4A 1KO7A 3GLIA 1II8A 4PC2A 1AKYA 2Q9CA 1KI1A 4NYJR 2W6IA 1BMFA 1JQJC 1NKTA 1A4RA 3ZD6A 1OIVA 3W5JA 1G8PA 5L3VA 3VNVA 1G41A 1R8QA 4PC7A 3AB3A 1SVLA 5HR5A 2Q3MA 2AD5A 1ZIPA 4C0LA 1G17A 3BXZA 4N1AA 2ZUDA 2QRNA 4GMXA 3EZFA 3OZXA 2WWIA 5DLQC 3LO5A 1PLLA 4LWZA 2GJSA 1SVKA 4QL3A 3P26A 3QPWA 4F7WA 1T4GA 4TN1A 4MYTA 2J87A 2ZRNA 2JJ1A 3HU3A 3IEUA 4G01B 4GSYA 4A6PA 1DAGA 2AR7A 2QNRA 3EPLA 5GJVC 4R71A 2IEZA 2HEIA 2AN9A 2GZHA 3RS4A 3B9QA 4TZ6A 3KKMA 3K0EA 3NC0C 5CLLA 1Z6GA 221PA 4IVPA 4IDQA 2OFOA 2QP9X 5BYJA 1NG1A 3W8NA 2RCNA 1OT3A 3M1IA 5KNCA 2QROA 4BLOA 2CNWA 2BBWA 3SNHA 3KQHA 4CEHA 1MRSA 3VR2A 1XBTA 1XZPA 4PZZA 1A7JA 4UNPA 2Z6VA 4XIGS 4G5SA 1UBFA 2X2EA 1KNQA 1GSIA 4A2QA 4AWXA 2YOHA 4P32A 3LA6A 3AVVA 821PA 1KO8A 1WCV1 1X1SA 2ZUCA 1SGWA 2CE7A 3OE7A 1NY6A 1OIXA 2PJRA 2EFGA 4XVUA 4Q7KA 4US0R 1Z3IX 2RGBA 1YU9A 3LDAA 2JGNA 3LQRA 5EZ6B 3EA5A 2ZRJA 4C7OA 3GLHB 1AS2A 3AVQA 3AF3A 4FIDA 5J40A 2IS4A 4PC6A 1ZNYA 1F2TA 4RJLA 2XTMA 3LXXA 2FH5B 2FMXA 5GVSA 3FOZA 1LVGA 1WF3A 1FOEB 5UKDA 2H18A 4OQXA 1KJYA 3MJHA 2EU8A 4EQ6A 4BFXA 2GCPA 1R10A 1N3BA 4OI0A 5GVRA 2ZRFA 3FE2A 3I5XA 3R8CA 1XNJA 4Q1DA 3W9YA 3TVTA 1E2DA 3IO5A 3NBZC 5IDVA 4B3GA 1L4YA 2OG2A 2OZEA 2CHQA 4V0OA 4AKGA 3GLFA 1RC8A 4Q4AB 4AG6A 5AR1A 5DI3B 3PEUA 1XCPA 3EC1A 3UPUA 3K0FA 4LHVA 4C0QC 2OV2A 1QBKC 1AZTA 4FN5A 4ESHA 4TMTA 1U0LA 1GWNA 2ODNA 4OYHA 4QJ4A 1MABA 2NO0A 4B71A 4Q1AA 3Q5EA 3DZ8A 4AY2A 1TAGA 2R6FA 1DEKA 1JI0A 2Z4SA 1FMJA 4OI2A 4BFWA 4TQ9A 4C9BA 1NN0A 2ORVA 1SXJD 4F92B 2IYQA 1CRPA 5DI9A 3CRVA 3A8TA 3B7GA 3BORA 3T1VA 3CONA 2W58A 4JVMA 4HLDA 3SJBA 1II9A 4Q02A 3VQTA 2ZSAA 1N6OA 3OIVA 1IN7A 1KI3A 1U94A 2JEOA 1QHHA 2CHGA 4A8JC 2Z83A 2VF7A 4PC1A 3CNOA 3X1YA 4DVGA 4US2R 2GCNA 2QORA 4BQSA 5G3ZA 4JL6A 4KHZA 4L4UA 4Q48A 3T12A 2OBMA 3WNBA 3TUIC 1F5NA 4N3NA 4FWTA 4HYYA 2W0MA 3VR3A 2IYXA 2A5JA 3BB4A 5G3YA 1Q3HA 4LC1A 4KFUA 5BN3A 2RGDA 1YR7A 4XD7D 3ADDA 5FBQB 1P2TA 2GILA 2VA8A 3DZDA 2YOFA 4JZKA 4NCHA 5A4JA 4HEJA
chains in the Genus database with same CATH superfamily
2FA9A 4JGGA 5I3ZA 2E1RA 3NBXX 1B8VA 3RSZA 1CJUC 1I4TD 2GNOA 1GAQA 2O06A 1J2YA 3VDRA 2ZKLA 4OJMX 4F11A 3NGMA 1WB9A 3HZRA 5LU9A 2IUUA 3OKPA 4R4JA 3LUCA 4H59A 4NR0A 4NZ9A 4BX0A 1AGRA 1FP6A 3I73A 3NHYA 1KBQA 3FR7A 3VO8A 1YJBA 3KLBA 4QSHA 4MGZR 4V39A 4AM8A 2Q2OA 3DAYA 421PA 1BKSB 3R3ZA 4YYEA 1VPEA 3BL8A 3D02A 4XR4A 2O8CB 3KR9A 1R9GA 1XTKA 2V0NA 1E7MA 2QTGA 2XMBA 3BOSA 5SY6A 1Q0TA 1EUYA 4RDXA 4DSTA 3KIPA 4NYMQ 4C2UA 1B2LA 3D1LA 2QTMA 1RCUA 1XHFA 2DQSA 2R1VA 4DSAA 3K70C 2Z2XA 1G3IA 4H7FA 4I4TA 4MCIA 3V2UA 4ESVA 3KKNA 1JECA 5KJCA 3V8PA 4PQYA 4YMUA 2PAAA 5J4KA 1FS4A 3IVGA 3KV3O 3OZGA 3OZWA 2C42A 2HO5A 2PMCA 1VG1A 4IHJB 4XLTA 2G9QA 1G21E 4HDSA 2RB4A 4JJFA 2J3DA 2HQBA 3OT4A 3RHTA 3VNBA 3H84A 2I2BA 4YCJA 1YRLA 3TFWA 3NGXA 3NPMA 1WF6A 3CZCA 1Z0ZA 3QF4A 5BNZA 1YMQA 2D0OB 2PYIA 3A6KA 3K7EA 1DP4A 1G8GA 1ZGGA 2I65A 3WJ1A 2VYQA 4LFCB 5KTOA 1A7AA 4MA4A 1UFKA 3EPRA 4KRFA 4DMUB 3LHDA 5IC4A 1KMHB 1GT91 1JKJA 4FCTA 4M38A 3CSSA 1R5NA 1P61B 2HNAA 1GGKA 5FUYA 2ID9A 1U7WA 3LRXA 4ARCA 3AF0A 3HXKA 4NCXA 4ER7A 3TF5A 1N7GA 3OKAA 2C96A 2ECKA 3I62A 1Z6TA 3R5HA 4YTEA 3TSZA 1QZXA 3ZWWA 5IXJA 1DQZA 2JH3A 2WJGA 4HN4B 5AQEA 4POOA 4D8YA 1KH2A 2CL6X 5AVQA 2A88A 1YQ9A 3RU7A 4B46A 1U80A 1AKTA 2HLDD 5JS2A 5I9NA 3P20A 4CL2A 1PWHA 1NW5A 4HVAA 3TLBA 1SXJB 2WU1A 4A26A 4RX1A 3E5MA 2QSZA 4RKRA 3WZLA 3GPDG 4E5VA 1GG2A 2X4DA 3QYFA 4BVEA 4EL0A 3ZNNA 1JWAB 1CBUA 2PL5A 4UNRA 2YRFA 3KJNA 4LA4A 1XKXA 2WJPA 2O5EA 1X0VA 1X94A 2OILA 4W6ZA 1BCRB 1P77A 3LP5A 3DMTC 4Y2VA 1MF7A 2WAOA 3FJOA 3L77A 4LKRA 3RAJA 1UXJA 4IH9A 2EOAA 2GX6A 4PNEA 5CLJA 3TSOA 2P3SA 3I9JA 4KVAA 4MP3A 4TWAA 3I1JA 2QZ4A 4K6GA 1JW9B 2PS1A 3R4CA 4URUR 3WBJA 3NU1A 2NQ2C 1NYQA 3SC4A 5JCZA 4JEIA 2ZBDA 1QPZA 5GM1A 1UMDA 3GDGA 3STYA 4TRMA 2IEYA 5IK2A 4D57A 3PFFA 1T8PA 1SOAA 2AWOA 2LIPA 5HCNA 4XB1A 1DRUA 1NPDA 2B5WA 4CM8B 5F7JA 2AQIA 1PYDA 1G66A 1KY2A 4MRAA 4OCZA 1UBCA 1Y37A 2EIXA 4HDNA 4KZKA 5FI0B 1PK7A 3EMVA 1U3DA 4HXYA 4R8LA 4AG5A 1IXKA 5JYCA 3HB5X 4TSFA 3GFGA 1Q7CA 2VDJA 1OCEA 4DPLA 2DUNA 2V6JA 1RAAA 2L42A 3NEAA 2BD0A 4WA7A 1WTAA 3MJVA 4BVAA 2GA8A 2OV4A 4OI4A 5LJIA 5HF8A 3K15A 1NBOA 4I9UA 1OZAA 3WL7A 1STOA 2GSDA 3AKDA 4GKJB 3HWX1 1EM6A 1T6NA 5JSZA 2ET6A 3HSYA 3AB7A 1Y9EA 3A4IA 4XD2A 4A15A 3BILA 3JZAA 5B37A 4G09A 2FPMA 5INTA 1P4JA 4TOIA 4AJJA 1JU4A 1T6ZA 1CIVA 2CKDA 4IMPA 3RCBA 4EG8A 3HFJA 5C32A 3CMMA 3LQFA 1YZQA 5IARA 2PYZA 4PLCA 3A1DA 4DAOA 3IIMA 4TUYA 4K8OA 2VK1A 1Z6ZA 1Z08A 2J3LA 1Y6FA 5C1IA 4M0DA 1OFTA 1RQ2A 2OZKA 2G7MC 3THWB 1GDTA 1D2AA 3EXG2 1YWGO 3T7RA 2AX3A 5KNDH 1NT2A 1JEJA 5E4JA 1UEXC 3K4HA 4UHBA 5MN5A 3T9EA 4AYTA 4DFDA 3D4PA 3ZGXA 4ESOA 4G4GA 4RLSA 4QUDA 3A1UA 3AOEA 2Q5EA 2VPYA 3PQEA 1UJ5A 4NNPA 3CRZA 4UVDA 6AT1A 4JT4A 4FHCA 1FW8A 1Z37A 3DEHA 3I9FA 3KZKA 1A72A 4HP8A 1T5DX 4PWZA 4L27A 5BSKA 3T41A 1ITZA 3B82A 3EEOA 2ERCA 2QD5A 4UDOA 4JJGA 4DWWA 1E7WA 1M2FA 5CH8A 3FPKA 4L5CA 2ZQ5A 1DC4A 4DDTA 3U60B 1DIAA 3G0OA 2FYTA 2LD4A 2PVPA 5ES3A 4X65B 1L7BA 4COOA 2RHHA 4J7CA 3TQFA 4V1CB 5AW4A 4A36A 1Q22A 4REMA 2WHEA 4BQEA 4BNKA 3L92A 1WMEA 2PBFA 4KLCA 1TM3E 3UAVA 2F4VB 5C8YB 4FEEA 5DHRA 1CUUA 2IEBA 4H1UA 2Q07A 3O8OB 2JI4A 2XNJA 1HNNA 3EFOB 4YC7A 1RPTA 3ANTA 1QWSA 2A0KA 1PIWA 4N3GA 2Z5FA 5H1YA 2K4MA 4GEKA 4WCDA 4FFLA 4LY0A 1O5OA 1QS0A 1ZJZA 3X43A 3FTFA 4LRWA 2JIBA 5TDHA 4MVWA 3COSA 4QYSA 3H19A 1R0XA 1E2BA 3V4OA 3I23A 1Y3AA 3IEPA 4EELA 2ORIA 3FWHA 3QOYA 1VYVA 3I6QA 4X7BA 1ONSA 1ACLA 1Z4KA 4YXFA 3WLNA 5B53A 2Q2NA 1ZUNA 3E4CA 1SVMA 3BB3A 4OFWA 1VIAA 4PPYA 1AN9A 3THOA 1QR6A 4XCXA 4RORA 3UTCA 5I7VA 5TMPA 3U4QB 1EESA 2R8PA 4PYRA 2DKFA 2XBLA 2VZ9A 1DWOA 3OMLA 4HH4A 1QTNA 5C4GB 2CE2X 3WTBA 3KQNA 2VPWA 2WZCA 5JW6A 5B1HA 1KAQA 3PUXA 3ZHTA 2CF6A 1O89A 3CLRD 3DL7A 4PQGA 4QEDA 5AM0A 4JXXA 4CKEB 2XXAB 1YBAA 3VPHA 3LCRA 3O4HA 2G3YA 3GDOA 1E1RD 2JAWA 3FYTA 5IT0A 4BJ5A 1GFSA 5BW6B 3BM5A 2Q2WA 5C34B 2J0SA 5TT1A 1XTQA 2AYXA 1ILEA 2WY2D 3TX6A 4TQGA 1SAYA 3THYA 1DMSA 4QRDA 3CJTA 4EF6A 4P31A 2O3RA 4C5BA 5DP1A 1VZ2A 5CFNA 4N03A 4Q3LA 2H9IA 3JQ9A 5EKTA 3Q1KA 5GONA 3SIXA 1PL7A 1OLSA 1X80A 1NVEA 5TMDA 1B3RA 3JQAA 5FLKA 3BFPA 2J0UB 2IXGA 3A4VA 4WLUA 3UJ3X 1M2VB 4XYBA 3G3EA 1ZFNA 2W11A 3O4RA 4P4GA 4URZR 3STWA 4OUDB 1VSTA 4LK2A 1MT3A 1T9GS 3CX7A 3CIFA 3NCTA 3LBFA 3R09A 1PT5A 1CLUA 1XMJA 5DTEA 3ULKA 3BDIA 1MGOA 3LH5A 2ALJA 2EX0A 4FFOA 4MVYA 4FFMA 1O5IA 3CRW1 1GVHA 5J5CA 5ALIA 4EFMA 1OASA 2PNFA 2A0UA 3TZLA 4NTZA 4FBGA 1ZK1A 1FFGA 1XFDA 2HPAA 4FQ5A 3UWPA 1H0RA 1OGJA 4IG9A 1KI8A 2EARA 3M2PA 3QYJA 1M8FA 4BRZA 2PGOA 4WDRA 1LBQA 1J24A 1S2NA 1K86A 3H4IA 4ED9A 1QORA 1ZAKA 4TTIA 1MH9A 4GH5A 1VCOA 1W52X 2NZXA 1J33A 3JQFC 5F3RA 2ODBA 3FNHA 1UJMA 3IRUA 3UENA 1NG9A 2N3ZA 2EJCA 3EHDA 4OHUA 3E5NA 2IH5A 3T4PA 1S02A 2AEMA 2VEDA 4CEJA 1KDOA 4DVJA 1V1RB 4HDMA 1P17A 2BEWB 1G6Q1 3TQQA 4AO6A 1Q20A 4IVNA 1KOGA 3CKKA 3GJTA 3DDCA 3KDSE 2AOTA 3OH8A 4JLAA 2X0EA 4OKNA 3S8YA 1B2RA 1HGXA 4O5OA 1CQIA 2W2NA 1JYEA 5TC4A 1SPXA 3VU9A 3U7GA 4BNYA 4DMLA 4MKXA 2XF8A 4I50F 2PS0A 1KAHA 1D2MA 1P1KA 1Z4LA 4DLNA 4Z8XA 3L3BA 4EY8A 1P2UA 4CKWB 3AC0A 1VLLA 2W6OA 2Y0PA 1ORIA 2IYTA 1XZ8A 4EY7A 5KQMA 5K20A 2QRZA 4LOLA 2CFTA 2XTZA 3FVTA 2G0TA 3OZUA 1OZHA 2ZDGA 5LZ9A 3FDFA 4NQRA 1Q5PA 1M9NA 3T5DA 3AR7A 2AMVA 1NYLA 2F00A 4TKMA 3NHZA 4M98A 5G1OA 1RYMA 3WYGA 4BO5A 4IIFA 2OBBA 4XGKA 5K3AA 2QJWA 3WL5A 4EUSA 1E3MA 1GNSA 1E1QD 2K2WA 1FSFA 3S28A 4JQSA 4FIZA 4Y2QA 3ACBA 1G21B 5AICA 4DEXA 3O2SB 1F4PA 1KWKA 4CXMA 1BWQA 1ZOLA 3IXLA 5LP6F 5JY1A 4H6PA 3P0RA 4QOGA 1EFUA 5A6SA 4H17A 3WGLA 5LYJB 3VVLA 4TKVB 1MJHA 3PC8C 4KMSA 4Q4HB 1NE7A 1QO0D 5FL7D 1E1NA 5KYYB 5I9SA 2GK6A 3RUCA 3C7KA 3EGXA 4RZSA 2LCFA 1EXWA 4D9CA 5L4LA 1GXSA 3CF6R 4XRGA 2EYUA 2ZYHA 2GKGA 2GXSA 2PLWA 2VTVA 2Y1LA 5HFNA 4I5IA 3DLHA 4EG5A 2XHZA 4C4PA 2R1TA 4XLLA 3BXPA 4MV0A 2PWZA 4BVBA 2CNDA 2EP7A 2H17A 2VTEA 3FDIA 3RYFA 1FDUA 1CF9A 2F1KA 2P3QA 3LGAA 1D1SA 1WEKA 5A0FA 1KEEA 1UPFA 3EPKA 4TLDA 4WOBA 5HKBA 1U5BB 1XDWA 2CK3D 1M0EA 3O95A 1RAFA 4C20A 2GETA 3EPHA 4H27A 4PM4A 3F90A 4RYLA 3D3EA 3LKZA 5EP1A 4F8YA 4MLDA 3TRFA 3GC6A 3FKJA 2BFPA 4M9SA 3R9XB 4YRDA 1Q7TA 1E77A 3R0VA 5JO9A 3E8SA 3MT8A 4CYMA 3N0VA 4NX2A 4UQOA 5HM8A 2KSQA 4CR7A 3NALA 4OGLA 1B26A 4R9NA 1HE3A 1YQEA 3R4VA 1ZUIA 4IFIA 4LNUA 1YZUA 4D9JA 3VPBA 2UYHA 1CZOA 1N9GB 2NXJA 3U19A 4HEHA 2YMPA 3CLSD 1I2DA 5TPZD 1N6KA 3RQSA 1I1QB 2V7UA 2W5UA 1HORA 2LR0A 3D2AA 4MJ7A 1GILA 3EVZA 2G9NA 1UOEA 3DOOA 4AY4A 4AVYA 5TS2A 2NXCA 4GZMA 3HRHA 4KQWA 3O3OB 4ZAFA 4OOFA 2QMYA 5EQJB 3WOHA 1GPNA 3UA3A 1QDLB 3ZWXA 4F86A 1VG0B 1TDJA 3HYCA 4B73A 2ILVA 2VJAA 1XU9A 3V55A 4EIWA 1COWD 5KX5F 3Q8MA 2C4NA 2H1IA 4JBIA 4O4LA 5EWLB 1P4SA 3MLEA 3VYWA 1YACA 2X9LA 1YA4A 3AFMA 4FDMA 4G07A 3CVYA 4BVHA 4NVRA 2GARA 1U3WA 2JGAA 2G82A 2VJMA 3TI7A 4BMOB 2MINB 1RU3A 3SZGA 5D1HA 1G3RA 5DVZA 1II0A 4QTTB 4X6YA 1E6KA 1E8MA 1PZGA 4UDXX 1IM5A 3D5TA 3M3PA 5K0FA 2VJQA 4S1VA 4BKUA 5LOVF 4IW3B 2VDMB 3SZUA 4QODA 3TN7A 2EWMA 4P4TA 3UC5A 3DT8A 3DONA 3IBGA 3RAGA 1XQ1A 3S1AB 4CIWA 2FG5A 5AVKA 5KC8A 4NABA 3WV4A 2O23A 4NENA 2PRZA 2FVYA 3M5WA 4NYIQ 3QJGA 4WCVA 3JYQA 5CNIA 2ZDQA 5A7GA 2W6PA 4A0FA 1BXGA 3LCCA 4P4NA 4PSKA 1CRQA 4FR0A 2IRWA 3GJRA 3IXMA 1KO1A 4YGXB 4BATA 3GG2A 5FBZA 5IBPA 2CL5A 2EATA 3V4RA 4IIJB 2I3BA 4GL4A 4URYR 1GTRA 2D59A 2QI9C 3T3IA 5LUAA 2P6NA 3LLMA 2QUJA 3IDSA 4L16A 3FDZB 3KLNA 3OMXA 1FY2A 3OETA 1W5TA 2NZWA 4IYRA 5JDCA 2NM0A 5BVHA 1JPJA 3L8MA 4XFKA 4UHHA 3BH7A 5CVDA 4JI6B 3X1XA 4CIAA 2QJRA 1AKVA 2P75A 3OJCA 2Z0MA 2YYAA 4ZEOA 5KOYA 5KMGA 1YVUA 1O95C 1TMOA 3EODA 1RQPA 3OIGA 4LJ7A 1YZLA 2Q5IA 4UUMA 1L5RA 1NJ6A 3IDFA 5I4IA 2P0YA 4INZA 1PP4A 2HF2A 2WKPA 4L5YA 1K6EA 1KQFA 4LYEA 1DJLA 3PD7A 4UFNA 4X60A 5LB2A 5BWCA 2WP0A 3N87A 3G0HA 4EG3A 4MS1B 2KHZA 3ND5A 4AF7A 1HLGA 4MZDA 1H4VB 3V6LA 6YASA 1EFVA 4YEDA 3IVCA 5HDQA 5ENDA 4YFVA 3RSCA 3CPEA 3R5SA 4TTJA 4DLTA 1Z33A 1JFSA 4KWCA 3JWGA 1WW3A 2B1IA 3WFZA 2GO7A 4C4AA 5C52B 4XDYA 1S9DA 1EFLA 4IOMA 2JGDA 2G17A 3A6FA 4YRGA 4LJ4A 1R16A 1KE1A 3SYLA 2R84A 1BFKA 3TGWA 3SE0A 3GP3A 4IPTA 3K8YA 3VR5H 1U1IA 5AOAA 4CKXA 3FSEA 4ZDIA 1DEHA 5KNCD 1U0SY 2F9FA 3H17A 3O83A 3ZI4A 4RZUA 5GZ1A 2HWUA 3GCDA 4NK4A 3AVYA 5KCMA 5I4KA 1DE0A 1Q74A 1DTWA 2F1HA 1JE0A 1RHQA 5JYBA 3B2EA 4RS3A 3D1VA 2CLIB 5A4DA 3A1WA 3MBIA 3ZW8A 5AXDA 4QELA 5FF9A 2VZLA 5KQGA 4CG0A 1CWUA 1YGPA 3D6UA 3VAYA 5LMZA 4DV4B 1CEEA 1F1BA 2O7VA 2YH2A 4ND7A 2A9JA 2P5YA 3CSUA 4WGGA 5ICEA 4J75A 2DBYA 1YJ8A 5DDIP 3RRBA 2BBSA 3RBAA 3DUWA 2VG8A 1TTHA 3CUVA 1BROA 3MRXA 3SLKA 1PGOA 3IXQA 3STHA 1MVNA 2W2LA 4G1UC 3L0BA 4N0DA 2ZM5A 4QJBA 4F96A 5DU2A 1KBOA 5C81A 3G2MA 5MN4A 5H59A 2DFTA 3HI4A 2IL1A 4DGSA 4KIJA 5FOXA 5DK6A 2CLEB 1R27A 1BRMA 1DFHA 2MYTA 3DMGA 1RSZA 2AYZA 2ATIA 2CEKA 3GUVA 4I0WB 3D2LA 1RRKA 2JCSA 4Q05A 2Z8YM 3ROGA 3W5DA 4BVJA 1M5RA 3A2KA 1UINA 4TKUB 2PZFA 5JVDB 4G26A 1ZGBA 2WD7A 5JSHA 1YS6A 1E9SA 2BOVA 3U0VA 4G86A 2JGJA 4QATA 3AX6A 2B0JA 1WJGA 1WY7A 5E6UB 1CUFA 5JFGA 1QNLA 1QK3A 4ZYLA 1ZH0A 1K4KA 3MTBA 4LBZA 4RKYA 2Q7DA 3HPQA 4P82A 3RRFA 2G9ZA 5LVAA 2UYQA 3V1LA 5CFRA 1U3GA 3LKVA 3LLUA 5EWJB 4M7PA 3WGHA 4WJKB 3URMA 3RAFC 4M1TA 1V11A 4LYHA 4MRMB 4TQAA 1XHLA 3TWOA 5JXGA 4NPHA 2I4TA 2QN8A 3FNBA 2XRFA 4XYEA 4PNPA 1XLTA 2IDMA 4DSOA 5KSOA 3MBOA 3NAZA 4EG1A 1OZ0A 3HK2A 4BIIA 3D54D 3QX8A 3V32A 4G1VA 3IOYA 3CM0A 4TYMA 4Z9AA 4YMTA 5K0EA 1UEJA 1RI2A 4K9QA 1J7JA 4QNRA 2ZP1A 1QE0A 2PFGA 1I4DD 2UZ0A 3Q7QA 5L53A 1SU4A 2IA5A 3FB4A 5BWMA 3PTZA 4TMWA 5IH7A 4EAAA 1OWLA 3CA8A 1GIAA 3GEGA 3H9EO 3H9CA 3P2KA 4KKVA 2YXBA 4PR3A 3VYVA 5KVCA 2F6RA 4W9NA 1Y5NA 2O52A 4RBNA 1Y1KE 2GJKA 5BSWA 4CG1A 1ESEA 3DE0X 1U8AA 3FSGD 1QZ3A 2JLQA 1EAYA 4B32A 3O73A 1KY3A 4B6PA 3VMFA 4UJ3A 3STUA 1FYEA 4B43A 2V98A 1NVWQ 4A82A 1HTBA 2B82A 3H5RA 4WTOA 5FTLA 4X1KB 1G5FA 4QEKA 3AU9A 1ETUA 1YSCA 3KEFA 4JJKA 2AOUB 5CLHA 3OP4A 3AY7A 1C0IA 2G5TA 1PR0A 2WR8A 4ZV9A 5ICGA 3GGDA 1WXDA 3ISTA 2ZRMA 4Y2UA 5D3MA 2PSSA 5AKHA 2DPMA 2IEGA 1S6YA 3A1EA 2L17A 1NXWA 2RHLA 4EYOA 5BT9A 3ENWA 1QB8A 1M6VB 1O8BA 1PR9A 3VNAA 4CNBA 3THXA 4PU0A 3SMQA 4DCGA 4OJKA 3RYIB 1HFWA 2A0WA 2GJAA 3LYAA 3RUDA 2Y1GA 3ESRA 5TNXA 2MU1A 1P9NA 4EY4A 3HJNA 4TT3A 4JVLA 2BGUA 5BP7A 3M3DA 4LMPA 4IKPA 1D09A 3QEJA 3WL8A 1GA1A 4F2DA 2YFKA 2QENA 2VF4X 1CZNA 2LCQA 1TOAA 1E7RA 5TR9A 1X8XA 3E48A 4RVGA 3HBLA 4CZ2A 1VHTA 5FR2A 3ZGVA 2F64A 3RU2A 1EHCA 2AZTA 2IKQA 4ZIRB 4MQEA 3K8OE 2BP7A 2JIOA 1I32A 1VE7A 2EGHA 3HZHA 3N8IA 4NYIR 2IQIA 4ENQA 3BMOB 4BKMA 1IRIA 5KNBD 2NUBA 1BE8A 1XB2A 2W83A 1E9BA 1P1RA 2HLNA 5IEJA 1PJQA 1HRDA 3LZ6A 3DXXA 4N7RA 4OQYA 4V2UA 4UBNA 4DJJA 1F2TB 2UZIR 4ES6A 4KIWA 2I2DA 2AHRA 3ZDEA 2IPAB 4OD0A 3FAZA 2ZATA 5BN5B 3V2IA 3WB0A 3UWDA 2SKCA 1O6ZA 4KTVE 4OFBA 2J0EA 3P97A 1MV5A 1OREA 3Q6MA 4DAEA 3BL5A 1ODSA 4D2IA 4RIHA 3V8NA 4IKEA 3N39C 3Q3HA 4O5AA 4RFVA 1UBNA 4PO3X 1VIMA 1QZUA 2DHQA 2YIJA 1FJGB 5IZCA 1Z82A 3MMSA 3N86A 3OWOA 1I2AA 3BUSA 4IG4A 4CQJA 4EKNB 1JTVA 3K1YA 5IFKA 5KWEA 4LXGA 1WBBA 2PBRA 5AVZA 4EGCB 3DC7A 4TT8A 1X9IA 3A6GA 4WCFC 3TLAA 1P1CA 4F4IA 2HNBA 3IAUA 2WZQA 2HHCA 4GPTA 4BFYA 3A04A 5DTRA 4TTRA 2NTJA 3IQWA 4O4IB 4G85A 1U8YA 2FSFA 3BJEA 2JVKA 3QEOA 3QXSA 3HXOA 2GR9A 4U2DA 5B4TA 2XY4A 1YQUA 3LZCA 2BGRA 3QUQA 3QYPA 4HR7A 4N12A 3AJ8A 1KPIA 3GK3A 4DUGA 1EG7A 2H4WA 1ZHFA 2EIHA 3NOXA 1CUEA 1JIJA 4CM1A 1Z45A 3TSYA 3WMWA 1L5ZA 2E2WA 1VECA 3H13A 1RRFA 3I6IA 4N9QA 3WNZA 4BU1A 5EHZA 4E3WA 3CZRA 2AC2A 3WP1B 2YINC 4UMDA 1T9HA 2QVCA 2X0DA 4M87A 5FV4A 4U7GA 4UTVA 3MWDA 3DXFA 3SS7X 3G8BA 2BZSA 1KMQA 4YH1A 3RE1A 4U7DA 4XVCA 3PDIA 3RHFA 3ZJTA 5DX1A 1OLXA 1DEAA 4M8KA 3MWEA 5FBKA 5AUNB 1DIHA 3TW8B 3SC3A 1EH5A 3RSSA 4E2YA 2ZUUA 5B3LA 2FTKE 3S1SA 3II6X 4KXFB 3QPUA 5DHSA 3RSHA 4XSGA 3I9V1 4ZVVA 2O0MA 3KOMA 3WMGA 3WWZA 2OVFA 4F4HA 4DV6B 4XSHA 1EX1A 4OJQA 2AVDA 2HDOA 1DLIA 1DX6A 1X7YB 1WZUA 1YV9A 1OF1A 1SG0A 2H48A 5E0KB 1VE5A 4JOQA 1L4EA 1OZGA 4MR8A 1JZSA 3HA5A 1T36B 3KXKA 4BMVA 3EB9A 5L7WA 3T7EA 4I1PA 4PAGA 1V26A 2BFBB 4KR6A 1VGQA 2NP6A 1PT6A 3QVWA 4V24A 1AXGA 2XKBA 3H5LA 3KT0A 2XUQA 2PRKA 1BQEA 1H2AS 2DRIA 3HEMA 3LGSA 4YRQA 3KETA 5I48A 4ZVPA 5K0JA 1YR9A 2V7BA 5BVGA 3H7IA 4RY8A 5ALYA 3PB3A 3QG1A 3ETNA 2QL7A 3WI7A 4URVR 2YKGA 1P0CA 3GUUA 1U8CB 3IUNA 4W1QA 2G63A 4MUJA 2YW2A 3SXPA 1W36C 3DE1X 2W6JA 5IJAA 5TGDA 3UYLA 4BWYA 1VRVA 3E9MA 5DM70 4Y67A 3A9VA 4O3FA 3WBBA 4EB6A 2ZJZA 1EZ1A 1FNMA 1H2WA 4U2BA 3ZUPA 5BOSA 2PO7A 2DQKA 1YZGA 1AMNA 4IOKA 3DTVA 4NEGA 4JZYA 4YXWA 1WUHS 2BN4A 1UBOS 3JVEA 4DGQA 3TI9A 3SQLA 2G5CA 3BRWA 4BX8A 3WLLA 1J22A 2V7EA 4JKOA 5HZGA 1TF5A 1I7PA 4HDKB 2G40A 2H52A 2ZB4A 1YE3A 5EXPA 4DJFC 1M1UA 1MA3A 1MB9A 3FOFC 3KZVA 1P2DA 1BQ3A 2MYPA 2X8JA 4Q3AA 3GJ6A 4AN1A 3GVCA 2Q0HA 3UMMA 3M82A 5TY0A 3DD5A 3HE3A 3HJRA 4ZC1A 3V1TC 2YYSA 2G1JA 3IDAA 5G41A 3R0QA 4EZIA 1DIBA 1X14A 3DKKA 4EI9A 1E4OA 1QHGA 2VT7A 2R68A 3V8QA 5ES4B 3NUQA 5EJGA 8ADHA 4L6CA 2GS9A 4S0ZA 2W00A 4B7ZA 1QU2A 1PT8A 1OX6A 3EQ8A 3UHJA 5CFZA 1T6YA 2CEAA 1LK0A 3F9CA 2RGXA 4AZ0A 4QTYA 1JLLB 1I3NA 2UXBB 2OCBA 5DULA 1Z0UA 4A1OA 4UASA 1G1AA 3V4SA 4JBXA 2VYCA 3FXAA 5K2OA 1XMSA 5H3LA 3ABIA 4A0QA 1LPNA 2CWDA 1LJUA 1PR5A 1U8FO 2W2QA 3GY0A 1GLNA 3D2CA 5GY7A 2I7CA 2DP4E 3I9KA 4PS0A 5E4FA 3UWSA 2BFFB 1XTJA 1A5AB 3WNQA 4LZLA 4BNLA 2JJYA 4MK4A 5EE3A 1N2OA 3N0XA 4X1YA 4ZCPA 2KWIA 4MWTA 4KPYA 1LNSA 1W5AA 1Z4QA 2PUDA 4AJLA 3LUDA 5HTKA 3D3JA 5AJUA 3GPIA 2FDRA 4GI1A 3K6SB 4BX9A 1PO7A 3RVPA 1N1GA 2W70A 1GUZA 2YN2A 2GZAA 1Y4UA 1MT0A 4UU8A 4ZK2A 1KSFX 2OV3A 2BM8A 1K7SN 5C37A 2QQEA 1EXMA 2B61A 2J1LA 2Q4RA 3KYCA 5LFAA 4YHHB 1H1LA 3VMMA 1N9ZA 1VKHA 1Y9AA 2BMVA 2NO4A 3OC6A 4HRVA 3N58A 4ME6A 3RVDA 3VOAA 5BQ3A 2VUIB 5J4YA 5CYFA 3AWIA 5IAJA 1ESZA 4EYQA 5KTPA 1YHNA 5E0OA 2RC6A 3SIRA 4MTCA 4TV8F 5D7NA 5DT2A 8OHMA 4GGOA 3B3AA 4E08A 1B23P 2H7VA 3P19A 3ZN2A 2H6EA 1JH9A 4GDFA 4QBFA 4FD2A 4IQ4A 1UMBB 1PU2A 2C20A 4NBVA 3C4QA 1B8OA 2XNDA 3VV2A 3OLCX 4OAOA 4D56A 4EH1A 1RWVA 1L8OA 1WG8A 2OECA 3NBYC 3NTQA 4R16A 4XIYA 4BWFB 2VSYA 1KL7A 2P0AA 4E0BA 2P3LA 5DPMA 1IN5A 3Q3JB 1B14A 1KIMA 3U6BA 4Y1RB 3QKSB 1N2ZA 3HVHA 4O25A 4MKGA 1GARA 2B3TA 3B9BA 3MS7A 4MINA 2FPKA 1Z5GA 2XBUA 3W04A 3WHPA 3KUCA 1VSBA 3INGA 1IY8A 1TA9A 1M34E 3TPZA 2X2OA 1TIBA 2XWSA 3AR9A 3B1FA 4KFSA 4KFTA 1BW9B 2H00A 1GU7A 4JDPA 4LOAA 1GA6A 3HRKA 1AUPA 1T26A 4ZU6X 3G5TA 1QFXA 1W5SA 4MICA 1EUQA 3W5AA 3M9LA 1SCBA 4QOSA 5M04A 3BA6A 3PD1A 5H3CA 2JZOA 4OMCA 3SGLA 4NARA 1QGED 5JEDA 4X97A 5TIIA 3NUZA 3QUTA 2FQ1A 5IM4F 3G8YA 3IDOA 3P32A 1JVNA 1QF6A 2HQSA 2XSZD 3OWXA 3IAFA 3Q9NA 2GAOA 1DC7A 3RKSA 4BEVA 1QYXA 2DBRA 2QRLA 2G25A 2ZIZA 3ZLJA 1DBRA 1WHSB 1U90A 4H6VA 3ANLA 4MVJG 5EOVA 3TW0A 1VJ5A 2W93A 3QKIA 3TW8A 3HDJA 4NATA 4B2PA 5BUZA 1TLFA 5GADl 4KTTE 5ULLA 1V25A 2C1ZA 1HDCA 3DOJA 3MMNA 1UBRS 4HH0A 2C2KA 2AOWA 2ZI5A 4LJ9A 1E4EA 1T2DA 4MQ4A 2Y0DA 3T8YA 2GBIA 5T41A 2JNWA 2NUTB 1FUIA 4HI0E 3HN2A 4ZYYA 1R15A 3EGWA 3PLNA 2Q7XA 2WD8A 4M0FA 2OM6A 4K9KA 5KPDA 3LW8A 1H5NA 4D8VA 4D7AA 2ACKA 4FWIB 3R9KA 2AKEA 3KE9A 1DBSA 1WLSA 1CUVA 3AINA 3FMOB 4HLCA 3SQWA 1EXVA 2EX1A 2GBCA 3WHLA 4BS9A 4DMRA 3F74A 2OFPA 3HO1A 2RAFA 2F1JA 3L7NA 5D85A 5FWNA 1JSRA 5C5DA 1KVRA 2BMFA 2Q1YA 1T29A 4MRSA 2MSWA 1XDDA 5EGSA 2OBXA 5JWHA 3ZU2A 4G36A 3QEBZ 1OTXA 4HB3A 3B9RA 4LYGA 2XOXA 5ALXA 4JEUA 3RI3A 5A9RA 4NBWA 2ZJ6A 3TCKA 3WS7A 4X71A 1PEKE 2C57A 2Q9AA 2VDUE 4AJKA 3ZV5A 3H9UA 1RJDA 1L7RA 2A84A 2GZ1A 1TCVA 3HKCB 1GAXA 3W5BA 1JHMA 4XWAA 5CVCA 5F5NA 4JI5B 4C78A 5AHKA 1LBEA 2QYSA 3TDNA 2ACWA 2Z6QA 6ADHA 3GRCA 4EABA 1DX9A 4CHTA 4D6PA 5BV8A 1FLNA 4QG3A 6REQB 3EZ9A 3HR7A 1A77A 4FW8A 2YHBA 4A6EA 3OQNA 4LXHA 3QV2A 4DJ5X 4N47A 1L1RA 2BDEA 1RYDA 1E2MA 2A6PA 2XGMA 2PKXA 5CTJA 3C6KA 3UO8B 3IHLA 3BRCA 3JXEA 2CLLB 5I5GA 1F0NA 3ZXSA 1TTQB 2IELA 3QE0A 5IKOA 1UPBA 3AKEA 2REQA 4X1OA 2J3HA 1HT2E 4QGGA 2JASA 3H1TA 3S5UA 1M5TA 2F3UA 1PS8A 1C4WA 5FTWA 2EFEB 2OESA 4HCJA 4TROA 3GJ8A 1WAMA 1B0AA 3DMRA 1R1DA 2P30A 4CHGA 3HBMA 9ABPA 3NM4A 3D59A 3VHXB 5KYWB 3FVVA 3K9HA 2M1XA 3S55A 1Z28A 2HWYA 2IZ7A 4L76A 1INLA 4PVDA 3SS8A 4ZQBA 3NPAA 5BMVB 2FI1A 2PWPA 4PPGA 2JJ2D 1MOPA 2I55A 2JL1A 3NWJA 3OEHA 1MB3A 3W5VA 3RYCB 4HVCA 3V3TA 4FJ2A 1IATA 2XTJA 5J1SB 4FJ0A 4W8HA 4F6LA 3E70C 3EQ9A 4V2IA 2O07A 3EZLA 3EDCA 4AB1A 1ML4A 2OHOA 3VJRA 3F6RA 4ZP1A 3QF7A 3DCIA 1XXHA 1FJHA 5J4LA 4MGKR 4NBSA 3DOEA 1KJNA 1SN7A 2SNIE 3I6YA 3MWLA 3NRJA 4IXTA 3GCWA 4NFLA 3GLVA 1U1EA 3WAGA 2C8VA 4L95C 1NE2A 2AEFA 2ZDHA 2HV8A 3OM1A 4H35A 1KYXA 2C4MA 3K1AA 4J76A 1R37A 2HH9A 2RK6A 1HZZC 3IJEB 3FPJA 4PSDA 5DGCA 5F4BA 5J5AA 2QW1A 1Q21A 1XEXA 3CZPA 3SF8B 4F3KA 2VTKA 3HEAA 3W79A 5C18A 4YT8A 2Z2YA 1GM5A 2B7CA 1IN6A 1L6IA 3OPMA 1ADFA 4QULA 5ICFA 5ITSA 1Y7PA 4YJ2F 3ZWVA 5IJZA 4ZHQF 7AT1A 5EG5A 2B92A 1GR1A 3QLEA 2FPSA 4GMFA 5KWJA 2D1RA 2G1UA 5A5GA 4E88A 1CQWA 2ZJ7A 4RDHA 1TQ8A 2AG0A 2I2AA 2OXRA 2PZGA 1N4AA 1KRWA 2OZPA 1WO8A 3ID6C 4IDBA 2WUEA 4Q4DA 4RQBA 1J2RA 1HTTA 4DMMA 4DLAA 1GGHA 2ID4A 3LPLA 2BI8A 4UU0A 3T9DA 4B4VA 5CPBA 3UB3A 1CQXA 3IL2A 3JZMA 3O91A 4N18A 5KTYA 3B1ZA 1PJBA 4WZZA 4Y2HA 3RJZA 3EXAA 2A59A 3TOCA 2FPOA 2NNWB 3L79A 4HB4A 4U2EA 3F5DA 4WK2B 1ZA1A 2NX2A 4OOEA 3M7IA 3WXMA 2GHRA 5IPFA 4GQIA 4EY3A 4BNTA 1OWPA 2J45A 2VTDA 3UJNA 4RTOA 3IUPA 2AFIB 2JEZA 2PJUA 3K5HA 2HBZA 1DQYA 1R5JA 2E4UA 3PEEA 2QGNA 4G4SP 1WP9A 3PXEA 5I9LA 3P9QA 4LJRA 2XBMA 1ZVMA 3COZA 3NWOA 3QEMA 2GVDC 3CB2A 4YUWA 1FMFA 3MHPA 4JLVA 4WDQA 1IZ9A 1IH8A 5JZBA 1Z5ZA 4QDZA 4OHFA 1HWYA 3QIAA 1ZNWA 1Z29A 1ZOIA 4R8KA 2EX4A 4QRHA 4E11A 4FB5A 3MMXA 5LA6A 1J2TA 3K94A 4IP0A 3SR3A 1C8KA 4RESA 2CSXA 3UB4A 1YUBA 1OXTA 1VMAA 1OQAA 2CXRA 3BTVA 1BAPA 1O9BA 1Z2CA 4INJA 2YN4A 3PPIA 4MVJH 1SHZA 3OQHA 2C5HA 4OQFA 4BNXA 2ZIFA 4P7JA 1PW5A 3U2QA 1O0BA 4FN4A 3U1VA 1KJIA 4B0PA 4N6GA 2ZVQX 5JYDA 3OJFA 1ZN9A 2Z3ZA 3CVOA 2GQ0A 4KRYA 4DBZA 4O4HB 4M46A 5J2UF 4ZZ2A 4KXMA 3J81k 5FPPA 1V8DA 4DG8A 4QG7A 1O8CA 4FUTA 5JRJA 4H6WA 1T34A 3R8XA 3U3ZA 3M6FA 4JUDX 4ID3A 5FNVA 1E92A 4B44A 5ENZA 1E32A 3HNPA 1ADGA 2ZU6A 5F76A 3W77A 3EDQA 3JATB 3WHKA 4B3HA 5A4FS 3VR2D 2ZWVA 1E2LA 4QEZA 3EISA 1ZW6A 1OKKD