2A5LA

The crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
196
structure length
171
Chain Sequence
SPYILVLYYSRHGATAEMARQIARGVEQGGFEARVRTVPAVSTALYATLEDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQLSMLLPLLHHGMLVLGIPYTPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trp repressor binding protein WrbA
publication title The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 55
structure length 171
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a5lA00
2FAXA 1OBOA 1AKVA 1XYYA 3W77A 3UXEA 2W5UA 5LMCA 1C7FA 1WSBA 1CZUA 1FLNA 3LCMA 3GFSA 3B6MA 4FX2A 4ZVNA 1FLVA 2ARKA 1F4PA 3NFRA 4C14A 3O2NA 4U7GA 3K20A 4QOHA 4XDHA 3NHLA 3JSXA 1J9EA 4CF6A 3ESXA 1J9ZA 2V5UA 1T5BA 1RCFA 1E5DA 1KBOA 1AG9A 2R96A 3KAPA 2HPVA 1VMEA 1X77A 2BPOA 3OX3A 1AMOA 2QX9A 4YALA 2FLVA 1ZX1A 2M6SA 4ZVKA 2MT9A 3L9XA 1DX9A 1FX1A 3U7IA 3NHWA 3R6WA 3K1YA 4ICIA 1D03A 2QX4A 1RLIA 3EYWA 1KBQA 4DIKA 3NLLA 2QMYA 3ES9A 1AKUA 3NHYA 3SVLA 3QFCA 2FZVA 1YKGA 2OHHA 3RPEA 4C76A 1XI2A 4BMPB 1DXOA 2FX2A 5NLLA 4PTZA 2BZSA 5EAIA 4ZVMA 3UXHA 1CZKA 1FTGA 2XOEA 3TE7A 2N1MA 4LTNA 2Q62A 3W78A 2BMVA 5B3LA 3HLYA 1C7EA 4YQEA 2B3DA 3F2VA 1OFVA 1TLLA 5F12A 4N82A 1DXQA 3B6IA 2BN4A 3NHRA 2HNBA 3F6RA 5FX2A 6NULA 1QRDA 5F51A 1H69A 2Z98A 1TIKA 1JA0A 2KLBA 1AKRA 4QOEA 1J9GA 2BF4A 3ESZA 1QBGA 2QMZA 4D02A 1D4AA 4YAOA 3NHPA 2V5VA 1FLAA 3HR4A 3GFQA 1CZNA 1D04A 2F1OA 1AKWA 4GI5A 3GAMA 4ZVLA 2OHJA 3TEMA 4LA4A 4BMOB 4S24A 3ZHOA 1V4BA 3OWXA 4CETA 1T0IA 4H6PA 1H66A 5NULA 2R97A 5LVAA 4M0CA 2OYSA 4YAUA 2FDXA 5FA6A 4QOJA 3S2YA 5A4KA 3OX2A 4QOFA 3G5MA 1BVYF 3FNIA 1YCHA 2KQUA 4OXXA 1GG5A 4Y9RA 4LTMA 2MTBA 4XDGA 3TZBA 3EDOA 1CZHA 3FW1A 4FGJA 5LJLA 4H2DA 1XT6A 1BU5A 1OBVA 1B1CA 1YCFA 1CZLA 2HNAA 4HEQA 1RLJA 3KEGA 3P0RA 2FVXA 3U7RA 1XYVA 4LAFA 1CZRA 4J8PA 2FZ5A 4YAFA 4QOGA 3NHKA 3D7NA 1CZOA 2Z9DA 4FGLA 3W79A 4GQIA 2QX8A 4Y9UA 5B3KA 1YRHA 5LBTA 4ESEA 1QHEA 3B6KA 4PTYA 3FVWA 1YDGA 3LT5A 1SG0A 2X2PA 3F90A 5TGZA 1YOBA 2XODA 2WC1A 4QODA 4R81A 2D5IA 2OHIA 2A5LA 4NLLA 4DILA 5JROA 5F4BA 1AHNA 4YAWA 5FUQA 4LTDA 4N65A 4Y7CA 4QOIA 1I1OA 5BUCA 1RTTA 4N9QA 3OWHA 1FVXA 1SQSA 4F8YA 3B6JA 3NHFA 2RG1A 3O73A 1QR2A 2QR2A 5LLDA 1AZLA 2M6RA 3N3AC 4U7HA 2GSWA 1JA1A 1ZWLA 2Z9BA 4GR9A 3F6SA 2Q9UA 3GFRA 5LBUA 3OX1A 3NHJA 3OVMA 3KLBA 4FGKA 2FOXA 1AKTA 5LJIA 4NULA 3QFRA 2Z9CA 2AMJA 2MWMA 3HA2A 3N39C 2ZKIA 3OJXA 3FX2A 2QX6A 1NNI1 3QE2A 1FUEA 5EA2A 3OJWA 2QWXA 1YCGA 3KAQA 2X2OA 4PU0A 3L9WA 5ULLA 1J8QA 4U7FA 3NHUA 2V9CA 4C0XA 3NHSA 4C0WA 4DY4A 2MOKA 3N3BC 3W7AA 3ESYA 4HS4A 3FJOA 1WSWA 1FLDA 2FCRA 1ZWKA 1AKQA 5EMNA
chains in the Genus database with same CATH superfamily
1VSBA 4JWKA 4X84A 1GPH1 2WDZA 2GASA 5H9VA 2O5CA 2ZREA 1FL9A 1AKVA 3G23A 1KXJA 1Y7HA 3VOAA 1PJ4A 1HO3A 3L0CA 1AVTA 3HY4A 4L6CA 4FFBB 3GG9A 1CG6A 2Q4DA 5FBWB 5BP7A 1F06A 1EK6A 3AJDA 2FRDC 2NO6A 1JQJC 3ZGNA 3HUFA 4RAQA 1AV6A 1QIMA 2C1XA 1XHFA 2WUGA 1SC9A 3H2JA 5AJUA 3DTVD 3QEJA 4IGEA 4JVSB 4AB1A 2WU0A 3O8DA 2EFGA 2Z4TA 3H84A 3T3HA 3MFQA 2ZYSA 4RK5A 3PQ2A 1SC3A 4RKFA 4ATNA 3TRFA 2GT1A 5EL0A 1Q77A 3W2HA 1KDTA 4LBVA 4M7RA 1Y6QA 3C5WP 4NFHA 4XCQA 1KYVA 3L1VA 2JVIA 3OUTA 2P78A 4Y1RA 5GOZA 3FIJA 3KQSA 3FSGA 5DRYA 1RBQA 1KIMA 3H9QA 4G26A 2B7BA 1DCFA 4GSLA 1W5EA 2Q0HA 2O1EA 3M9XA 3KYCB 2RG7A 1AUVA 1DHTA 1O9GA 2RI6A 3E4CA 2W2NA 3HYNA 5KYGA 4TTRA 4JEIA 5A0VA 1HK7A 2PXAA 2YFQA 1JAYA 2EJVA 2VZ8A 4QTYA 1L3CA 3NS7A 1KMQA 1NXSA 3ZV7A 4CT0A 4ROSA 1G3IA 4FZVA 1JLLA 1ZI9A 1QC5A 3BEOA 3OMXA 3RIXA 1YHZA 1M0SA 4CF3A 3EYAA 1A7KA 4YCNA 2YJGA 3FTQA 3MF4A 3TW4A 3D7SA 3PXAA 4DR1B 2BHNA 1XU9A 4TTAA 3UT5B 5AVSA 3NU1A 2XCRB 1GNPA 3DD5A 1EUCB 3FBGA 2ZBFA 2O0HA 5JWHA 5P21A 3VBEA 3WS7A 1U63A 3VR4A 2PZMA 1N6KA 2G83A 1W8DA 1I0LA 4L5YA 4E32A 1KJ8A 5B1YA 1WW2A 2B4KA 2PZJA 2R4QA 3LUAA 1O0SA 3T5CA 4DLYA 1L7PA 2JIMA 4G8BA 4HDCA 4QICA 1JLSA 2NV0A 3E9RA 3JYHA 4LXQA 4ER3A 3DTVB 3KKEA 4OQMA 4Q7QA 3O8BA 3SR3A 4RFLA 1UWVA 3N0XA 2FLVA 2ZG6A 3IX7A 2ZU6A 3PNLA 3QU5A 1O94D 4WFQA 1KJWA 4BMXA 1GPNA 1HTBA 1HDZA 2D3WA 4QFCA 5KJ1A 2F55A 1FQKA 1K89A 3L7CA 4E2WA 1JPNA 1R9MA 3V4PB 4C6SA 5KU7A 2QT1A 5LB4A 4AJNA 3DZIA 4XB6B 4JLDA 5HIKA 3BILA 4RBNA 1H5UA 3AF0A 4M46A 4QPNA 5G41A 4NE7A 4BAZA 4U63A 4CUZA 4F6CA 2EKDA 2COUA 3CQ9A 3DB1A 3KR0A 1EFPB 1YZQA 4NEHB 3D2CA 4B47A 3E1SA 3EDQA 5TT0A 5I4KA 4DV7B 1Z0UA 1Q7TA 2OG1A 1KL7A 3EEFA 1ZSYA 4N5MA 4D8TA 4EEKA 4F85A 5K3FB 3PQFA 2ZLBA 2CNDA 2NM0A 3WJ7A 3T8YA 1DZ3A 3NHYA 1SOVA 4GO1A 2IOYA 4JMPA 2BTEA 1A7AA 4BB5A 1UJBA 5KWJA 1I94B 3LI2A 1H5QA 4BTVA 3A27A 3WQBA 5KOHB 1E6KA 1N2IA 4UVHA 2GBPA 2II6A 1QK3A 3CX7A 5NLLA 3LTEA 5CIYA 1QV7A 2VWHA 4JA0A 1J21A 1BJKA 1C0EA 2Z4RA 3LT0A 3URMA 3WTBA 3ZOZA 2ZZNA 3BOSA 1INLA 1V16A 2B98A 3AKDA 4I1OA 5KOJB 5EXSA 4HDKA 5AICA 4BFLA 1J0AA 1E61A 4G0OA 1PEDA 1JJIA 2O3TA 3CR7A 4OH7A 2QTLA 5B3JC 2AG8A 2BUAA 3HBAA 2VJBA 1BDMA 2OZPA 2VA9A 2IZ5A 5GV8A 3DVAA 5AKKA 3L7MA 1KZ6A 1SQ6A 5B1IA 2Q62A 1YZGA 5CPFA 1JDZA 4LDJA 5BR8B 4HUQA 8MHTA 1RHMA 3PD1A 5LIPA 1P7CA 2TYSB 1NU8A 2X22A 5EIOA 1Q0SA 3GT3A 3THYA 1QHFA 1XTPA 4URVR 3QX3A 2C31A 5A6VA 5DW3A 3PV0A 5K8TA 4CGZA 1KNQA 2ASVA 1EFRA 2QUIA 4CM9D 1Q83A 2YRFA 4FBGA 4F3RA 5I7SA 1NBWB 1X7HA 1QLWA 3M9LA 1ZCAA 2HZ7A 3LWNA 2BHSA 4OKNA 1V37A 1TYBE 2PV0A 2OA0A 2C7OA 2BR3A 4IJQA 1O95A 3MINA 4LMBA 1RE0A 3RVRA 4BJ1A 1R0LA 2PY6A 1QF7A 1UH5A 1T8SA 2PZBA 1I10A 1DUVG 3MOSA 4MW7A 3T6KA 1KZ7B 2P4HX 2NU9B 3CG0A 4L57A 1GZSA 2VHQA 4LRQA 2ZR7A 3EK2A 1PNOA 1Y8QB 5AVQA 1HOXA 3CRMA 4KVZA 1L4FA 2Y1LA 4PVDA 2OZVA 4RHXA 4GBJA 5LYYA 5LWQA 1EGAA 1B8NA 2FMXA 3TOSA 4J3FA 4C3ZA 4N3CA 5CB6A 8ABPA 4AYTA 4K1XA 1TZJA 4A9AA 2P77A 1QVRA 3CIFA 3O47A 3STTA 4QUDA 3D6NB 1QBGA 3SKYA 3ZDZB 4EW2A 2LKDA 1A8HA 2H54A 2G0AA 3GDHA 2AH5A 2PRYA 3I39X 3W6PA 4TLAA 4NCJA 3LMKA 4RZIA 2FZKA 4HBZA 2VJLA 2UXCB 4KO4S 4ZZ0A 1DBQA 4NDAA 3RYFA 3E5HA 2ZQ5A 5C8YB 2G8LA 2Q5IA 1RWNA 2FEXA 1BYIA 2AJBA 2I67A 2P9EA 1X2EA 3H05A 3DWIA 1XTSA 3LO8A 2V7XA 1N6OA 3BK7A 1P8AA 2RGCA 3NT5A 4I8DA 1V1RA 3EF0A 4N8EA 1IYZA 3SXJA 4A6EA 2IDMA 4GRAA 3VR2A 3V33A 4A23A 2VO1A 3UB4A 1RXVA 5ALSA 2R8RA 4RETA 2DGDA 5LQAA 5A5GA 3I4LA 1G8HA 2BEWB 1OIXA 2F6RA 4ZGWA 1JIVA 3NWOA 4MIOA 1Z4NA 2C84A 3F7TA 3D6FA 4MS3A 5EEHA 4HMQA 4ZAFA 5K0BA 3HYRA 5K3EA 1R27A 2EFCB 3AY6A 3HADA 3QLUA 1PJZA 1PR0A 2GDZA 4M99A 4CRWB 3AEYA 4Q47A 3B1FA 1D0VA 1J39A 5K6TA 5DHQA 2QP3A 4G37A 1S0UA 1Y8RA 3CA8A 2IUSA 3JWEA 3PHLA 5F1OA 1B93A 3IBSA 1AU9A 4YJ2F 3CU5A 3IKJA 1ZMBA 2RGAA 3DGEC 3FDJA 3PUHA 3DHVA 1NOKA 1O54A 1J24A 4EJ0A 4JC8A 4P7BA 3SVTA 1SOMA 2GJ8A 2GCGA 4A8JC 1HY3A 4MRPA 4B0PA 2CSUA 3CT4A 2LDXA 3BKXA 4NKRA 1QORA 2XX3A 3H8WA 2WHPA 3O4HA 4N6GA 1TEXA 2G1AA 1R3DA 1CB0A 2O7QA 2FQQA 2AFHB 5KU1A 1NXWA 4MVJH 1LPNA 5I7OA 1QGOA 3UY4A 2R4TA 2X0DA 7AT1A 4QWMA 2MTBA 3KHTA 4H77A 4EATA 2CHUA 2FWIA 1P7WA 1J99A 4EKGA 1V9SA 4Z9YA 1MX9A 3VSBA 4QQNA 1EK0A 3HEAA 1KWKA 4FGJA 1JTEA 1RJFA 3OPVA 3DDCA 4LV6A 4MVWA 4RX1A 1UKAA 1F2VA 1KRHA 1B73A 3HP7A 1D8TA 4FS3A 4OHXA 2MSEB 4JLVA 1R1DA 4PYIA 3DNPA 3HU5A 2WJ4A 4PVCA 3HTXA 1YCFA 1B1CA 2YVLA 2HNAA 2VNHA 3LHDA 3SQXA 1R0CA 5I7UA 2YZ2A 1TEHA 4B3FX 1W36D 4FOOA 3ZI7A 1ONNA 2ORYA 4X66B 2LXNA 3P0RA 4WK2B 5DGDA 2PTGA 3ZZ0A 2CMKA 3AHEA 5PNTA 5BWMA 2ZRNA 2IXTA 3H99A 1J56A 4GPAA 4GVXA 3TI9A 1KMNA 4DMUB 4YK7A 4HGNA 2FQWA 3DCJA 4GUAA 4B81A 4Q3LA 2RB4A 1QGYA 3V4LA 3RT9A 3CF2A 3EXAA 4K6FA 4QBFA 3D4IA 4BRWA 1NTOA 4L9RA 3THXA 3HJCA 1DAFA 4AN0A 3NTQA 1SQGA 3ZLUA 4LJKA 1YL6A 1MAUA 3KBBA 4G4GA 3PPWA 1LK7A 4ID9A 4IQ8A 4RY9A 1G1MA 3TRHA 3V46A 1JN0A 3PUZA 1N6IA 1DKOA 5ILQA 3R7DA 5H81A 4D6PA 4HPXB 4D4MA 1M6WA 4R7TA 3SQOA 2H4JA 4MHTA 2QD3A 2FWPA 1CY6A 4WLEA 1UJ2A 5AFSA 1NA5A 1XZJA 2FQXA 1C2YA 4R3UC 3ONDA 3WXMA 2CV2A 2A9PA 2X4IA 3VUFA 4C0LA 1K8RA 2P8SA 4NNJA 3SEQA 1TD9A 3R0XA 4ZZ3A 1ND6A 2R47A 4K9RA 1ZW6A 4R2WA 1XDZA 3GDGA 5CYOA 4EW1A 3E3NA 3BIFA 2W6ZA 3FI9A 1C80A 3A4NA 3K9BA 2HHAA 3G13A 4M76B 1Z5ZA 3QEAZ 4GQAA 4DSOA 1QJCA 2R6ZA 1ISSA 2DTXA 3TLBA 5BW4A 1BN7A 4P4SB 4YJFB 2PKCA 1F0KA 1KQ3A 1QRAA 4RJIA 3ZE7A 2H0QA 3N87A 4N5HX 1M34E 4P4NA 4YQYA 2FSFA 1T35A 1ZGCA 2DBZA 4WLOA 2PMFA 2NAPA 3AH8A 4NS1A 1W36B 4OHUA 3PPYA 1JTFA 3SSMA 2V55B 3BEDA 4MRRA 1CF9A 1WXFA 3QG1A 4MQFB 4NOKA 1XFAA 5IVHA 3OZIA 1E1KA 1UF9A 3BFJA 5IEJA 4HB2A 4MB2A 4ETWA 4NZYA 2NPFA 3R5SA 1ZNWA 2XODA 4KQCA 4YJ3F 2XYVA 2P1DA 1WSDA 2PKQO 3OA2A 2FPLA 3VPSA 5FTLA 4QRDA 1XELA 2VLIA 4P34A 4YRAA 5CXUA 4MTLA 4GZ3A 4K8OA 1TA9A 2H8KA 5CAEB 5JROA 5JXGA 4Y6SA 2NO7A 3GEIA 4EUFA 5LYJA 1YMUA 2I1VB 3HFJA 3DKPA 5CW1A 3NBZC 1N6HA 1Q1QA 1K8QA 2HA0A 4MLDA 1ZQ9A 5FBVB 3WNVA 1AQNA 1QIEA 1FMCA 2I4LA 1NBMA 5DV9A 5J5CA 4FI3C 2YNMA 3PNPA 1OXVA 4ZXPA 3HA5A 4FW8A 5IZ4A 2H1LA 3GIDA 1HA3A 1VXRA 4WJZA 2YV5A 1RFLA 4J4TA 1PHRA 2F59A 3P5SA 4R69A 1I1OA 1M74A 4UDOA 5EE0A 1LF5A 2XGGA 3ZYCA 2IJGX 2P4QA 3HKDA 3MGCA 1FFCA 3Q0IA 1LF0A 1ZOSA 3A1NA 1X13A 1X1EA 2BI8A 5EINA 1SEPA 4BMCA 3AM5A 1QDEA 3FYUA 1VCNA 3II6X 2A0YA 2KS6A 2RBGA 3LVBA 4RTQA 3B78A 4ZFNA 3QBDA 4KXUA 4AKEA 2VUHB 3CIOA 4HWRA 3PNMA 4RHUA 1OR8A 5G3ZA 1LPSA 1NVBA 5LQSA 3TZHA 3RGWS 4KH1A 2EX4A 1D5WA 4J2TA 3T5DA 2XZLA 4C30A 3AZQA 3WJ1A 3IUEA 3WQQA 4D9JA 4F04A 1E4VA 2BLNA 5BV8A 1W85A 5BQ5A 4HZUB 3DLAA 3T12A 5DMXA 3HXOA 1Y5MA 1HGXA 2XUGA 4WUTA 5CK5A 2WTAA 3TQTA 4QAJA 1NXXA 1E4YA 1QR2A 2QW0X 1T8UA 4K9MA 2XE8A 3QHQA 4ZZ1A 3WNCA 3RVQA 5JAPA 3LXUX 1RAHA 3OF3A 3RSLA 4AKIA 1ST2A 2ECOA 4HFRA 1JG4A 5FWXB 4L28A 5BUZA 3FKQA 4DR7B 5F3RA 5FWDA 4GM1A 5K0JA 5A03A 1XFDA 3E82A 4R1MA 1D2AA 3WGVA 3Q10A 2R44A 2P2GA 3UMSA 3GRFA 3P9PA 4F2HA 1BVHA 3CWZA 3RW9A 1J0XO 3ID6C 1SBHA 5J59A 4ENRA 1VA5A 4HOYA 3GLFE 2QI9C 4C7XA 4L8YA 4AQ7A 2QBYB 4XYMA 2HF9A 3OOYA 2BISA 2HPHA 2ZSDA 4XYGA 5D51S 1Z16A 2IPLA 5EUQB 3B2NA 3TIFA 1FRVA 3A6FA 3EXEA 3FB4A 4HR7A 3VU1A 5K4GA 2Z9CA 4CXMA 2Y05A 3QBEA 4GKJB 2R68A 3MELA 2QLNA 4F91B 1ESMA 1LK0A 3BB1A 2ZJZA 3LCCA 1O95C 3ML1A 2V4UA 4JLBA 1DO2A 1P2GA 3GFGA 3MUFA 1QHSA 2PYIA 5HS4A 3U19A 3PEYA 4L3WA 2ZE6A 1XDDA 4IOJA 1LH0A 1YOVB 1Y5LA 1K66A 1ZJ5A 2V8OA 3H2KA 4OL0A 4NFLA 2JLSA 2HJGA 1LZKA 2G9QA 4RXTA 3HM9A 1YXMA 1T5LA 1CY0A 5TPWB 2HIHA 4PU0A 2AMVA 3ZGXA 1VL1A 3OHSX 5FT9A 4COOA 4MQMA 3ENNA 3TRKA 1J5EB 1RWMA 3GXBA 1SIWA 4MS4A 4XKJA 3HEBA 3U4DA 1Y1RA 4H6VA 3UJPA 5IXYA 1Q91A 2WJPA 2EEPA 3P9IA 4KBYA 3VDXA 2JNWA 5AUNB 5TR9A 2A6PA 4MS1A 2QN2A 5I45A 3IPRA 3GLHB 5B2ZA 2QRQA 3LP8A 4F5ZA 1QLJA 4NCNA 3I5UA 4DHEA 2PJDA 4L5IA 1PL7A 3Q98A 2HA3A 3RS0A 1N9KA 3ZCTA 1W2GA 5KNCA 3KP1A 1IVYA 1KZGB 4IWYA 4WOCA 5ANRB 1GGNA 4QARA 3ZBQA 4DCVA 5C52B 1QCYA 1W1UA 1P0MA 2B35A 3RAJA 2H85A 4DLVA 3SXUB 5JNRA 3DE7X 1EZZA 2EKZA 3PQEA 4PGFA 2P2LA 3FZEA 1IQPA 3GCZA 2GHIA 1G21E 1T4GA 2HXSA 1KKLA 4F86A 3HHPA 4D3YA 4EG3A 3IOYA 1GY8A 2HSDA 3T7IA 2F48A 3IPLA 4QE3A 5F2KA 2A5GA 4TXJA 2H5JA 3GVIA 4K05A 4PG7A 3GO4A 4DCMA 5D3MA 3AY3A 1L5KA 2QRZA 1RVV1 3C16C 5JQGA 1N5OX 1PKEA 4HDOB 1Z8NA 2DCMA 3KO8A 4Y6GB 3DOIA 2J41A 1IOLA 1HTWA 1NBAA 1R10A 1LBSA 2IEYA 3QLUC 5JZ9A 1RLMA 5EWLA 4YRPA 1UCFA 3QVMA 5A9SA 4MYSA 2NZJA 4C08A 4OI4A 4AO6A 2Q3JA 2H2WA 3C85A 4OB7A 4WE3A 5DLQC 3HJGA 1EE9A 4ZO7A 2YXNA 5C8VA 3MCVA 4W5JA 3OPQA 4DLAA 1E99A 1Z5WA 1A2KC 1LPBB 4CR7A 2C7RA 3PNQA 5K0TA 2NO1A 3GT0A 3WSVA 5KC9A 3C6MA 4KQKA 1YR8A 2NUBA 1RCFA 5JG7A 2LP4Y 3EMKA 1UOEA 5AVZA 1CJMA 4B44A 1E5DA 3LGAA 1SFRA 3OPXA 3U44B 2FUNB 4X1KA 3P2MA 4GLOA 4XARA 1BH2A 2ZTSA 1GRNA 3EMVA 5D84A 5KQMA 2VP3A 1KP2A 3RS8A 1EB8A 2GK3A 4J7UA 2P67A 2QT0A 3SHVA 1X77A 2MYPA 2GLUA 2ZAYA 2BPOA 4F38A 4D26A 1P0PA 4QYTA 2C61A 4LZLA 5KNLA 1W44A 2CXXA 4MDEA 2B6HA 2HKIA 4XI9A 3EPPA 1S6YA 2ZWIA 5E9JA 4Y0VA 2GUWA 2A7QA 3T3EA 4HGOA 4Q3CA 1ZX1A 4TT8A 5GINE 1QFJA 1UDAA 5ABPA 2B1IA 4DC0A 2BIFA 1WVGA 2JFVA 4GP6A 1WHTB 3E2PA 3TLGA 5JISA 2B4QA 1F4VA 4I99A 1P1HA 3U7IA 4ALNA 1TMOA 1D03A 1J8YF 4LJ5A 4BYGA 4PSKA 1KERA 2Y1KA 2H6EA 3W5SA 3HABA 3TECE 2EJCA 1VSTA 4DGSA 1EX9A 2VATA 2A8YA 4AIIA 2GYVA 1YQGA 5FTWA 4CEIB 4ZCRA 1H0KA 3AR2A 4CCWA 2PUDA 4JY7A 5IT5A 3GVXA 1A97A 2GNOA 1X9GA 1QK5A 1JBQA 1K6IA 3E9QA 2JH3A 3KJGA 1REQB 4BXOA 1T6NA 1I5OA 4BMPB 2KI5A 4LXHA 1FPQA 1YC2A 2IH4A 1C4WA 1O4WA 2KX7A 4OQ4A 4DGQA 5HM8A 4EY5A 1GAQA 3HY6A 2PS1A 3LL7A 4FXPA 4W82A 1PTJA 5CT4A 2W2LD 4YRTA 3IEMA 2V7VA 1CR1A 3T1YB 2QNRA 3P5BA 5EMLA 5F21A 2IE8A 1E2MA 1NV9A 2PIDA 3IUNA 5FKJA 1DV2A 1HYGA 3R3HA 4IVNA 1NP7A 1TUEA 3HSYA 2JEYA 3PGVA 4P3OA 3H5RA 1CY1A 4UZFA 4MWDA 5K3DA 4IGIA 4A1OA 5I9IA 1FP4A 3DLTA 3I53A 5C3MA 2B3DA 3QFFA 2GXUA 3QGMA 1NW7A 4KG7A 4QX6A 4P4LA 4WXYB 2R7AA 1E2UA 1UKBA 5E6RA 1Z5UA 3TQHA 3PPIA 4K2AA 3JQ8B 4E51A 3B8EA 5JZBA 3A9TA 1DG1G 3ZUPA 2HK6A 4IDCA 2HUPA 2RHTA 3FFWA 4LXXA 5B57C 5FLYA 3D2LA 4BY9E 2R0QC 4RVNA 1VE5A 3ROQA 3FOFC 3ZE0B 2CJWB 4HX9A 4AP5A 2NYUA 4YRZA 2HNBA 3F6RA 3IB3A 4EO4A 1N1DA 2JFUA 3BYZA 3K09A 5KTTA 1GUFA 1E8MA 4C7KA 5F9MA 3TUIC 3BS4A 2HT1A 1WU7A 5CURA 3V8RA 3A1WA 3MJVA 3RNOA 2YWBA 3CSSA 4RPGA 3ZWXA 3IAUA 5I6DA 5BT8A 1K5GA 4PRYA 1EVKA 4M36A 4KQFA 4L85A 5A02A 2CLLB 1R12A 2WZCA 4NI5A 3S1LA 5H16A 1NKVA 4TGLA 3GEMA 2AE2A 3ETDA 3NC0C 3COSA 4LIPD 1U8XX 4OU5A 3SKVA 2YNMC 3GVHA 3IEXA 3U9LA 4I46A 3ENVA 1NI3A 3HZHA 4L1KA 4IVRA 3JQEA 5CDGA 2ACVA 3T0GA 1WPRA 3AT1A 3AR4A 4LJ8A 1FTNA 2H18A 5H8WA 2ZWAA 3K2BA 1VPEA 4YDQA 3FG9A 2FW6A 3OQPA 4IJVA 6CHYA 2PU5A 5CDTA 1HR0B 3E7DA 1O08A 3FYUC 3I9JA 1YBFA 3PNVA 3WOVA 5C1DA 3CV3A 2PWAA 2JBHA 2F9LA 2WIAA 4OA8A 4PHTA 4YIKA 5D5QA 1Y3DE 1Y1QA 2OZLA 4WINA 1YU9A 5P8WA 3ND7A 1MNAA 4XIIA 1YS4A 4I9GA 4R05A 1BXRA 4Q3EA 1MEEA 2B4AA 1NNLA 2FG6C 2QORA 4YONB 2ZR9A 3O1JC 1N0HA 4HI0E 1ZMXA 1XG5A 4RTKA 4LA4A 3BL5A 1M1YB 3H2GA 3E84A 3UWPA 2ONCA 3VR6A 4XW2A 4DN6A 5JNWA 2W00A 1PQWA 5HFJA 2PEZA 2QP9X 1DX4A 2XB9A 3OI7A 1EDDA 4KQGA 4G07A 4LXGA 5JPDA 5JS7A 2CGEA 3FVVA 1XRPA 4RYDA 1O9BA 5KNDA 1QHHA 1V4BA 3U4QB 1M8FA 1TTPB 4FD2A 3QMPA 4EA6A 1VMKA 3TBHA 3V9AA 4HS9A 5EZSA 5ALUA 1YJAA 4HTFB 1TT7A 5JFOA 1P0QA 2DPLA 2XGMA 1LVUA 4QGBA 1JBKA 3TW8A 1L5RA 2JJ2A 3EISA 2FDXA 2ZPAA 1UQRA 1T91A 1X39A 3DOHA 4OUKX 4JLMA 3R40A 3GA5A 2PANA 2I76A 3PLRA 1P45A 1JEQB 1ZN9A 2EKBA 2G80A 1HORA 4MICA 4EY7A 3NDPA 4L74A 4MJ3A 1J2UA 2OV3A 4CG0A 1NJ1A 5AMXA 1FU4A 1URPA 2IIQA 3PUKA 4JFAA 4YQZA 1W0CA 2FQ1A 5ER6A 2I3BA 4J2HA 1NPYA 2D59A 4WL0A 3C5CA 2NYRA 4CM3A 4BN0A 2ZBRA 4BQIA 1POXA 3LLUA 4H4EA 4JL5A 2C92A 4JN6B 3H4IA 3P4UA 1BU8A 4LTMA 1XD2B 3ZHVA 3L7LA 4CM4B 2W98A 2O9JA 3TNFA 3TZBA 4KV9A 2F43B 1EJ6A 4B79A 5ARDA 3REQB 1G16A 2EL7A 2EBUA 2QM7A 5JECA 5JHHB 4JR2A 4UBKA 4WY5A 1NRXA 2AT1A 2JIBA 3ECAA 3QU9A 1A76A 1GKLA 1SZCA 4L0DA 1D3AA 2X15A 4B3SB 1VG8A 2GD1O 2JDIA 2RIRA 1K6MA 1E1RD 2MSDB 3MJ4A 5IHXA 1MEOA 5AI9A 4ZKEA 1NX9A 2UVQA 3O4GA 1ML4A 1D1TA 3KQMA 1Z6AA 3SC2A 5HUQA 5D8DA 2YTZA 1MX5A 2WG0A 4KFTA 1R37A 3KV3O 2B2XA 1J70A 3G2KA 1G2QA 1IRXA 1LBEA 5J5AA 4DNQA 3OZFA 5FQOA 1X1DA 2XQJA 4QJIA 3R7FA 1SPBS 3KQVA 4KPUA 1E3EA 4JLAA 4OHWA 2AN9A 4PSDA 4ZEOA 1Y6RA 1Q7RA 4AZTA 4BPBA 4E5YA 1CZRA 1NC1A 3D5EA 3WLPA 1ZUWA 2WHYA 1ZAKA 3RVNA 3SSOA 2YWJA 1RD4A 4NX2A 1IN1A 4C0SA 4CM5A 2VYQA 2A1TS 3INTA 3UJ9A 5HZMA 3W5BA 2BF7A 3EEOA 2BEVB 5JI3E 5CDSA 2Q41A 4AJPA 1GD1O 4OQFA 2HU5A 3KTOA 1U5CA 4IUBS 3GN1A 4LPKA 1YRQA 3N70A 2DECA 2RGUA 1LBTA 3G2NA 4IFTA 2ATEA 4DA0A 1Q0TA 1GYPA 2A0XA 1KOLA 4LXYA 2DE0X 3K0KA 2MSNA 3NDIA 3AERB 2BMWA 1LY1A 2RHJA 1VSUA 3UV3A 5JSKA 4JJ6A 1VM6A 2JGIA 1BO6A 2J3KA 3RS7A 4URHA 2Q3MA 4UU1A 4RKRA 2P9BA 5JNLA 4YT2A 4EVIA 1OAOA 1WTCA 4EQ6B 1VFPA 3OQOA 2YW9A 3VDQA 2XKKA 4R1SA 4FC6A 4G5YA 1EA5A 2XPCA 1X87A 2GK7A 1OROA 2YQZA 3FUVA 3GCGA 4GXTA 3SC4A 4MQLA 3VR5H 4BNNA 2OD2A 5BMVA 1SUFA 5IT9A 4MAAA 2YXBA 2R6DA 4L76A 2V7TA 4K6MA 3VM6A 2Z5LA 1GZ7A 1M0TA 3WLNA 2ZBEA 1XLTA 2Q1XA 3DKIA 2C98A 5AW6A 4KI0A 2QGFA 4ZI7A 2X2PA 1OU4A 3BD9A 3OCWA 4R40A 3T3OA 4O4JA 5H3CA 3EDCA 5K8CA 4XTRA 4JB0A 2BRUC 3IDOA 3NPAA 2VP4A 2RAFA 1QDUA 1FDRA 1VKNA 1X9IA 1WKBA 3OTGA 4NU0A 3H1BA 1NLZA 1T34A 2XUFA 5K3SA 4YFVA 4DIFA 1W0JA 2CNKA 1SVIA 5E1BA 2WTMA 3C74A 1OD6A 3NGLA 3O0DA 3O8OA 2CLDX 3G8YA 3L4BA 4GR5A 2YHSA 4M8NE 4LGCA 4EY3A 4I08A 3ITEA 1CJUC 3ROXA 4BLSA 3GLIB 3QVGB 2LIPA 1JIJA 1KJNA 1AKYA 4F2DA 2GEVA 1NU6A 2D1QA 3P2IA 3AEKA 4MKGA 1KYTA 1IDN1 2N47A 2VJNA 2BSXA 4M1KA 4Z9XA 4D82A 3WKCA 1VHLA 1UMCB 1LX7A 4O4LA 1MGPA 2DPYA 4F06A 1RMTA 3FJYA 3RNLA 5DM2A 4CTOA 1QFSA 4G5OA 2PBFA 5CIQA 3RROA 1AA9A 3OFVA 1XUOA 5I7VA 1B74A 2BI4A 4D4HA 1W1WA 4O8CA 1E18A 1LTHR 3OBBA 1JHDA 3P7MA 1K63A 3DR3A 3FYTA 1I4EB 1JJFA 3CEAA 1L9XA 1SQSA 2XNCA 3I9V1 3QPBA 5DXAA 4AZ0B 4ZDIA 2B4YA 1E6WA 1RRPA 4DB4A 5F7ZA 4OSOA 5JBNA 3S28A 2A9VA 4U9HS 4DNPA 1QXSA 4IUCS 5KAMA 1VCIA 2MMGA 3LP5A 3PQ5A 1E92A 3RSZA 5J2TB 2C9DA 1NF9A 2P0AA 3ANSA 5DH9A 2Q1SA 1VPDA 1G66A 4AG6A 3NIDB 4ENTA 4ZICA 4JX9A 5LP6F 3U61B 4YVFA 2ZSJA 3A9WA 1UC8A 2BFOA 4MW0A 4NOMA 4E33A 5ELMA 1AZLA 1PTJC 5AVXA 3T1OA 3A2NA 2Q9BA 3DFKA 4NNOA 1QS0A 3V4RA 1U11A 3EGCA 1RRGA 4OXKA 3GQBB 2UZ3A 4XEHA 4Y8VA 3G9UA 2DJIA 5DSZA 3T4UA 4GZ6A 1XMJA 1ZO8A 2J5RA 4LBZA 1DVRA 2IUTA 5A3JA 1X7YA 2RHGB 4B8WA 2AFHE 1PP4A 4MRSA 2ZTVA 1UM9A 3O2QB 4UUBA 1J42A 3WMEA 1UXKA 1VG0B 2B2NA 1TF5A 2R7KA 3MWGA 4BO1A 4CLOA 5L3SB 3OUUA 3NEAA 3WZMA 4JBXA 4WXEA 5FLEX 1C8KA 1EVZA 3O94A 1A8PA 3QEMB 1YRLA 3PYXA 4JP8A 3UYKA 1AKTA 4JLUA 3SJ7A 3H8VA 4FIZA 3NOVA 4AM8A 4BNVA 4I5FA 2HT6A 4LHYA 4N3GA 1VLMA 2D7CA 2FZGA 3DHYA 3NZEA 4UAGA 4X54A 5BW8A 4UE2A 1TKAA 2VDWA 2FEKA 3A25A 4NONA 5I8PA 3K09C 3ILHA 4JKIA 1OILA 1P8JA 4E1AA 3EXG2 3IBFA 2XXAB 3L01A 3D31A 1SU7A 2C4HA 3B5JA 3DNMA 4Q7KA 3GBVA 1OGJA 1K75A 2XCIA 3EW7A 2P9QA 3QF4A 4G8CA 4JWTA 3LLVA 4RD3A 1N4DA 3IP9A 2ZYHA 1I3NA 1G5HA 5DHPA 1PWXA 2YWRA 2ECKA 4NZOA 2R1ZA 5B7QA 5L95A 1EM6A 4TRJA 5CHYA 5D1NA 1SMKA 1H2YA 1DAHA 1NXTA 3A70A 4ZT6A 1UEXC 4MB6A 4JI5B 5JS6A 1PJRA 2GJSA 2PZEA 1QRUA 2GAOA 3LCJA 4AN4A 3K8QA 4G5GA 3WGUA 3DMPA 3LY7A 3RYCB 5FLXA 5BSRA 3O8CA 1IVSA 2MOKA 1WMFA 3AETB 5CLJA 3KB6A 2C59A 4D3FA 5CMLA 1V4VA 2D2IA 4QIHA 3B8HA 4NJMB 1PJCA 4AJIA 3QA3E 2ZIXB 3UJDA 3IHKA 4FLMA 4JU8A 3FVTA 4BQOA 1W94A 2X1HA 3ZZNA 3CF4G 1XYYA 4RKQA 5CXQA 5B2EA 4JGBA 4XB1A 4Y67A 1U02A 1IIRA 5AW0A 1NHGA 3MLEA 4LNHA 4R2MA 3THWA 1LJ8A 1WY5A 1GFZA 2IODA 2CKDA 2PX0A 1D9XA 4YO8A 1F4LA 1QZZA 1YIOA 2QOEA 4ZOQI 2O0MA 1NR7A 4PWZA 4YAKA 5C2JB 4KCGA 2N75A 2C4KA 3B6MA 2Q3BA 1IK6A 3SIWA 1IMOA 2QY9A 3PEVA 4WIAA 3IQHX 1YB7A 2ACEA 3MD9A 2IQIA 2Y9PB 2IDKA 2QJRA 1YRAA 4MUEA 3KZCA 4G5SA 2GOYA 4LY9A 4ZZ2A 3NEYA 3EPHA 4W7IA 1CWUA 3HPQA 1K4MA 3MWDA 4QOHA 1QE3A 1LLDA 1M33A 3TVTA 3L6RA 3PD7A 2IYQA 3NHZA 4H0CA 4KAXA 1L5WA 2ADOA 2GNAA 4DV0B 1F8XA 1WCYA 4RS3A 1ZFNA 2GM5A 5JO9A 3HP1A 5GJWC 4EEXA 5K45A 3LPAA 5KKCA 4BB6A 2GF9A 3KSDO 5ESDA 3ZE1B 1YR6A 4A2PA 3C24A 4RU1A 4FUQA 1ZM2A 4I4IA 2WVGA 2IP4A 2I6QA 3OM0A 1SUEA 4MI3A 1DC7A 3GDFA 5AVYA 1U3FA 1BXZA 4V0KA 2WSSD 3OY7A 4HK4A 2IV7A 3BSYA 3HB4X 1NC3A 3NYIA 3ETLA 4LNUA 2QUAA 4CUJA 5L3ZA 1JLKA 1U2PA 5EPOA 3IJ5A 3QEOA 4B45A 2J7PA 4NHOA 2YR0A 5JARA 3QXHA 1NUAA 4F6RA 3OCXA 1AGRA 1ZHOA 1HT0A 3O0TA 1I9GA 1MC4A 2J5KA 2NO4A 3CSUA 1VSVA 5T4HA 4RTRA 2IV3A 1E20A 5LD2B 2QUBA 1OIVA 1OWNA 2EW2A 4B83A 1JT9A 3VYVA 1D2CA 2VEOA 3JD3A 1P91A 3KDPA 1XMPA 3WZ2A 1D2HA 1FX1A 4JDPA 4NCHA 4TLLB 2YW2A 4YMWA 1Z4QA 4MWZA 5JTUA 3IUQA 5BYJA 3G7SA 1OJ7A 1VIMA 1NVTA 3HCEA 4X71A 4A0SA 1ULSA 1CHDA 1RLIA 2VSFA 1ZZEA 1UDBA 1P1JA 1CUDA 1DAOA 1QG0A 4ZCSA 3PL1A 2I3DA 1XIVA 3AONB 4QLAA 5AKZA 4J49A 2W22A 4MO2A 2J45A 5EVCA 4AY5A 5CA0F 2DU8A 3EVFA 4HNAB 1UR5A 2Y4NA 3ZJ4A 2VDNB 1PBNA 4DTCA 1IHUA 2FX2A 1C9DB 2H3EA 2R7MA 5FR2A 3I2IA 4C4SA 1J0BA 2HF7A 1VRWA 2PGIA 4FFBA 1FJHA 1ODSA 2FE1A 4L7VA 2G5CA 4FFDA 5EAIA 4BRSA 5AI5A 3C98A 3I9V6 1KFEB 3GN2A 5DF1A 2ZTUA 1ULUA 1OB5A 4G5QA 4HNGA 4J43A 3DKVA 3GYGA 4MZDA 4S05A 1U9ZA 2CXRA 2H08A 2MHCA 3HKBB 4QO7A 4ZU3A 4YP1A 4C9BA 1PJ2A 5CA0B 3AYZB 4ZYUA 5AQEA 5EJ6A 3WQHA 1Z45A 4NBSA 1QCCA 2CXSA 1OAOC 2N9UA 2VHJA 1VCMA 5IAKA 3OH8A 1U9CA 1E8DA 3ZLTA 1ZMRA 2Q50A 1BA3A 2G71A 1GTMA 2PT7A 3QMVA 3WNDA 5JLJA 9ATCA 3SSNA 2LBPA 1ZD3A 1XLTC 1WXHA 3H2BA 2ZW9A 3JWIA 2X7JA 1CQJB 3X3HA 2A9OA 2WPDD 3KYCA 1NZJA 3BCSA 4MR8B 4OTZA 4MW9A 3AVXA 2WWGA 2ZJ4A 1C0LA 4BU1A 3SHOA 4P3PA 5EHIA 1N34B 3CPHA 4LBWA 1ADJA 1H3FA 1HQCA 1U9JA 3R3ZA 1ZINA 2IUYA 4R98A 4KBGA 2YIJA 4GICA 5G1PA 3A6PC 2G25A 3WK5A 2G1KA 2RC5A 3GLHE 1P0IA 4UBIA 4B6QA 1QRDA 1T1SA 2X0NA 3NGXA 2W6MA 5FPYA 1KQPA 2QSJA 3L4BC 2Z95A 3PXDA 3I01M 1VRVA 4D3DA 3WP1B 3UT5A 3KEOA 4HXFB 3WLHA 4DLKA 1DADA 4TYNA 1X1TA 2BEJA 1FDSA 4L9AA 1G0OA 1EUCA 5AKLA 2RGWA 1RQNA 1TU4A 3CTMA 1JFFA 3Q6IA 4RK7A 2PK3A 3COVA 1M83A 2JBAB 4TV8A 3MQ2A 1TUBB 1WAMA 2E5WA 2ZJ7A 3L40A 3O1HB 4QOEA 1NQUA 4G8JA 1Y3AA 4RLFA 3CX8A 5KKAA 4DEXA 1TMGE 7REQB 3AP1A 1XWWA 4P33A 2B2CA 3OEWA 1FDVA 1AUOA 3DTVA 3DZ8A 4J7CA 5TRTA 1S7GA 4Q05A 1TEZA 3VRHA 1C4XA 4O2AB 5ERYA 3P20A 4FN5A 4ND1A 4QJ5A 3VU3A 3ZTTA 4G5XA 2RAVA 4BWVA 4EZEA 2KPOA 5DNEA 2H0RA 1MQ8B 3BULA 2R48A 1P18A 3HR4A 1JEYA 3U48A 4RM3A 2A57A 1GKKA 2OV6A 1A9RA 4ZTBA 4P9NA 1NXOA 2VXYA 1N25A 2ZT8A 5AJZA 3O4FA 1SUPA 5G4KB 2JVJA 1GITA 3SN6A 5K99A 3A7DA 1QE5A 4KO1S 1GKIA 1EFPA 5A4DA 3FLAA 1X8XA 4DA4A 2BW0A 3RTAA 3W9BA 3T7AA 4B6OA 4U7DA 3KWMA 5K3FA 1BQ3A 1QRTA 1NUPA 4ZVQA 1W52X 2F17A 3CNNA 2OBXA 4S24A 2XRFA 4WFIA 1GUAA 3RSGA 4N0QA 3V2HA 1ZN8A 3CBGA 3L0BA 1FMLA 4P3XA 2PXXA 4PAGA 3COPA 4LZPA 1UP4A 2ADFA 2H65A 3EIHA 3RJ5A 1VFNA 5ALZA 1QHXA 3I8SA 1V5EA 4I36A 1KAEA 4MPPA 3UUGA 4WGGA 1QTQA 1TW3A 2NADA 3BMNB 3VU9B 1H66A 3KL4A 4JS0A 1YVPA 4MKXA 3GGSA 1VQ1A 3VVMA 5KOJA 5LA6F 1NP3A 2HRRA 2I2DA 3IAFA 1ENYA 5B64A 1R3UA 4JBIA 4MV1A 5E8RA 5HX7A 1C5KA 1EUZA 5FWYB 4POOA 4BNLA 2I7CA 1CDOA 3G1WA 3SZLA 5A9RA 3ZTWA 1V7CA 4EM6A 5EQDA 5THKA 3UKDA 4DPMA 3RR2A 1JFSA 1U0JA 4MV3A 2BUBA 3GBPA 4KXFB 4EVRA 3U4GA 2WMOB 3UW3A 4MIKA 1B0ZA 1BRMA 4BNHA 2JGJA 3OX2A 4FYJA 3KYIB 3UBMA 2C82A 3EGDB 3W1VA 2RBKA 3HE3A 3M49A 1O94A 4MVXA 2QUHA 2WA1A 3S70A 2GZAA 1Z4LA 3OO0A 3GEPA 5DCUA 2ZJAA 3CVXA 3BREA 3IEPA 4RJJA 3C15C 3CXUA 3IV9A 2ZZMA 4OXYA 1IQUA 1RYDA 2ASEA 1TQ2A 1YNSA 5DGCA 4BVEA 1DFGA 2HREA 3CRRA 1AK9A 1TM3E 2FWJA 4OVKA 1I14A 4KSCA 4XOUA 5ILOA 3MYYA 1EP2B 5LJLA 5BWCA 1H8HD 1U0TA 1XT6A 5TXGA 3PXXA 2NU9A 2GYYA 4W5WA 4N5LA 2BEKA 1CCWA 2HYIC 1Y8QA 4OOFA 4TWRA 1XZCA 3QKSB 4FK8A 3GLGB 3D3WB 4JJ4A 4H7IA 2W6PA 5ERGB 4MK4A 3BMQB 1N6LA 3L6BA 1GQ2A 4IIJB 1GFWA 2FZLA 5FTKA 4CKXA 5HRAA 1XX6A 1Q19A 2QJOA 3A6EA 3L41A 4LQ4A 4E2ZA 2O8EB 1YAHA 1YGYA 3Q8WA 1FFBA 1P61B 1THMA 1U2TA 2J3IA 3PXBA 1A2BA 2G08A 4UFOA 1YVUA 4UTPA 5FEUA 5IFLA 5D5HA 3IA2A 1G6HA 3O3NB 2IK8A 2JD2A 1PSWA 4KFUA 1HETA 4JROA 3I61A 2FN3A 4LSZA 4ZEVA 2GHTA 1F9AA 1VYVA 2QL9A 5JCJD 1EWTA 2VRCA 1M2EA 1YU6A 1U7ZA 1KNXA 1T2AA 4YAFA 5KSOA 1QYRA 3LUKA 1MC1A 2OVFA 2PLWA 3MRXA 5JQWA 1U98A 1Z36A 3BK2A 5EHZA 3K1JA 1WCWA 1FNDA 1LRKA 3IQEA 4NG5A 3AVYA 2NOAA 1R0BA 4R7GA 4AZSA 3X2SA 4EX7A 3ENKA 4J76A 3KIPA 4X8OA 5C5EA 2C7PA 3W5JA 1W6RA 1A8QA 4OYYA 4L73A 3WLFA 3S2IA 4GQBA 3UMJA 3T1VA 3EVCA 3KWJA 4OBBA 2EERA 1DBIA 4GGOA 3B60A 4V38A 4WKBA 4DR6B 4Q39A 3X1JA 1BA2A 2BEWA 1PVDA 4PZ0A 1PGNA 1YA6A 4WACA 3BRSA 2JAXA 2R7NA 3LFTA 3P0HA 2WAMA 3AR9A 3DCIA 2A9JA 4NBWA 2GNPA 2XUZA 3L7OA 4NQZA 1CB7A 3BAZA 2VAVA 1MJGM 4HVCA 4X7BA 4DLUA 4INZA 1IPEA 3UICA 2QD2A 4YAGA 4BO3A 2HIGA 1A5BB 1YO6A 4G2TA 4P7KA 2I1LA 2I9PA 2HEIA 2JCXA 4FLEA 1UUFA 2A30A 3CN7A 1XQXA 2VOEA 5CH3A 5G4LA 3ITKA 3CMCO 1GUYA 2XUOA 3QWIA 3I5AA 7MDHA 5K2MA 3RBVA 1RKQA 3EIUA 2JVKA 2OSVA 3EHEA 2D5IA 3UMVA 4YCSA 2Q6LA 2RAUA 2EWVA 2DAPA 3ZHSA 2IPMA 1P1KA 4PHFA 3L4JA 4GEGA 1K7EB 4WZ6A 2NU7B 3AWIA 3TJRA 4C6RA 5F78A 1AHHA 1PFKA 2B78A 1X1CA 3AB3A 2AFHA 1VIAA 3CZ5A 1DWPA 2OE2A 2Z1NA 3ENQA 2GQ0A 3PIRA 4DCUA 4DCSA 5BRAA 3UG7A 2LDBA 5F1PA 2C4VA 1DDIA 1Z7YA 3A6JA 4ND4A 2XCQA 3B1YA 1WY7A 4HWPA 1C1HA 2AR9A 1MG0A 5DYWA 4H3SA 1LPMA 5FNZA 1M1YE 1Q1EA 4DJAA 5ELLA 3STWA 2G76A 4QOIA 4WJKB 3T61A 1YGPA 3KJEA 2I6GA 1Q12A 3ZR4B 1ZAYA 2H7YA 3CNHA 3ZDDA 3RCBA 3VPBA 2EG9A 4PZYA 4TT3D 4MRMB 3BWDD 1N5MA 3WWZA 4AWBA 2VC2B 1ZJWA 3LLCA 1BGVA 1A04A 1GV1A 4HGRA 1CUWA 3LQ2A 3KEMA 3FPBA 4KGXA 4QUGA 1GGEA 1Z0FA 1X7ZB 4QAQA 2D0PB 3ER9A 1VJTA 5A04A 4FONA 1CFZA 2GB4A 2OD7A 3F1LA 3F3KA 4X20B 2HDOA 4OLJA 3V3TA 2ODTX 2QM3A 1V2HE 4I50F 3DDWA 1I2BA 4XTCS 3SXPA 5EWMA 2BLLA 3OOSA 3EEIA 3M5WA 3L0OA 5CB0A 3NETA 4CU2A 3LAWA 3N3AC 1OU0A 1FYVA 1IPFA 4C5AA 4D3SA 2BSQA 1KFJB 5HFAA 2OHVA 2E1PA 2QYHA 3KVNA 1ZVJA 4QXMA 2ZM6B 2GEDA 1TVCA 1F5SA 1ZUNB 2FSUA 2I3AA 3GW8A 4I50B 4JBHA 4KREA 2HUNA 1YIAA 1SRQA 3IKMB 3KCQA 3DYBA 3PR1A 3OMWA 4RUKA 5DLYA 1N2ZA 2XTJA 2W8ZA 4MWOA 3QE3A 4YHBA 7YASA 3GRAA 4NULA 3W0LB 4GPBA 7GPBA 2CCKA 4IS2A 5CITA 1EQUA 2ZYVX 4P4SA 3UC5A 2J0EA 2WI8A 3OESA 1K08A 1X2BA 1D4OA 1JQ5A 1LWNA 1QZTA 4JBGA 3LVRE 2G70A 2IVFA 2FMUA 4R2KA 3CO0S 3GPIA 4MQFA 3W4KA 4BOYA 3OIVA 4B9AA 3UG6A 2YZMA 1QM5A 4Z2YA 1TADA 1N3IA 2I2AA 1C41A 4XCVA 1SVWA 2O2XA 3H13A 2PX2A 2G0TA 4XX1A 3DOEA 5AM1A 1SXIA 3WC4A 4Z49A 3VA7A 5DWVA 2J3JA 1F8YA 5FOVA 3GB9A 4PZCA 4YPVA 3HCRA 1HKHA 3ROEA 1UL1X 1DQNA 3WYDA 4B3MB 3QLVA 4F3NA 1AXEA 2D0IA 3EIFA 1RLOA 2P2CA 1GTG1 1SBQA 1ZGBA 5HIMA 5CAEA 1IWPB 2EXXA 4MMYB 4H6WA 3DEKA 1G60A 4CCYA 4TLEA 2PRKA 5H7XA 3OMLA 5K8VA 1NRIA 3IRVA 1VCOA 4G1FA 2HGZA 1EJ0A 2GDJA 4F3CA 4DIOA 1W29A 5JNUA 4RC9A 3HB0A 4BKQA 1RPAA 4JOQA 4H59A 2CL0X 2DPXA 4TKUA 4U2FA 4CMCA 1KK3A 3RTGA 4LV5B 5FUMA 4JYMA 2ONJA 3T9DA 5EHQA 2Y92A 1XA4A 1T6YA 3NJRA 4E5MA 2R5NA 2FTKE 4R0VA 2YWHA 721PA 1TAQA 3KSBC 3BZUA 3Q15C 5JAHA 5H3HA 1SB8A 4ISBA 2VDPB 2AG6A 1D6SA 3RQSA 5BNWA 4OX9B 2ZJ0A 4YUZA 3T9CA 3K4HA 4TL7A 1NNUA 3UAYA 2DQ4A 2PXHA 5K20A 1UFVA 2IYTA 4TQGA 3PTLA 5E6UB 1KGSA 1QOZA 1VE1A 3BSFA 3B9RA 4IOLA 4S3MA 3V6MA 4HEHA 3BGWA 4G8DA 1YCDA 1XDWA 2BV3A 4EF4A 2B25A 3OFKA 1XDSA 4EJMA 2AN5A 1NVKA 3TZLA 4AICA 3EG5A 3IH5A 4DW8A 2AEEA 4MR7B 2IYLD 4FFSA 4UPVA 3PITA 3WGTA 1IY8A 1W47A 4Q7EA 1B23P 1XMXA 2W2OA 1UC5B 4I1RA 3FSJX 4OHVA 5IH3A 4HSEA 2C2WA 1BRTA 2F8MA 5DM0A 4JIMA 2BGKA 2HRQA 4LOHA 3RF7A 5HUJA 3IIKA 4HWKA 4YMGA 4M9RA 3GCXA 1Q3HA 3MXOA 5FWXA 1T36B 3VKVA 1MA0A 3NHLA 2ZUCA 4CF6A 5EJ7A 3WMFA 5KNBD 1TC1A 3BXFA 3GLIE 3QSGA 1ZR4A 1O94C 2HX1A 1YMQA 3I37X 2EFDB 1QUFA 4A91A 1JR6A 4IMPA 2QBYA 5DEOA 4C0BA 3PYMA 1PK9A 3S2FA 2HR1A 1Z38A 5DM1A 1OASA 2V7EA 3HCWA 1MUUA 5DN6D 2HQOA 2GKSA 4ZQBA 3B6ZA 1BX0A 3DNFA 4FPXA 4V1CI 1L4GA 4IMRA 2X3FA 1JHRA 3GNQA 3ESRA 1LI4A 4KTTE 3I8XA 3RV4A 1Q7EA 3ISTA 1NT4A 5IJXA 1ZS9A 4G5RA 4QOSA 5CX1B 2MYNA 1YOVA 1RM4A 1U3TA 1YR7A 1QYIA 4FD3A 2M6SA 5K0CA 1RWKA 5CLGA 4MWGA 4JENA 5TPWA 1UDWA 1A9ZA 4KVGA 4KN5A 5BN3A 3FMGA 1PHPA 3L9XA 4C3VA 2OFXA 3GP3A 4QVGA 5HKBA 2C4TA 1RAIA 3DZJA 4QULA 3TVYA 3P32A 1A9PA 4YAIA 4FLFA 2H2GA 1S5PA 4NG4A 1QO7A 5CYGA 3HMQA 4B17A 2HBRA 5EGNA 2Z0MA 1PQUA 1R6XA 2OFPA 1T4BA 5DOZA 1XNHA 1T2FA 3HWWA 3SDSA 4OGLA 4IHAA 3GLHA 1Z47A 1GNVA 4AKGA 3MQFA 1QRSA 4MQEB 2BMJA 4D96A 5HS6A 3U17A 3MM4A 4X3OA 1U2RA 4CIDA 2Q2OA 1P4GA 1QTRA 1IN6A 2Q3EA 3HR8A 2XNSA 4NVRA 3B48A 1N9GB 4PICA 1U9IA 2HA2A 5ESRA 3SXUA 1SVOA 3ZVNA 2OXIA 2CV1A 3LH5A 4L5CA 5A3QA 2VNIA 1T25A 4D41A 4J1SA 4MAMA 4MUKA 3BERA 1T2VA 2DHCA 3LQYA 2Q4EA 4QUHA 4JI6B 3RF6A 2OOSA 2GCPA 2M1ZA 2UYGA 1J2RA 1P81A 2G6TA 2XOEA 3A05A 3G9QA 3PX7A 3NI2A 3O7MA 1OQAA 4KNYA 2O8CB 4IV5A 3I9MA 3SX0A 4AXXA 4G23A 1TM1E 1WKCA 3FFXA 4ACBA 5CFMA 1FBTA 1YJCA 1H2FA 4G1EB 2WOJA 4QEZA 3HYTA 3L1HA 4LBYA 3HXQA 1IBMB 2XYRA 1C7EA 3AFMA 4YQEA 1JF8A 2ZJ6A 3ITNA 2UUBB 5DYTA 2AC7A 1ZCJA 1WD5A 3KLOA 2O1SA 5EP1A 1NQOA 1QFZA 3UMBA 3KS9A 1IBCA 2BFDB 1GZUA 4HQKA 2DHQA 4R84A 4D5GA 1PAUA 1DXQA 3ADBA 1VBNA 1ZKDA 2GF0A 4YO7A 3PRKE 4LZOA 1LRJA 4WESB 3ZZTA 1P17A 2P2SA 1GQOA 4J0JA 1XVLA 2O14A 3RRXA 5F5XA 3T06B 4DDTA 1H9CA 3JWPA 2I65A 2VJAA 2D4AA 2EJBA 4RVFA 3CZ9A 2FUKA 2YJTD 4MMXB 3KDAA 3H3JA 2B7LA 1Y5RA 3AUUA 1NR5A 3K9HA 5FUBA 4JLPA 5C1BA 1DE0A 5A7GA 2ZYWX 4FEYA 4EK9A 1Y3HA 4AUEA 3PRHA 3U44A 1EFTA 1FXWA 1TIKA 1YB1A 3IUYA 3SP1A 5K05A 2RK3A 2AJ8A 2X7HA 4KQ9A 3JZAA 3DAHA 2ZRQA 3DWGA 2Q1WA 4PXAA 5ENZA 2Z1DA 2QV7A 3WLIA 5EUCA 1BFKA 3WLTA 1AKRA 4AJKA 1MIOA 4JKOA 3CH7A 3IOMA 4BMNA 2VBFA 4OGGA 4JJ7A 4KWIA 4KO8A 1MC8A 3H87A 4NPHA 3RU2A 2FYTA 4MLZA 5L9AA 4FZJA 5JBQA 1ZH6A 3RIYA 1GTJ1 1XBTA 3CUUA 3FKSA 1QF9A 1VRCA 4JLKA 5KWIA 2EQBA 2QZPA 4HYTA 4M1YA 1GRRA 3F3YA 4JUFA 5KBYA 2V5VA 4XYBA 1HLDA 3RVJA 3ZDAA 3RVMA 4DRZA 3GNTA 4PZPA 1AN0A 1WHTA 2HO5A 2Z2YA 3I23A 4JEMA 3UOAB 4F7DA 4QQFA 1N2JA 3KUUA 4BQQA 4EMBA 5IBPA 5SZIA 5BN5B 2ZRHA 2VYCA 5BV0A 4GVPA 4FCCA 4O5AA 4I6JA 3TVDA 4D5EA 4ER6A 3LRXA 1DEHA 5TC4A 5CVUA 4GI7A 4CVNA 2A0KA 5KWEA 2PL3A 3DMTA 4I4TB 3ZV5A 3WK8A 1MJNA 3ZXIA 1G63A 5IUJC 5FR1A 4G36A 4IXNA 2XW6A 2YMQA 3ZW8A 4KOEC 5DYIA 1REQA 1M6HA 2IXEA 2PGXA 4HDSB 1BJTA 4X90A 1IBKB 1L5HB 4EFNA 4U4AA 2R97A 4CWAA 1F17A 1VG1A 4H1HA 1LVGA 2HA6A 4DABA 1BX1A 3N2KB 4IV0A 5FFMA 3IB6A 4C4AA 2RK4A 5A4FS 1JYFA 2QZJA 5JEDA 4DG8A 2JFPA 3Q9LA 4P31A 4B9EA 2PBZA 3JYLA 2ISQA 3KQUA 2P5YA 3FOAA 1U0FA 2FB9A 2R25B 5KYKA 3AEUB 1NIPA 3M6MD 2ZT6A 1UJMA 2Z83A 4II7A 1YS9A 2JC3A 1IG0A 4WZBE 1SG6A 3HHEA 4BYMA 3BIOA 4GT1A 3Q41A 5E4JA 1ZRNA 4XM1A 2EGHA 2ETXA 3AJRA 1PN3A 3VR1A 2BGNA 2VQFB 1DRVA 3TDNA 3HY3A 4PBTA 3E53A 4BC1A 4BJHB 1I1NA 1W36C 5E6SA 1JQKA 2XXBA 3SEZA 3W7VA 3WMWA 3D3KA 4C7JA 3OU7A 4TVBA 4E08A 4BNIA 1DKNA 1XWIA 5JY6A 1SU6A 2C9CA 3BWXA 3GRCA 3FW1A 4KYIB 5FV4A 3Q11A 5TV2A 3QUQA 3LX5A 1Y6FA 2LZ0A 2VXCA 5DP1A 1UJ6A 5SZHB 2IT1A 5SYAA 3PHGA 3QLVC 4Y6LA 2HCBA 3U3JA 3UOWA 1TO6A 4PRKA 4E14A 5DLPA 2Y1GA 3MMPA 3EXHA 5F5NA 3NRCA 5AJHA 2O0KA 4UBMA 4XWAA 1CD5A 4C87A 4WA7A 2RAPA 2OHOA 2VZ0A 1I01A 1D1SA 1E2NA 1W5AA 4UVEA 5KYVA 3C8UA 3LYUA 3UA3A 2W4QA 4C7OB 4P0PB 5JTTA 2E85A 5F33A 2SKEA 2H0AA 1THZA 1USGA 2FR1A 1KZ4A 2G77B 2SICE 2XA9A 3HKCB 3PLAE 4YRRA 2I2WA 5DM4A 3OKPA 5DEIA 3USZA 5TF0A 1A8UA 3EY4A 4HZGA 5KDOA 2C07A 3JASA 2W2LA 4QHSA 3REFA 1FU8A 3H1EA 1ZKMA 1GILA 1IIBA 2OFOA 2CZGA 2Y2UA 4HDNB 3UK1A 1DTWB 2KJQA 2IEDA 1J20A 3KQWA 4ZIRB 3WY9A 3UIEA 3K96A 3ZNPA 3NO4A 3C8MA 4WW0A 5HGXA 1JEAA 3TR0A 1VG9B 1QMPA 2XVMA 5ALDA 1JE1A 4V3CA 4N41A 4OFWA 3RLIA 4E94A 1ML3A 4WTOA 2Z9DA 4BX2A 3PL5A 3WX0A 2E18A 3CLUD 4BCCA 1B6GA 2XRMA 4FINA 5D86A 1VL2A 1IN4A 1OY1A 2QX8A 3KKLA 4KXMA 1P5ZB 2YOFA 3SQDA 3BTOA 3H04A 4TLMB 1M1YA 3SWWA 1RKXA 1NE7A 1UIRA 2B20A 3OCYA 2F8TA 2AYZA 2ZRPA 1L1FA 2Y1OA 5JJKA 3USES 2AW3A 2O50A 1V3TA 2NTJA 1OAAA 4IYRA 1OFHA 4JQYA 4MRNA 1TZ2A 3U4QA 1S2GA 1NSYA 1IUKA 4EG4A 5ECYA 3LW7A 3UKOA 1CR0A 3TSOA 3WB2A 1FSFA 5LUAA 2PH1A 4Q1FA 1PZNA 1Z4IA 3ABZA 3AR8A 4HTFA 3MG9A 4MQ4A 2P62A 2DWCA 2X5OA 4MVJG 1NW9B 1GCAA 1V8PA 1MRNA 3DF7A 3E05A 3HC7A 1ZY2A 5EZ6B 5EMMA 4A6PA 1YFLA 5DHTA 2XNDD 4CV2A 2H8GA 1ID1A 5JC1A 2QXTA 3R23A 2I4IA 4EHKA 2QHXA 5EQTA 4PX3A 1T1IA 3SZGA 1KJIA 1YOBA 1YS6A 3WIOA 1Q1NA 2HDNB 3IR5A 2GPWA 5CB4F 2R2GA 3T7CA 1JEQA 1L7BA 4G0PA 5TSDA 3G0BA 4QODA 4I3HA 3RGGA 3A2MA 3RQIA 3E27A 3FLMA 2BJVA 2HLNA 3OJCA 3R41A 5LZ8A 2GAJA 3WTCA 4P0QB 5CUQA 4PXYA 4BWGA 4BX3A 1GQSA 5DNYB 3OZSA 3TGWA 2XA1A 4L0QA 4CL0A 4LSWA 3ROTA 3WA7A 2ZUDA 1C8LA 4CZ2A 3PENA 5IG2A 3PQCA 5JS8A 4PLPA 1XD2A 5BO5A 1O7JA 4BIIA 5IKPA 1C81A 4CM4A 3ZGYA 3GT4A 1T8RA 2YIMA 4JP3A 5AVKA 5EQFA 1NI4B 2GEKA 4IRXA 1RBZA 5GQSA 3REQA 1P7ZA 1E7YA 1WVIA 2FPOA 3W8EA 4Y6OA 4ZYLA 3M6WA 4F71A 5M34A 4OUDB 3QP9A 3ET4A 4BFTA 5AW9A 5CVEA 4CMAA 4MVJF 1CS0B 4M38A 1T6ZA 1TAHA 2MSLA 2QRUA 5H59A 4B2PA 2Z2IA 4TTIA 4D25A 4OQEA 3SIPA 2NXJA 3KOOA 3T7DA 3ZIDA 2AJCA 4FMCB 4HNVA 5LLTA 1RQ2A 2ZDHA 1JNYA 3P9SA 4GM0A 4EEZA 5JHGB 1DO0A 5TJHA 3I3SR 4X85A 3FCCA 3HUUA 3L7AA 3D3QA 4LHZA 5AI4A 821PA 1G8FA 2FEPA 3NC4A 3OQHA 1Y9AA 3MRTA 1NR1A 2R79A 1U9IC 1G9XA 1XKXA 3EH2A 2O48X 1XTRA 1GSAA 2W2MA 4LHEA 4Q24A 2DFDA 2DFLA 2AQIA 3FTCA 4PCUA 4X3CA 4A5SA 3F96A 1Z39A 3AUSA 3EGOA 3L7YA 2WAAA 4MCIA 4Q15A 4DLPA 3OCZA 5KQSA 1H4SA 1RW4A 1JDUA 3MEQA 1MHPA 4P08A 4P84A 2VPWA 4MDFA 3JQQA 5H70A 1RJ9B 5M04A 4RVSA 2BEVA 4ER5A 1OGYA 1IN5A 4C5BA 2QVLA 1Y0BA 4Z3OA 1RKUA 1VJRA 2GAFA 2Z9BA 3CUWA 4JLWA 2EDCA 5KTYA 2FG7C 2HCTA 3GVPA 2GN0A 1H8ED 1HYQA 1R6UA 3ICPA 2BUCA 2ANBA 1KPIA 2NTVA 3MILA 1VYTA 3AERA 1QQTA 3LCUA 3AIKA 3PFKA 4K0RA 4U6QA 3TCKA 4YRKA 3GH1A 3DEFA 5DNVA 3E58A 1UWCA 4IM7A 1KVSA 2ZR0A 2BBWA 4ZI2A 1YRBA 4EQ6A 2YN0A 7ABPA 4RKEA 2A2ZA 2WR8A 4P58A 3QFRA 1G55A 2AZDA 2F64A 1X94A 4Z2AA 5MGNA 2JLAA 4NE9A 3RYTC 4HQ0A 1F6WA 5MN6A 4MARA 3V9PA 5DDIP 3QSYA 1M2GA 4TLBA 2A5DA 4XQCA 3VMMA 1U04A 2P65A 4ZAGA 4BE9A 3TQQA 4H60A 3VR4H 2PUTA 2XE4A 1KH1A 3I92A 1NBEA 2QX6A 4BE4A 4AAYA 3JRWA 1BCSB 1BMQA 4XRGA 5ARBA 1JT2A 5IWCA 2UXBB 4H17A 1RI4A 2NVUB 1WUIS 2HSEA 2VJPA 2ODBA 4C43A 2C94A 2AZMA 4Q6BA 1E6UA 1NW6A 2WV9A 4IKOA 3OIWA 1ZNZA 4RXMA 3ZGLA 1E6EA 3ELYA 2Q27A 2PL9A 2OGZA 3IAHA 5LNK1 1KC1A 4MDHA 1YD7A 1SUCA 5IN5A 1XZQA 3NHSA 3QEKA 4NZPA 5EPUA 3MWJA 2G4CA 5DJ5A 4Q9NA 3U62A 3FFTA 1SWWA 4D8UA 1H4QA 5CM9C 4OQLA 5B3AA 1E2GA 3UUWA 4CN9A 5CRIA 3MHTA 4ZTZB 4A03A 4ZEMA 3MJTA 5F9HA 2FCRA 2Z8YA 3N0WA 4ZVVA 2DUJA 1YZYA 3CG4A 5C8YA 3TUZC 3A1UA 1EPUA 4OSPA 1SHTX 4DMHA 1UMCA 3GRVA 2VT3A 4JA2A 1A7JA 1E1MA 1BZYA 1VI6A 2PA3A 3FPFA 3OU2A 4QFDA 4G1CA 1G5QA 3CLTD 5TB5A 3PDHA 2Z3VA 3DVRX 3OC6A 3W77A 3CLKA 1DMSA 5G0WA 3DHEA 3WJAA 5DBFA 5H9WA 2XR1A 3UWSA 4JP2A 1PLKA 3NRJA 2C77A 2GARA 4O02B 5E1OA 4LE0A 4ZEXA 4X65B 3DMTC 1CUAA 3IMEA 4AZ0A 1FW8A 1X92A 4WLFA 3QFTA 2WT9A 3W8NA 4HHEA 1PO7A 2CXQA 2XB8A 5KTNA 2YRWA 3O03A 1WHSB 3L3BA 3VO8A 5ESXA 1QIFA 2DLNA 1QQ6A 3IP5A 4UARA 2GD6A 3U5TA 5J2TA 3OQNA 1K7XB 4J1QA 4II2A 4PYNA 1DKLA 1DTEA 3DZKA 3HNRA 1GIAA 2VWGA 1JAIA 3RVDA 3V7NA 3O2NA 1Q0LA 2WIFA 4PLTA 1E32A 3MC1A 3PVCA 3WWOA 5BUQA 4IDHA 3NTRA 3FYSA 3W9UA 3QNWA 2W2XA 1OZGA 3X2EA 2BBTA 1GEEA 2DQSA 3MIIA 3PX2A 1JMKC 2V0NA 3BGIA 4TOIA 3KJHA 2PQ6A 1JHYA 3RE1A 3ADKA 3MTQA 4KPGA 4XM2A 4BMZA 1XHLA 2JGRA 5L3SA 3AVOA 4LC1A 1T5BA 3P9KA 3P4YA 1LXCA 3E81A 4DWVA 2KW5A 1G2OA 3KKNA 4BGVA 2J7KA 4EHHA 1XQWA 1BDBA 4MP3A 5H68A 3L8MA 5AJVB 2CL5A 4MOWA 5JSHA 2HJ9A 2QTFA 4CF5A 2R96A 3PQ8A 3NOOA 3KAPA 1N3BA 4A4DA 3CVJA 3TB4A 3W5AA 2BFBB 2IYRA 1Z63A 1NJ5A 3EZXA 3DOJA 3E4DA 1PQYA 1F6BA 1IXKA 3KJFA 1KI4A 2VAXA 1O6GA 3F97A 4I14A 3EB9A 3T5GA 3SYRA 1V39A 1EDZA 3OX3A 2RD2A 3FVQA 1X0XA 1SC1A 3MJSA 3OICA 2XXAA 5CFPA 1U6IA 4EO9A 4YJHB 1JSRA 1ZJJA 4RANA 5A2GA 3E9YA 1GJRA 5DT2A 3EXHC 1JTVA 3FWHA 4H4CA 4P5EA 3FROA 1GDHA 3V4SA 2OKGA 2B30A 4MWCA 1KJZA 3F7MA 4YXWD 1OA0A 3IUBA 2QUJA 3G17A 1WCXA 3VNUA 1SKBA 1VE9A 3PDJA 1A8SA 2PMCA 4YRJA 5TGTA 3U49A 3VVBA 1MOQA 3K1YA 2DWQA 5ICFA 1CY8A 2RKWA 3NTOA 3TD2A 3EJWA 2QX4A 3T3GA 4ECAA 3RYCA 3EYWA 1W6UA 2C1EA 3BVPA 1KBQA 2E6KA 2OB1A 1Z2CA 5IABA 1FUKA 3TMYA 1G5IA 1H94A 3O82A 4KWTA 2IDJA 3FMPB 4N6NA 5JD3A 5GADl 1AKUA 3EZ2A 1LSOA 3P97A 3C7CB 3KD2A 4NJMA 1FTYA 3T99A 1R6AA 5IM5A 1HMYA 5T6BA 4KITB 2ZIXA 2YN4A 5FQNA 2OENG 3GROA 2ES4A 2IYSA 2AF3C 4Y2RA 2VZEA 2ZROA 4C76A 3EASA 1VBFA 1EGQA 2AG5A 5FUXA 5B4UA 4OFBA 3DO5A 3RUDA 1U7PA 4UTOA 3U0VA 2PS3A 4HVLA 3TZCA 4ZDKA 1ZJ4A 2NQ2C 5DI3B 2ATXA 2CWDA 4MPTA 1ZI8A 2GWHA 1Q2XA 2PN1A 4JT4A 1PW7A 2H29A 2LCFA 4B2LA 2DX7A 2NYVA 4IYJA 4L9SA 3PGA1 3SNKA 1TAUA 1EBBA 5HRUA 4AU1A 4NBKA 2VUIB 1DWOA 2Q3DA 3PNOA 3TMKA 4EITA 3U3RA 1SHJA 3MSCA 3AP3A 5FI3A 5T57A 2C5HA 4B4VA 4E46A 3ZH9B 2VXOA 3MMNA 4MUMA 2IU0A 5CT5A 3QUBA 2OGTA 2B83A 3LK6A 3ON5A 4D42A 1O5OA 2OBMA 1ZR2A 4YBRA 3WXBA 4DIMA 3CVWA 4RK0A 3G89A 5F98A 4AY2A 3RUHA 1GGVA 3X1XA 3FLEA 1TLLA 1V96A 1BHSA 4ONEA 2XEDA 1JHVA 3CURA 3MTGA 3WE7A 2E55A 1PR9A 1WMAA 2VYFA 4QDKA 4ZHQB 4FKZA 3VNRA 4YCMA 5ADWA 1FNSA 1PVVA 4R54A 5JO0A 3C1OA 1E3WA 1Z2AA 2BN4A 2GZ1A 4NPAA 2SNIE 3NHAA 3KZKA 1LLUA 4K6OA 4OXQA 2Z1MA 1JBEA 4IX1A 4U0KA 4M0PA 1Q16A 4MYHA 3E8MA 1GNTA 5JZMA 2WQ6A 4IKEA 3L0SA 3N07A 2YWFA 3KUCA 1NJGA 1T2DA 2D1RA 2CE2X 4IJMA 2EC5A 3SZRA 4I5GA 2V0CA 4HLQB 4ENQA 5CEEA 2G1JA 3R7AA 4FB5A 1SBIA 3VFDA 1N2OA 5C81A 4PGGA 4W1SA 2RARA 1CP2A 1JFLA 2YJ5A 4M1ZA 3SYLA 2GESA 1ZH0A 2H2IA 3D81A 5A5FA 4YMUA 4URFA 1CW2B 1FXUA 2R00A 3FCEA 2NGRA 4BEBA 2FHSA 3IJEB 4OFZA 1ZK3A 5C51B 2EAUA 1DV1A 1LNQA 2IW1A 3PVSA 2E4VA 4PNEA 3ADCA 3B52X 4DSAA 2QZSA 1EK5A 3TTWA 3KT0A 4CDMA 4PPNA 2L69A 4Q48A 4EYKA 3QTBA 3NWEA 4TWJA 2DP4E 3V1UA 1AS0A 3KKPA 1E2DA 3GRZA 3ICQB 1ULBA 3G0CA 5IVIA 3PI6A 4REMA 3TEFA 4XE5A 1GGJA 2JBWA 1VP3A 4IWNA 4DEYA 2ZRGA 2P6OA 3DBOB 2OWEA 1VA4A 3BGVA 4UDYX 2VF7A 5LNK6 4YI3A 3OQ1A 2A92A 3C3DA 1ND5A 3UMYA 3V4FA 4I1VA 2P3LA 4F5YA 1JEYB 3BN3A 4ENUA 2HMYB 2QW1A 4YMLA 3C45A 3I2YX 4H0FA 1H05A 1GT91 2OHJA 3AW8A 2I4RA 4I66A 1XL0A 3HXPA 3NW9A 3T54A 3SJUA 1L4HA 2TMDA 2ZB2A 4RACA 4AWXA 4DLXA 4ERNA 2GLXA 1VKRA 1K68A 4PCAA 1DL5A 3DH0A 2WLSA 3ORSA 4YH1A 3LTNC 4GZMA 3TFQA 3TCNA 1L6IA 4NL4H 1QP7A 2XB2A 1E0AA 4EB6B 1VYHA 1OVGA 2AUMA 1F3OA 1M8KA 2BFWA 2X3YA 3JU3A 3PB3A 4HNAA 4IDBA 2AG0A 4N0MA 5E8JA 2OQIA 4PRZA 2E21A 5I7WA 1DKPA 1WBBA 1YZVA 2XMRA 4P3YA 5IMBA 5AIBA 2XWSA 1E62A 4DPLA 1YS1X 3V7YA 5E7IA 3EC2A 2ZOSA 3ET5A 3OE7A 4GPTA 3E7XA 5DBOA 5AT1A 2X4LA 4E2FA 2HV8A 2JATA 1R50A 2IU4A 1US8B 3HKBA 4YAUA 4R6WA 5L4NA 2AI2A 1P7YA 2ZRDA 3D7RA 4I1UA 1R5NA 3FCOA 2WWIA 1C1YA 3NV9A 1NQXA 3QYPA 3FRHA 3P71T 4ISCA 4KAJA 3GJRA 4KQ2A 4A82A 1GPYA 1KIFA 3OM8A 3RSCA 1A5ZA 1HQYE 2D0OB 2C4WA 2JLCA 3KWFA 5KSPA 2VDMB 1EEHA 1JILA 4X3PA 4A1FA 1Z3IX 1QAMA 1W87A 4FW9A 2OXTA 2Z43A 1ZNXA 6LDHA 4NZMA 1FXSA 1QV6A 1BVYF 1O58A 2P41A 4QVKA 2CF5A 3RAEC 2LWIA 1ZM4A 1KQNA 2VQSA 2VNJA 1V8OA 3BIWA 4OP1A 1CQJA 4TRMA 3ZWNA 5A4JA 4DQXA 3TNYA 4MR8A 5JZOA 5LZ7A 2E9SA 3G8BA 1V48A 4A8HA 1H2WA 2QP4A 3ZJYA 4C7VA 4IG9A 3SKXA 1SHKA 1NQVA 4HAWA 3KQKA 4LN1A 4M87A 1BD3A 4ZQCB 4OP2A 4YS6A 3VVCA 1V8ZA 1ZIDA 2RHDA 3VPFA 4JYAB 2BY4A 3EDMA 1MO5A 1PZHA 4N3BA 2E1RA 2HWWA 5K0NA 1P3JA 2O06A 3NFYA 2VPTA 3VPCA 3B13B 2GEBA 4BO9A 2J4DA 1ATIA 4KR0A 2F67A 3MWYW 1QAOA 4IXTA 3WSTA 1Y7IA 5LIRA 5CFLA 3S29A 4KPEC 1X0VA 3BSSA 1CT9A 3VPHA 3MZ0A 1SAYA 1WD7A 1E79D 2G4VA 3N75A 1D07A 1E7SA 4FQ8A 1LBIA 2IYNA 4BQSA 3C1TA 3RVLA 3ZDEA 1AKNA 1FJGB 2AV6A 2R2AA 2PWYA 1T3LA 3LQ4A 1XEAA 3E2IA 5CXXA 5FA8A 4BNTA 5I3ZA 1TE2A 2JBAA 3N6RA 2QMQA 4WXHA 5SYNA 3SVZA 4PEVA 1TUBA 4EABA 2ZIEA 1M75A 5EZ5A 3HYCA 7REQA 2XMBA 2FVXA 4ZOLB 1ADFA 3OT5A 1I0ZA 1XYVA 4EYGA 1NMQA 4ALLA 2FW8A 4O2AA 1OPRA 3FZYA 1IZ8A 3DMHA 4YPFA 3WGIA 3DZGA 3ETJA 3THSA 3A3NA 4U1RA 4CFSA 4ZCMA 3MWKA 2BDTA 5KUTA 2FZ4A 5AKXA 3EGEA 4GYKA 5C3UA 3UWMA 1QP8A 5K0ZA 2B0CA 3N6XA 2IBTA 3T34A 1YDHA 3NVAA 5G4KA 1ORIA 1R8XA 4GLJA 4LHSA 2FRVA 1CUBA 3JALB 5KB3A 4XWYA 2SKCA 3G82C 1ODLA 1BN6A 4EAQA 2IL1A 4NIMA 4J0EA 3RFTA 1EHIA 2NSHA 2XCTB 1K92A 1QHGA 3G9XA 1S02A 1ONSA 2WPDA 1PLLA 2OL4A 4RIIA 2IBSA 1P6UA 1P31A 2A9RA 2QN7A 2JH9A 1OFTA 1GGHA 2IEBA 1DJOA 3LK7A 3DAFA 3OZEA 2D62A 3DT8A 3FPHA 1OUMA 2YC2C 2W2TA 3JQGB 4AJEA 4WBNA 2BH2A 2A5JA 2Z30A 2UZ4A 1LLQA 1EESA 3R8CA 4QGHA 2ZIGA 4M54A 4QATA 1QIGA 2ZETA 3O75A 4KR2A 2Y1DA 4L4SA 3DZDA 3IQWA 1PSDA 3BMNA 3GPCA 1XSEA 3WKBA 3V4VB 4YMTA 4GE0A 1X38A 2VSYA 2IHVA 2MJLA 3QM1A 4MRVA 3D59A 5E1MA 4TMVA 1YIDA 3CXRA 4MSUA 1Q0QA 3COJA 1Z8HA 5FWYA 4CQNA 2WIKA 4B33A 3INRA 2EX0A 3A4TA 2L82A 2B4TO 3Q3GE 4JUIA 1XQ6A 2ERYA 1AUQA 3GK3A 4H7JA 2POQX 2VP5A 3K9GA 3M4NA 4HN9A 4EARA 2W2KA 3EFBA 4JJFA 5L6LB 3MS7A 4BAUA 3H83A 3VTAA 1Y98A 1BMTA 2PSDA 3EGDA 4LHVA 5DOVA 4FGSA 1A9OA 2C2KA 4UU8A 4AQDA 3Q85A 2BONA 3A9CA 4HLDA 5F52A 4U2EA 1FUYB 3WYCA 4DILA 3VYUB 3MJHA 2WNIA 2FX3A 4ETNA 1GQFA 2BFEB 2VWPA 4TVKA 1RIFA 1J5PA 4WI1A 2XRYA 4BB9A 1DMRA 2P4SA 3F5SA 2NSJA 3FR8A 2NXWA 5ENVA 3ICCA 4Q6WA 3ZPXA 1UODA 3TLJA 2CUZA 3DMGA 3ESCA 3CF0A 3FBWA 5J5VA 3K3PA 4F4HA 1GL7A 2D5CA 2QRLA 2RH5A 1UPTA 1T3ZA 4NJEA 1P60A 1X14A 3AFGA 3IV7A 4P1ZA 4AC9A 2O52A 1P5HA 4GD3Q 3ZH2A 4QM7A 2Y71A 1D6JA 2E4AA 3PQ6A 4J0IA 5C1IA 1S2LA 3WDSA 3DSRA 1RI2A 3QKSA 3H2ZA 1P0CA 4QPZA 3D3WA 3DLIA 4RABA 3FETA 4BMDA 3GLGA 3GJTA 3OCCA 3BMQA 1L1QA 3N86A 4JI4B 1JIXA 1FS5A 4IIJA 5JC8A 4K0KB 3EA4A 3SDBA 1IY0A 5CJJA 3I5XA 1XQ9A 1U0EA 1NNSA 1D1QA 2V6FA 4J0QA 1QH0A 1QH8B 1JAZA 1MA3A 3K05A 2QJWA 3S2ZA 3ZS9A 3HI4A 3L8DA 2WJAA 3B7GA 4OV6B 1OZ0A 4KPYA 2NVBA 3L0PA 1KPHA 2OHFA 3RC9A 2NNLD 3CHYA 1QU3A 1SJ9A 2NZXA 3FF4A 2AOUB 4O2BB 4F5WA 2J0UB 3U80A 2YVAA 3QWBA 1A2OA 5DWDA 2VPQA 3LY9A 2QR2A 4D4JA 3PPXA 2JI8A 2R8EA 3SBXA 1TVEA 1XPJA 2F3PA 2M6RA 5BWLA 5C1PA 2I1WA 3A58B 5E9QA 3EGXA 3JD2A 3R6GA 1OI2A 4I9NA 3AEQB 3HJTA 3GARA 1E2IA 3L1KA 2PZKA 4FNOA 1XTTA 4CEJB 5ALHA 2JGEA 4ER7A 1PVOA 1GTZA 1VKOA 2WTEA 2YHUA 4TWZA 4AZVA 5HM6A 1G6OA 3E7WA 5JRJA 3R7WA 1XCGB 4FE7A 5ITSA 2H7VA 2WZDA 5U4QA 2AYXA 1DGQA 3THOA 3V7FA 5DTJA 2C57A 4HAYA 3CISA 2FE4A 5DNDA 4LF4B 1YHYA 1H8HA 2B5VA 3GBSA 3DZCA 1SXHA 2JIDA 1PL6A 1YI1A 3BWEA 4CIYA 5AUPB 5BURA 5TQ2A 4N18A 5H02A 3N39C 1W19A 3EAQA 1YE3A 2VFAA 4IINA 5TIIA 1G0NA 3EMDA 2JI7A 1DQRA 1F60A 1G20E 2GTPA 4FFLA 4K3UA 1FBNA 3KB8A 5E2AA 4GZ5A 4DMRA 4RSGA 3DW3X 3OJEA 3TZEA 3H1AA 2Z3WA 2V1UA 3EGWA 2UYYA 4GLBA 1KH2A 3G8CA 1SGWA 3KAQA 3MLBA 5I9LA 1SELA 5AIAA 3LYAA 1WZEA 5ULLA 4C4OA 1X7XB 4RHTA 1EWYA 4CJXA 4ACAA 2PWBA 5FHRA 1CUXA 3IP7A 5JCJA 4I55B 1J1IA 1RXSA 3L7NA 1OOEA 1V5GA 5J2UF 1DXYA 1UOQA 4K1LA 3N5CA 4EHBA 2CVQA 2Y0BA 4Q4LA 2HD4A 1LQUA 3I0ZA 1N6NA 2QL7A 3LYLA 3P0FA 2LUOA 1HT3A 1R8JA 4PZAA 1FA9A 1QWSA 1RJDA 3B89A 3O95A 3WLKX 3AIOA 3FJOA 1XXHE 5LD2C 3C4QA 5K5EA 5F9FA 3FXAA 4CGYA 5JI2E 4GPZA 4YY3B 3KQTA 2Y1CA 3GLRA 2XZOA 3PT9A 1OBOA 5J2UB