2A5LA

The crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
196
structure length
171
Chain Sequence
SPYILVLYYSRHGATAEMARQIARGVEQGGFEARVRTVPAVSTALYATLEDLKNCAGLALGSPTRFGNMASPLKYFLDGTSSLWLTGSLVGKPAAVFTSTASLHGGQETTQLSMLLPLLHHGMLVLGIPYTPYGASHFAGADGKRSLDEHELTLCRALGKRLAETAGKLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trp repressor binding protein WrbA
publication title The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 55
structure length 171
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2005-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a5lA00
4BMOB 2A5LA 3GFQA 5NLLA 3NHPA 1CZNA 2BMVA 3P0RA 4YAOA 1J9EA 5A4KA 2MTBA 1D04A 3R6WA 3W77A 4LTNA 5TGZA 5LVAA 2HPVA 1XI2A 5B3KA 1YCHA 4CETA 3NHJA 2OYSA 3FX2A 1FLNA 2F1OA 2AMJA 3OJWA 4N82A 2MOKA 1FUEA 1FTGA 3O73A 1JA0A 2D5IA 3L9WA 3W78A 3UXEA 4ZVNA 4FGJA 1RTTA 1CZLA 3HLYA 4F8YA 4U7FA 3K20A 4NLLA 4D02A 1J9ZA 4LTDA 1XYYA 5F4BA 3LT5A 4LA4A 3FVWA 1AKVA 3GFRA 1BU5A 4QOHA 2Z9CA 5FX2A 2FZ5A 1DXQA 3FW1A 4PTYA 1V4BA 3W7AA 5NULA 3KAQA 2V5VA 1DXOA 4ZVKA 2QX4A 4XDGA 3OVMA 4HEQA 2M6SA 3NFRA 1FVXA 3QFCA 3HR4A 3ESXA 3JSXA 2V5UA 2KQUA 2R97A 2FAXA 5EMNA 5LMCA 4ICIA 2MWMA 4DILA 2BPOA 5BUCA 1H69A 1T5BA 3N39C 5EA2A 3QFRA 3LCMA 3KEGA 3W79A 2OHHA 1AKWA 1J9GA 1QHEA 3NHYA 3K1YA 1KBOA 1QRDA 4FX2A 3OX3A 1RLIA 1TIKA 2KLBA 1T0IA 5LJLA 4QOGA 4C76A 2RG1A 4Y7CA 4PTZA 4GI5A 1I1OA 3F2VA 4NULA 3B6MA 1AG9A 5FA6A 3U7IA 1DX9A 5F12A 3ZHOA 4YAFA 1AZLA 1CZKA 2QMZA 4YALA 1SQSA 4DY4A 5LJIA 3NHKA 2Z98A 2QR2A 3NHSA 3F6SA 4QOJA 1YCFA 2HNBA 5LBTA 4U7GA 5LBUA 3NHWA 3SVLA 1C7FA 1YOBA 2QMYA 1FX1A 2M6RA 2BN4A 2FVXA 1TLLA 3TE7A 4XDHA 4ZVLA 1E5DA 1WSWA 5ULLA 3KLBA 4N65A 4FGKA 2QX8A 2Z9BA 3TEMA 3NHFA 1FLVA 1CZOA 2X2OA 1H66A 2QWXA 3NHLA 4C0WA 4ESEA 3RPEA 4ZVMA 3D7NA 1YKGA 2R96A 4FGLA 3F6RA 1YCGA 1XYVA 3ES9A 2FX2A 2OHIA 1YRHA 4QODA 3B6IA 2FLVA 1ZWLA 3OJXA 4Y9RA 1J8QA 4H6PA 1CZRA 4YQEA 1NNI1 4GR9A 2QX9A 5B3LA 1SG0A 2N1MA 3B6JA 4BMPB 4QOFA 4H2DA 4LTMA 1BVYF 3UXHA 2HNAA 2FCRA 2FDXA 4HS4A 5JROA 1AKQA 3FJOA 2V9CA 3ESZA 2X2PA 1XT6A 1FLAA 2XOEA 1JA1A 4R81A 1ZX1A 2BZSA 4CF6A 1FLDA 3EDOA 1B1CA 4LAFA 4U7HA 5LLDA 3L9XA 1OFVA 1OBOA 2B3DA 1OBVA 2Q9UA 1WSBA 2BF4A 3KAPA 1D4AA 4YAUA 3OX1A 5EAIA 3O2NA 1AKUA 3EYWA 3ESYA 4C14A 1CZHA 4J8PA 2W5UA 1D03A 2MT9A 3TZBA 4GQIA 3FNIA 1QR2A 1RCFA 3NHRA 1X77A 5FUQA 1ZWKA 3OWHA 3OX2A 3GAMA 2Q62A 1YDGA 3U7RA 4S24A 1RLJA 2Z9DA 3GFSA 4YAWA 3N3AC 3NHUA 2XODA 4Y9UA 5F51A 3NLLA 3S2YA 1VMEA 3F90A 1AKTA 1QBGA 1AKRA 3G5MA 4M0CA 6NULA 3B6KA 4QOEA 2WC1A 2OHJA 3QE2A 2ZKIA 1KBQA 2GSWA 3N3BC 2ARKA 2QX6A 2FOXA 3HA2A 1AMOA 4QOIA 4C0XA 1F4PA 4OXXA 3OWXA 1CZUA 4N9QA 1GG5A 4PU0A 2FZVA 4DIKA 1C7EA 1AHNA
chains in the Genus database with same CATH superfamily
1H1TA 1OJLA 2VFAA 5KOYA 2ZYWX 3DL0A 4E03A 1GZ6A 5CU7A 1E2DA 2D5AA 3ZWNA 4MS1B 4OJTA 4YJ2B 3UMMA 3ROQA 3T5BA 4AJHA 4V02A 1SGWA 4WDRA 1KO1A 4M21A 3OPXA 4G8JA 4CUJA 4QRHA 3FOFC 4KREA 2ZBDA 2P6UA 2RHGB 4DSUA 1VJ5A 1XNRB 4BE9A 1A0OA 2J4FA 4D8VA 5CDHA 1E8DA 1KEEB 2OILA 2O7NA 3GG9A 3RK1A 4LX8A 4A0HA 4MB6A 3SHTA 3OY2A 2ZIXA 1C4OA 3BB1A 2XQIA 3C1TA 3LDUA 1KDZA 3M3HA 4TUYB 5BRNA 4AYTA 2NUAA 5B3KA 1YCHA 5JH7A 1AZSC 2GFQA 4Z4IA 2YMPA 2QL5A 4L2IA 5C1BA 2XCRB 4IIJF 3G8DA 1TM3E 4PW0A 3FX2A 3AF2A 4O2BB 4U3JB 4XB2A 2PUWA 1DKQA 3ND5A 4AWBA 4MVJA 3VDNB 3RJTA 5ALVA 3U40A 1Z47A 5EMJA 4U9UA 1Q21A 2TMKA 2QL9A 4W5HA 4KRGA 3VHQA 5BQXA 3UPTA 3UY4A 1LX7A 5CJJA 3DE3X 5BWCA 2DHDA 5AVUA 5L3QA 4IOMA 1Z0SA 1Q7CA 2DT8A 2Y1CA 3IXLA 4MHSA 3ZD7A 2V0GA 5LP6C 3K6SA 4IDOA 5WRFA 1I1QB 2J5BA 4B84A 2BT4A 4RKWA 4G09A 2AMLA 3U44B 3N74A 3UXMA 3TXAA 1W5SA 3D7MA 3DVAB 3DBHB 3HCEA 3AZOA 1RP7A 4MQMA 2ODPA 4KYTA 2YZ7A 4RMNA 4D5EA 4F71A 3NQ41 1K8QA 4D02A 4QGAA 4XGNA 3TSWA 3CX7A 4FI3C 4LXHA 4GO1A 4UM5A 2DFDA 4K3VA 4GYWA 3TTYA 4OQLA 1KZGB 3CVOA 3EZ7A 4PO3X 1H2HA 1F9EA 1N2SA 2RHLA 2G70A 4NCHA 1L4YA 1KR2A 3MLAA 4ND3A 1Q16A 2ORED 5AKXA 3SNKA 2VSQA 4QELA 3TRDA 5HGXA 3KSAC 1MX3A 4KE6A 2JFPA 4RTSA 4RZ3A 3VNBA 2AOUA 2XDYA 1I94B 3ACDA 3G2KA 3H8SA 2HV9A 5BSWA 4EHHA 1E2IA 1XUOA 3UMYA 3KXLA 4NBTA 4PC1A 2X15A 4Q3BA 3OICA 4D79A 5AM2A 1XNQB 2B82A 4JI4B 5IM4F 5I7OA 3ETCA 1RXCA 4OK5A 2DHEA 1L0BA 3M81A 1GZVA 2EOAA 4KQEA 2W4IA 4ZCLA 3LWDA 3QXXA 1ENZA 1P91A 4RBNA 1SCNE 1M8JA 3WAKA 1Z5UA 1RM5A 1XBTA 4QHSA 5EWJA 2BEWB 4IV5A 4YJ3A 4BMSA 5I9NA 3VDRA 3B1VA 4JR2A 3V7WA 4AKHA 1MDBA 4Q4HB 4BO4A 5JJCA 4KTTE 4K9LA 4AY3A 4H1UA 1I24A 1QZTA 2A5JA 4HZGA 3P2IA 5DOZA 3JCZA 1ZM3A 3HB5X 5EIXA 1VXRA 1IBSA 1CHNA 2EWVA 5EHIA 4DIUA 2XMSA 3TH5A 4F1KA 5EXPA 1GTSA 5CT6A 1Q0TA 1FDTA 2VDJA 5F7XA 3FDJA 2PWBA 4IJVA 4MNTA 1BS9A 4JAVC 4J3NA 1IAVA 1RHJA 1X15A 3AINA 2IPAB 4JUAA 1H2AS 3E2IA 4N7RA 3EOBI 4CYMA 5IVHA 2W6MA 4AMGA 3FWKA 3X1KA 5B6JA 3M8KA 4FNGA 4R1SA 4DV3B 1P6QA 1Y4ZA 4WH0A 5BQOA 1KDYA 5B64A 2ZIZA 5FYQA 1Z82A 3RYTC 2O1XA 2OBYA 4ICIA 4I4CA 3D2AA 1S2GA 3KL4A 5H9VA 1DAHA 3Q9NA 5L4SA 5KKAA 13PKA 2WG1A 2I3BA 1HDRA 4EJSB 2ZE7A 1YRWA 2PN1A 3UHAA 3I52A 1RLTA 5HG0A 1PL7A 4ITUA 1UDRA 4FZJA 4WBNF 1I5OA 1HDOA 5EGNA 4DMMA 4XEUA 4F3RA 3IFSA 3PQ4A 1TQ6A 1Y5RA 4H18A 1KI9A 1LDBA 3G0OA 3PHLA 2VZ0A 4TTSA 1YQQA 4IXDA 1NWCA 4EABA 4O5AA 3KEGA 2QP3A 5FFMA 3UHOA 2ZQYA 2R6GA 3BICA 4ZPXA 4U2DA 5B55A 3GJ5A 4LHSA 1AKWA 2ERYA 4EGAA 1G9TA 3G5TA 1ZLXA 2A0UA 2ZP1A 4OAPA 5JQGA 2P6OA 2GZDA 4RZIA 3UNXA 3FUVA 4BEJA 4DJEC 3NTOA 1WU7A 1TL7C 3VKHA 4F86A 3CUEF 3EZGA 3C3EA 4BDSA 1IY2A 3RK0A 1LLUA 3JQPA 2CD9A 1YR6A 3KPJA 3L3BA 2Q50A 2DHRA 4JVOA 2OFXA 4LISA 3DYIA 5E1DA 3SYNA 1JNYA 1AK2A 1G8HA 3G8AA 4ZRMA 5CXQA 1IULA 2QW8A 1O97C 3L77A 4NCBA 2GJ9A 1UDCA 1RLIA 1WD5A 3IOMA 3V32A 5CDTA 4IXNA 4ZICA 2VS1A 2J5KA 2Q4BA 3L82B 1DFHA 4NL4H 4EG0A 2RI1A 5ELXA 2VQEB 3LM8A 3O1HB 2PGIA 3C3BA 1ZJZA 1UBJS 1WXQA 3SR4A 3TAUA 5A4AA 1M8GA 4J0GA 1DOHA 4REOA 3VR6H 4RK6A 1K7FB 2HB6A 2W90A 4WXPA 3RSQA 4YRKA 1U3VA 1W29A 1JJBA 3HU2A 3SEQA 3U7IA 4ES6A 5JWRA 1GFWA 4IHJF 3PE6A 3RFXA 3RARA 1VJDA 3DBOB 1AO0A 5GZ6A 3SF0A 1KDPA 1VE3A 1MJ5A 4G0UA 5B3JC 1UKZA 2YHUA 3HWRA 3E7XA 1ZXBA 1YAHA 3QMPA 4QXRA 1YS7A 1EP2B 2NZ2A 3RIGA 4BGEA 1EAMA 3NCHA 1OUMA 5KDDA 2ZM5A 4RDCA 4YALA 4CM9D 4MULA 4PV7A 5GINE 2WINI 4D26A 4KFUA 4MGKR 2PYZA 4LWOA 4M8LA 5EPOA 3VSEA 5C5DA 3NHKA 1OSNA 3FSGA 3O1LA 3ITKA 1Q57A 2WBLC 5A9SA 2XVZA 1IPFA 4I4LA 4W5JA 5LZ7A 5IJ0A 1E5TA 3O3OB 1VSTA 1GQRA 1Z4OA 2CHVA 2ZUDA 3RS3A 3X3HA 4BLPA 4TKMA 4MJLA 5KYTA 1O0CA 1N2ZA 3K4PA 1RI4A 3L46A 5B30A 5HX7A 3VC7A 5JU6A 1HQCA 4ZANA 1YOBA 1DJOA 2QMYA 3CLRC 4RIFA 1B0UA 4B31A 2YWXA 1L5RA 4A7PA 2QBYA 2FPGB 1Y3IA 5IS2A 3JVIA 4M0DA 4TSKA 4E51A 1TLLA 4N76A 4R1OA 4KITB 2LNDA 2GCOA 3I23A 1Z22A 2A9JA 3KZOA 4GLFA 2PZEA 4PF1A 4F9FA 4NHOA 4RQUA 4F2WA 3MBIA 2P9GA 3RHTA 4FFMA 3OQPA 4FS3A 2G07A 4HQOA 1E1QD 2DP4E 3X0DA 5LMZA 2O0MA 2B8EA 1AK1A 1FUIA 4I99A 1M2JA 1DDGA 2WUGA 2QX8A 4FS8A 3W5JA 3FZGA 1X3LA 2GS9A 4CMGA 2WYWA 4C0JA 4V1CA 2VTVA 4ARZB 4TXJA 4V0ME 2ZJAA 1RCUA 4YPOA 5BQ3A 2ZWAA 2QWXA 1J0EA 1NN3A 3C43A 4NBSA 3UG7A 3A9CA 4WOBA 3KHTA 2XKJE 3HA7A 4QA9A 1G8JA 3JASB 2WE8A 4HYQA 1PEAA 5D5HA 3OCWA 5ALNA 1QYRA 1CCWA 4G85A 1YCGA 2VI5A 3GJ6A 1RPZA 4Y2GA 4M22A 1RM0A 3P4UA 3RKRA 2OC4A 3UHFA 1OI4A 2BGTA 2EFYA 2Q4DA 1A88A 2PEZA 1JMYA 1QRAA 2A1UB 1W4RA 2NLOA 2ZIWB 2PNFA 2Y0BA 1EDBA 1X42A 2ZBGA 3LU1A 2YS6A 5IWCA 3NM6B 3FTNA 3OI7A 2JBAA 4KVFA 3ORYA 1YOVB 1B14A 2H5EA 4IIYA 4HLUC 4GNKA 4LI0A 3PSAA 2AN1A 4JSYA 3PC8C 4M2LA 2XRFA 1WWKA 2ZBUA 3OJXA 4I66A 2QAGC 3Q0TA 2CHGA 5AKGA 1DJPA 1Z06A 1J8QA 1U2QA 1Z33A 3KT0A 3ECCA 4ZHQA 5ALUA 3ZOZA 2QTNA 4E4RA 5CH5A 3QTTA 1OYWA 3LUAA 4PLGA 5TQVA 2BFBA 1BA3A 1OIXA 5L7TA 1MAVA 1BEEA 3QEMA 2YVLA 3QE9Y 1Q0ZA 4WDQA 4S2EA 1XXHA 4CM3A 4CDGA 3QKSB 2P5UA 3JQ8B 4NBKA 4O4HA 5JDIC 3FFBA 3DHNA 1TZBA 1L3CA 1T4CA 3ZJTA 1DBQA 4CIBA 3MN1A 4NECA 2Q45A 4O1MA 5K0BA 2QP4A 3U62A 2O54A 5JCZA 1KMIY 2XA1A 3EWNA 3PQFA 4KR7A 1E3DA 1R0YA 3JQDA 3UCFA 3UANA 5EZYF 3UG6A 4UNRA 5JLJA 3G7NA 3DVLA 3UPUA 4JQYA 3B1ZA 3RSFA 1WULS 2B2CA 2B5VA 4JR1A 2QRGA 4XYLA 4FIDA 5AVWA 4BNHA 4QVGA 4HAUA 1PL8A 2FCRA 2OGSA 2GQ0A 2ZB2A 2FDXA 3PXDA 3A4TA 3PCXA 5DO9A 5K3EA 2VJOA 4UHJA 1O6FA 2BR5A 3AF4A 3CVJA 5J23A 1R6TA 3ZLTA 2I1VB 3TTWA 2Q5OA 3HRKA 3KTOA 3OQJA 4ZC8A 1V37A 2X2PA 1LVUA 1SELA 4CCAA 2WA1A 2NUBA 8ADHA 4OSOA 1RQPA 3TDKA 2A5DA 2J5XA 1WZEA 3GUUA 1T2EA 2JZOA 5THXA 4P36A 5DNVA 3X1ZA 4CF6A 4F45A 3IKLA 3K05A 4MQUA 5H81A 1GRVA 1R8JA 2OESA 3HB4X 1HL7A 3H4IA 3E9RA 3RYHA 1B1CA 4LAFA 4XUEA 5G4KA 2GD2A 4Z4CA 1ZC4A 2GN6A 3MQFA 1J09A 1DC3A 4ZQEA 2CV1A 3D02A 2V3CC 5JALA 2EXXA 2ZT8A 1O5OA 3MTGA 4WASA 3W5AA 2JDID 2ZE6A 3HSYA 4ZAGA 2UYHA 1Q1ZA 1EPUA 2BF4A 2F1IA 2Q8NA 3E23A 3P97A 4XIJA 1D4AA 3GFPA 2APJA 3IPRA 5TT0A 3OOSA 2BFDB 2HRCA 2QRLA 3IR7A 1SC3A 4IVQA 5AJVB 5AXCA 1ZM4A 3CLSD 5K3SA 3C3YA 3H4MA 3BREA 2E1RA 1L5FA 2QN2A 1AQIA 3M6MD 4H7KA 3D8SA 1BMFA 1D03A 1TO2E 3IIKA 2Y0PA 2H52A 3NWEA 1HLGA 2R1ZA 2BFPA 3F4BA 3QVXA 3MBKA 5KMGA 2DLNA 3L7OA 2WYUA 4KQGA 1JDVA 2LV8A 4C7VA 1YU9A 1YUNA 1PEDA 4E12A 2WM9B 5DSTA 3LUKA 1W0KA 1Z4IA 2Q9CA 3O03A 4L4YA 1I3NA 3HCCA 4HCJA 5IVPA 2NMVA 1GZDA 3DJFA 1A95A 2VYVA 4L4ZA 3LBIA 4EF4A 4AAYA 2R11A 4M86A 3AXTA 3PWKA 4EVRA 1Z6QA 4L8FA 4XQCA 2J4CA 1R64A 4MR9B 1VE6A 1L4HA 2Q1UA 5F2KA 3OF5A 5FPTA 5FUBA 4I4TB 5LA6F 5B12A 5CA1A 4RMHA 1EFRD 2IGBA 3QJ5A 4ZAYA 4Z6KA 4JJKA 2B1RA 4KODA 1DPGA 3H2KA 1ACJA 3F8WA 4H9GA 2FXIA 3GH1A 2QDXA 3A3KA 4MUNA 3HB9A 4OBXA 4UNNA 2WTAA 3RBXA 5COAA 2GFHA 2REXB 1GGVA 5B2ZA 1N78A 1ODFA 1RWKA 1TM7E 1YACA 1X2EA 5L3RA 4AWAA 3ZDEA 4JJGA 3BK2A 1XZPA 5JXGA 1EJ6A 1BFDA 1YIAA 5LSAA 4KJXA 4E11A 4FHGA 4K9SA 4PNHA 1O5IA 1Z0FA 2YY7A 3A32A 4GF5A 4N7MA 1NLFA 1XHEA 3IILA 1YDFA 1ZOSA 1B8NA 4U7WA 3O90A 5CP8A 1RJ9A 1TYBE 1WABA 1JDJA 1VJRA 2ES4A 1DELA 1FZQA 1NJFA 3CA8A 4ZYZA 3WIBA 2XNDA 5T8KC 1RXYA 5DM4A 3TQCA 2XUGA 2QUHA 3AY6A 3PX3A 2G3YA 3BEOA 4ENQA 1DIRA 2DKOA 4DMHA 4WBSA 4E94A 1WPRA 5BW5A 5EJ4A 521PA 3M4ZA 3D5EA 1VDZA 1WB4A 4FT2A 1SY7A 4NPAA 1G7TA 2IDMA 3VC3A 4KR3A 5F52A 1CQIA 5JC8A 3GLGE 1VHWA 2INGX 3CZ5A 1FU8A 3AHJA 3JX9A 1QH0A 4HWPA 4ETWA 1HZJA 2AFHE 3ETHA 4RQTA 4JLUA 3C1OA 5CYFA 1INLA 2NTJA 3ZBQA 1UOEA 3SM9A 2XA2A 1G6Q1 4WKPA 3FNBA 4P81A 1S1MA 3KHUA 4NYJQ 3HV0A 2C8LA 4YT5A 1JT2A 3F46A 2WMYA 4IVRA 2R1TB 2K87A 3G89A 4MVJI 4MQFB 3DFFA 4OHFA 3RYCB 3CF0A 2B4AA 4X7MA 2P6MA 2IZ7A 4JU9A 1EDOA 3HY4A 3LT0A 1KTIA 4DIOA 3ENKA 4I9NA 2BJWA 1LBIA 2JGEA 3WWCA 2NXCA 5C3UA 3L6UA 1Y6QA 1YRYE 1CIJA 1HH4A 4JIMA 5CX1A 4M9RA 1ZOPA 2WU1A 1Z07A 3GD5A 1I3LA 4GWKA 1CS4C 1RLUA 2FF7A 1P7YA 2IIQA 3T54A 3CSDA 3K6KA 2WWIA 1W8DA 4ZU3A 1RRCA 2VPZA 3WBJA 5NLLA 3MWYW 4WLEA 3KDPA 1QVRA 3JV7A 3GQVA 3Q5GA 4CL0A 5IJWA 3U48A 3DM9B 2DUJA 2V4UA 3NT4A 2D4HA 4EG6A 3WGYA 5A4KA 4CCYB 2CJFA 3GZTB 5AW2A 3LY9A 1D9ZA 1EX9A 3F7TA 1ZLYA 3MFQA 1L8LA 1KMCA 1MO3A 2GO7A 4JNCA 4CEJB 3NEJA 5GGXA 4MWTA 3T7IA 3G8CA 1EU1A 4UPEA 3AP1A 2BELA 2YN4A 4J9VA 4N5NA 5TQJA 4CCSA 1TI7A 2Q5CA 4BVHA 2BEVB 3CMCO 2XF8A 2QUKA 3KJZA 1A4IA 4RZQA 4U2CA 1Y34E 2G5CA 3CPSA 3MCVA 1L7BA 1L1FA 3ZXIA 5A4FS 2IS2A 1EFVB 1H93A 1N5IA 1CIPA 1QQBA 1F0KA 2F3SA 1JWAB 3FKJA 3CLUD 4M87A 4E5KA 3PFIA 1ID8A 3W5IA 3L7KA 2ATVA 3F96A 5IN5A 4D9FA 3IEMA 4Q12A 2DU8A 3IOBA 2FUCA 5LU8A 3WYFA 1FYXA 1EX6A 1P6UA 2R6DA 3FLMA 5IJXA 4AF7A 1GQYA 1NULA 1JU3A 3MTQA 1KO4A 1YQEA 3ET4A 3FDZB 4RU1A 4I4NA 4O0MA 2O2ZA 3LW8A 4UPDA 4PAOA 4YR7A 3EC1A 2VAWA 3GA7A 3DWEX 3HLYA 3MIIA 4NCXA 1P4HA 1T35A 3WI7A 4CM5A 3K1AB 4PLZA 2RH5A 4HGQA 5DISB 3NC1C 4AX8A 5IYZA 3BMOA 1AGPA 2RK6A 1DRKA 2XEDA 2B7LA 3JYHA 3KB8A 2PVCA 2HLHA 5KSOA 1AA9A 1AUOA 4ASUD 1ZN9A 1N2IA 4MDFA 4BN5A 1FTWA 3EGCA 4W8OA 3AKZA 3GGPA 3ZHZA 2EZTA 2ODNA 1TTPB 4QUDA 4TV8B 4X92A 5KJEA 3U1BA 1FPMA 5EC8A 4XB1A 1SC6A 1AKVA 4WZBA 1GA1A 2A9PA 4PSCA 4MDHA 3RSSA 1LB1B 3C3JA 1HI9A 1IN6A 2ZLBA 3LRPA 4HLDA 4PYRA 5K3FA 2R8YA 1KAQA 4RGYA 2NSHA 2YOFA 3KCQA 2IYYA 1EEXB 4H1VA 2GEBA 3I0ZA 2HI0A 3S2GA 1VJGA 3LLUA 1FYVA 4RD3A 4BBJA 4ZN6A 2WM2A 1JIUA 4DLNA 5EQTA 2EQ5A 3DZKA 1NSTA 1KGSA 2OGUA 2JLXA 1SULA 1A69A 3AK4A 4M9SA 2OXEA 1YGYA 3NH9A 3EMVA 3TW8A 3MJDA 4CE6A 2YN2A 3FYDA 3E84A 4FDMA 1A8IA 3OLCX 2B92A 4C6SA 3FGNA 3I2JA 1GZUA 2DQYA 3WGQA 3TTUA 3WLJA 5C32A 3OPMA 4UTXA 3EEFA 3INGA 3IE0A 1O89A 3U1VA 1C50A 3AF5A 4P82A 1D5WA 3UMBA 1DPFA 2Z43A 4NBRA 2Y0DA 4XRRA 1NXOA 2H29A 4IQ4A 1L4NA 2BLLA 4L22A 4MUXA 4CZ2A 1DKPA 2R5NA 3OE4A 4MQBA 5BNFA 1RMTA 4LZZA 2UYQA 1Y9AA 1X8LA 2NZUG 4OOEA 2EGGA 1QSGA 1J5EB 2VG8A 4GWGA 3TQSA 3BXXA 2ZBVA 1YUBA 3AUAA 4QXQA 3U81A 2HU8A 1F9AA 1RWBA 2XBLA 3FI0A 3DF9A 3IV9A 4TLLB 4K6HA 1JZQA 4XVUA 4NS4A 4CGZA 1KE1A 2KHZA 1TCAA 1JI0A 2LKDA 2GTHA 4OHBA 1OI7A 1E0AA 2IKSA 1EI9A 1FFXA 1ZU5A 1UWKA 2FEMA 3Q40A 4ZWNA 3UA4A 3OTIA 3TE6A 3N6RA 3O74A 3E1SA 1BCRB 1TJ5A 4AUMA 3PQ7A 3GDFA 4I2NA 3EVDA 4PPYA 4Y1RA 3ICPA 4UUBA 3TGLA 2QNIA 3D8RA 1TYAE 3BC1A 1RTKA 3CX3A 1T4GA 2FPKA 3HYTA 3OUZA 3L0YA 3NC4A 3A6JA 3LFHA 2J67A 4GXRA 2VSXA 5EFOA 2J6HA 3ZWWA 4EUHA 3ZLBA 2GOYA 4G41A 2BBTA 1ZYUA 2Y68A 3INRA 2GEFA 1YR8A 1E5VA 2OHHA 2QRUA 1TADA 2QF7A 1XZEA 5FLXA 3QF4B 3ZJ4A 3AB3A 3F7MA 1YB2A 2X0EA 4WESB 4Y6SA 3E27A 2IE0A 2EKBA 2NM0A 2JJ8A 3F97A 4E07A 1U81A 4FEGA 2OSBA 1VLQA 3P9XA 3QYAA 3B5EA 4OJYA 3SS8A 4KQMA 1DKLA 3AQIA 3VQTA 3PX2A 2CZCA 2VK8A 2H4FA 3U0VA 3BQMB 5JAQA 2NSYA 3OA2A 2Y67A 2PY6A 4B7CA 1JQ5A 5AVZA 3FFXA 4B6RA 5I8ZA 2OO5A 4JC8A 1EM8A 5MFZA 5HW0A 1FQWA 2X41A 3FFTA 5KBYA 2Q1YA 3VZDA 1GWNA 1U6IA 1RZ3A 1PGNA 2XIQA 1E3WA 2QR5A 1BSVA 3FMGA 3LHSA 3RVMA 4XM2A 2H1OA 4KQCA 3CLTD 2IF0A 2P2YA 1LPSA 1XN1A 3GJTA 1CV2A 4KDEA 4N1AA 3RREA 1M8FA 4AQYB 5KYWA 3TX2A 1VDMA 4JV5B 2L2QA 4ITVA 1XA3A 4V1CI 3QUCA 3VH3A 2JFFA 4XRGA 2GPAA 2NZXA 3N0TA 1V26A 4FKMA 3EFBA 2JLYA 3HC7A 3T41A 1IN1A 4JX9A 3TLGA 4ETIA 1M7BA 1O5TA 2V97A 3CEMA 2HRQA 3FAKA 5M3BA 2PR2A 2NQ2C 2RKOA 1X19A 1Y8RA 3N2KA 4LGYA 3RE1A 1UDXA 3SVZA 4PSKA 5FWAA 2XXAB 4ALKA 1N5DA 2IYQA 3AR7A 3DGFC 1JDZA 4TKUA 4DWWA 3K35A 3MHPA 1X38A 4Z4GA 1VMKA 2ZWMA 3LZ6A 5DIZA 4S05A 1BQ3A 2HNBA 3QSYA 5LBUA 3PQ5A 2HXYA 2QZZA 4WNAA 2GEDA 2ACVA 2Z08A 5FBRB 1M1YA 2HK8A 5AHXA 5HKOA 1XQVA 4NEGA 1U65A 1BC5A 4AO6A 1U94A 5JQGB 5GV7A 4L27A 2HRBA 2WKQA 2Q9AA 1UBTS 2YHSA 3TVDA 2FX3A 4MJXA 1QK3A 3N8GA 2AS0A 2I76A 2PDAA 4NQRA 3CUVA 4EO4A 1MIOB 3VU8A 5B1EA 3U5TA 4B17A 1P0QA 5JSYA 1ZH4A 3F5FA 4IIFA 3GQBB 2FDRA 1VYVA 3BHJA 4UCWA 4X61A 4KK4A 5EWLA 2C1XA 4UBOA 3UA3A 4B73A 1V5GA 5KQSA 1M10A 2LKCA 5HKKA 1YZQA 3CEHA 3OHPA 3SS7X 3C8ZA 2AZDA 3LWZA 3A1DA 5JZSA 1ADFA 3NTQA 1QQ7A 2NU7B 3LVRE 4X95A 5ALJA 4WFIA 4D5GA 1A98A 2BZ0A 4IJ5A 2ZUFA 2XKKA 5EXXA 2G0NA 5C80A 3NS7A 2AI1A 4G4SO 5H4GA 1TAQA 1Z4JA 1H0RA 4FDLA 4HRVA 5E7JA 1KIFA 1O9BA 2FMTA 4MYRA 1E1CA 2PTGA 1QVWA 4CRWB 3N2GB 4FD2A 4F9EA 1D0SA 1YV9A 2XTMA 3QLEA 3X1WA 2G9RA 2PXAA 4XD7A 3CEAA 4GOOD 2C7BA 1RBQA 1NRJB 1XAGA 3VZPA 2AF4C 4QGHA 3GZ4A 1WE2A 2YC2C 4JB8A 3IR6A 2FSSA 3G2LA 3H5NA 3ZDFA 4B09A 4CNBA 4CTOA 2VXOA 4ZIRB 2XF2A 2PX4A 3H18A 5JPIA 5B4UA 2AYYA 2EJTA 2ZSFA 1H23A 2KMLA 2NO5A 3MF4A 1VIMA 2PSSA 2ZCUA 4LYFA 1ZWLA 4RABA 4JI8B 4JMPA 4EEZA 2WPDA 2ZSKA 3PXCX 2I78A 5IF3A 1RACA 2PYDA 1UP6A 4G5QA 4MGZR 1O4VA 3ZY2A 3PIIA 1QQAA 1TF5A 4JT9A 5A9RA 1S2IA 1PZXA 3KKMA 1YJQA 4P86A 4R3UC 2W6PA 5EZSA 1RXIA 3EXFB 2QLLA 3TAHA 4OFBA 5GP1A 3UKDA 4MITA 4WOJA 4GMDA 2O0LA 4UUNA 1QTNA 1ECLA 4FMPA 1VYTA 2OBXA 3EE6A 3GCXA 2D8MA 3IMKA 1KZ7B 4MIKA 3ET5A 5C0OE 4RMGA 2B7CA 3VR4A 3ZWCA 4BNXA 1UJNA 3GRYA 3D6UA 4L0CA 4AN4A 2Q46A 2I7DA 3U3ZA 1XROA 4RQAA 3EIXA 3KT8A 3RUCA 3ZW7A 2I3ZA 3HXLA 5SV2A 4P3NA 4FE3A 1G60A 1DCFA 4OFXA 3I39X 1Y5NA 3P9KA 3SR0A 4BNDB 3GLKA 2I8LA 1JHMA 3R75A 2OTCA 4OQXA 3CNLA 4DADA 3LYAA 2BBOA 4TV9A 1K7CA 2JHFA 4X1IB 1XZIA 3RH0A 4U2EA 4P4SA 1FPQA 3R0JA 5EIHA 3H97A 3TB6A 2OP0A 1ZOIA 1K68A 2XD4A 4IXMA 3X43A 4AZTA 1E1MA 1T3HA 1FLAA 1HM5A 1UBUS 1L5GB 1L4KA 1MC4A 4BGIA 1PD1A 4RANA 1D8TA 1N2CA 1W88B 1Q77A 1JTVA 4N5LA 2HDNB 4A23A 4LZWA 2CD7A 1I3KA 4HG2A 1WF6A 2QTVA 3Q6NA 6CHYA 1CVIA 2FHPA 1DUSA 2P30A 3RUIA 5JCXA 4PM4A 2XOKA 4Y1FA 4CL8A 3LX6A 2VIIA 2B37A 2VSNA 2ZIEA 3A26A 3ABIA 3FCXA 3KTAA 4R2HA 5J2TA 1S2NA 1XG5A 2WABA 2OHVA 4OM8A 1M2WA 4PS1A 5CXXA 1DCKA 4F60A 5JH7B 3LPCA 4BWVA 1FNCA 2JHAA 2W6NA 1M6YA 4JGGA 4LDQA 4PBRA 3NBAA 4GM1A 4RPJA 1BZYA 3PL1A 4ZAWA 1X7YA 2PPVA 2IU6A 3L7LA 2Z4TA 4KLAA 1Z2OX 3JD0A 3DMTC 4Y6OA 4IJQA 5ES3A 2AGVA 2I91A 2HBYA 1KDVA 1SXHA 4WOPA 3BWVA 3I37X 4QDJA 5E9WA 2X1LA 3KYCA 2O8CB 4PCVA 5CW2A 4CLEA 3C39A 2VF2A 3ONDA 1O94A 2K2WA 1RRVA 3L8MA 1KU6A 4OHMA 3AEUB 4WE3A 1W52X 4KIJA 3WJ1A 4X84A 3UC5A 4RADA 4B6GA 1TK3A 3GLFA 1PWZA 4UE3S 1BX3A 3CG4A 4HZUB 2OCPA 4PR3A 3CVXA 1ZP6A 5H3CA 5I8WA 5DHSA 1B8UA 4MV7A 1EGMB 1JJFA 1Z56C 1MO4A 1XOIA 2VP6A 4WUVA 3AL0C 2NQ8A 5CFLA 2QP9X 2X14A 5IKEA 5IT5A 2R2GA 3OZDA 3FYUC 3R7AA 3WVNA 2JAOA 4I50F 4EX6A 4QNRA 5LZ2A 4QTYA 4H4EA 1THGA 1J5PA 1JR3D 5K6AA 4FKZA 3KRTA 1JBKA 1CR4A 1PX0A 2MYPA 4IMPA 5C8YB 3BHIA 1ML4A 1QHXA 2XTJA 2YIJA 3IT2A 2C0QA 3DCJA 4GX1A 2JJ2D 5I9BA 1C80A 1XU4A 2O2EA 1ZN7A 1V7ZA 4Q05A 1HORA 4DRXB 2YIVX 1F06A 3S2SA 4AJJA 4OHYA 5KX5B 4D4IA 2BJVA 4JVSB 4ATNA 2BHLA 1VYHA 2EBWA 2Q0XA 2IYUA 4QXAA 1K6JA 1Q83A 4Q1EA 3NONA 5ANRB 5AW0A 5F51A 5CA0B 4DR7B 4GYKA 3WL4A 1CLUA 2Y27A 3JQBA 2OXIA 4AZ0A 1FS4A 5AUNB 4LHYA 4QIHA 3KQPA 1XVIA 2MSCB 3OTQA 2N47A 5FBVB 2PQMA 1EXDA 1YMVA 4FFPA 3FBGA 5DHAA 4LFCB 2F3QA 1MGOA 1O8BA 5C8XA 3GRVA 1QJ4A 3Q5EA 4F91B 4G1EB 2IW1A 1VPEA 3F3KA 1E6LA 4L08A 5AI8A 5FQNA 2NU8B 4RZ2A 1BX0A 1XEWX 2FR1A 2VPWA 3RYIB 3QVWA 1CDOA 3QVVA 3WSWA 2GBFA 4UQLA 5IJ9A 4FHFA 2R4TA 2UYCA 2IYFA 1GN9A 4KMOA 2XQGA 4B3GA 3SKYA 3DGEC 3KXDA 3SSNA 3FG9A 4N0DA 5BRAA 1DV1A 1R4ZA 3PRKE 1TAGA 1A2BA 3N7AA 5ALMA 5CVTA 5DLEA 3BGWA 1E9DA 3NHZA 3A06A 1LQ2A 3A9SA 4N5DA 1NGSA 4MDYA 4AIIA 1CY0A 1PZGA 3KT3A 5A03A 1YBAA 1MZPA 2FGKA 3T7RA 4C78A 3GZJA 3OOHA 1P18A 5LPNA 3BEDA 1Q2XA 3FB4A 3EBOA 3TCXB 3HDJA 5FNVF 2P4UA 1DXHA 3L01A 4MIOA 3DE0X 2AD5A 1KIMA 3FZQA 1F4PA 4LZNA 4EKYA 3B2EA 4UAJA 1XZDA 4ZOAA 3TJZA 2BTEA 3IIJA 3M1IA 1RKUA 3TF5A 3SIWA 3GELA 4IDHA 4NYJR 4O25A 5K01A 1COWA 4A1OA 3PEFA 1E32A 4LMAA 2DM6A 3DEJA 4MV8A 2DCUA 3P19A 3KB6A 2BGIA 3L02A 4YAIA 4UNQA 4M1MA 5IPFA 1YCDA 1TU4A 3QH4A 5JAHA 4RLFA 2CKDA 1ZY2A 1IN5A 1KMQA 4UTRA 3M34A 1Q2UA 3BKXA 3OTWA 3T9EA 2X2FA 2V03A 4EW1A 5L45A 2W42A 4IIJB 4MO2A 3UOAB 4J0FA 2M1ZA 3FTCA 1G66A 1XTPA 4JHXA 1YZGA 2H63A 3F9IA 3L7NA 2DSNA 2ORIA 4PICA 1EFAA 3ANLA 3NHPA 3ZK7A 1JH9A 4WSOA 3NWPA 2YRFA 3QWHA 4GLBA 1GOTA 3L49A 1R6BX 4D6YA 3HHPA 3E9EA 2OLJA 1SVNA 2D0OB 2MTBA 3CG0A 3P0IA 3R6WA 2I87A 1W4AA 4UHHA 5CA1F 1NW3A 2JS7A 3BAFA 4IG9A 5TNXA 1KO8A 3Q2IA 2V45A 4K6KA 1CP3A 3PNQA 4RMIA 1NRXA 1P4RA 1NTRA 2OWEA 1KFJB 4W4TA 3GT3A 1CVLA 1O3YA 3EY9A 4Y9DA 4ZOLB 1FDWA 1C0KA 5FWYB 2YYAA 1FLNA 1YB1A 1R2QA 2X8AA 3CPEA 1JKIA 2AMJA 3I1FA 3QFFA 1CY1A 3R3JA 1Z5NA 2A9OA 1R50A 3BB4A 5LLSA 3RF6A 3WIVA 2O8FA 4DUGD 2ZSAA 1KH3A 4D3SA 1RWNA 1Q91A 5D01A 3V9AA 2X0JA 2Y66A 4AJKA 5HGJA 3JQ7A 2BGRA 2BM9A 3JTEA 3O73A 3LGXA 1BN6A 1NQAO 3N58A 4QJ4A 4FJ0A 1JG6A 2VTEA 2PWPA 3FCSB 3G0GA 4Q4AB 2XI4A 3KOWA 5DE3A 4EFMA 5HPYB 5H8WA 2C3MA 3G68A 5KNBA 2NOAA 4C7BA 5AUQA 3W8NA 4RVSA 2PXCA 3DMDA 3M6VA 1L5SA 4RIGA 2WIBA 4JT8A 4HJRA 3ZHRA 1W36B 1AE1A 1T43A 1WUKS 2L17A 5JJKA 2AYXA 3NIGB 1IEVA 3JAKB 4KPUB 5JXWA 4M9XA 1V1MA 3OHMA 2E4UA 3O8CA 2OWDA 4PZCA 2C4VA 3WX0A 4HDMA 1OB2A 3GMIA 5KIAA 2LIPA 2PBZA 3FTQA 4LOAA 2AMYA 5DDIP 4C03A 4DYVA 4EITA 3M3DA 1KFKB 3B70A 4LA4A 1VKZA 3CJQA 5G0VA 4FNAA 3BMQB 1W7AA 3V8MA 5GQSA 2HJ9A 2W2MA 3HH8A 3NTUA 3OEED 3PF9A 2QJWA 1NT2A 4I9FA 3RRJA 4UOZA 3LF1A 2BEKA 1MN6A 3FF4A 4U5XA 1AHPA 4INAA 2WFLA 3FCOA 2C07A 1MJHA 2NPIA 3G2HA 2YBEA 1A9QA 4PRYA 1QCDA 2AOTA 4PANA 1OZHA 1UOOA 4OPMA 1RQXA 5HQ3B 2ZIGA 3FPGA 2XB8A 3NASA 2GGSA 3EZLA 3PEUA 1ORTA 5LMUB 2FETA 4UU1A 4JJ8A 2MSDB 4UUMA 4EGSA 2Y2VA 3AO0B 3LA6A 4XARA 1YSCA 2QQ0A 3BMNA 3RS0A 4Q3NA 2W48A 1RYBA 1W5BA 1N6PA 2JGRA 3LKBA 3P0EA 4KU4A 4S2UA 3ED1A 5DTRA 3VPHA 1OOEA 2ZIAA 4V0RA 1KKUA 1LPNA 4YCJA 3U4DA 4BU0A 2XB2A 3EIHA 3QNMA 1NRIA 1QF7A 3R20A 3CVWA 2HWKA 4E3ZA 1C9KA 3JD1A 4P08A 1WHTB 2CC2A 4MW6A 2I6QA 2PKEA 3RLFA 2QENA 4RFSA 5EWMB 1LK7A 3ROGA 2CXPA 2VDOB 3UJBA 1P7VA 3R7LA 1DIHA 1YZHA 3ZE0B 4V2UA 1EJ2A 1RADA 3HB0A 4DBLE 1AH2A 1IOZA 3WK6A 5KQLA 3PDHA 1KH1A 2KJQA 4FLEA 2VHYA 1RAEA 2MR6A 2FJPA 1WDKA 2IYEA 4Z2AA 4PRKA 3KJEA 3FVRA 3TFWA 3VU9A 4Z4HA 3B8HA 5A5EA 2Y8EA 1AS3A 5BSEA 1Z6XA 5DGDA 3OOWA 3H9EO 5JSZB 4V0NA 4PEVA 5LQUA 2GD6A 2RD2A 1DO2A 1NVBA 2XX3A 3AETB 3G0DA 3WDLA 3IKJA 4G5OA 2UUBB 2O8DB 2C83A 3DL2A 1UPFA 3OBBA 1HETA 1IHDA 2NSDA 3I05A 3O8RA 4PG5A 5G3YA 2Q7DA 3NB0A 2Y05A 1E6MA 3AJDA 2VLIA 1ZHOA 1Y6RA 4KOEC 2BY4A 4CIWA 1HTTA 3VUEA 4F4IA 1I4DD 1D6NA 2HJWA 1D9XA 2WF5A 4MMXB 4C6RA 3D4IA 4OL0A 2PAAA 3IGFA 2CN1A 4PZEA 3X2FA 3HB7A 1JQBA 1M3SA 1PHPA 4D6XA 1CJTC 1OXVA 1Q0SA 4PSUA 4XYBA 3TJRA 4DHWA 4YV2A 2JFBA 3I5MA 4ZP1A 1E94E 5L8VA 2C5SA 1X1AA 3ZXUB 1QWSA 3KWJA 5DYYA 3GBSA 3IVAA 1GPLA 1XNGA 4G4SP 2NVBA 4N7BA 2ZU0C 3VTZA 2LD4A 1Z3IX 4ZZ1A 1U31A 3OJFA 4MVJP 2I8CA 2GZAA 2WNIA 3NBYC 4JXJA 5AUOB 1D2MA 4XH9B 3NEYA 1ZGHA 2QDKA 2F6RA 4C6HA 4F4DA 3AHGA 4G23A 2R25B 1R0LA 5DI9A 3U7QA 1RJEA 2HCRA 3NP7A 1BHQ1 1P19A 3G5UA 4DV2B 1LW6E 1VSBA 1SQFA 1P1FA 4CLXA 2I54A 4Q47A 3RB8A 2D2VA 4QUBA 2BMFA 1ZVVA 4JH0A 4DN6A 2WMDA 2OEPA 3AVXA 1MB0A 3JAWA 3PDCA 1AS0A 1EK2A 1B8OA 1DX4A 3CLRD 3LPMA 4GI3A 4QICA 2GM9A 1XQYA 2EBFX 2X4GA 2J33A 4R68A 4WPGA 5EE9A 2NIPA 3ZU5A 4W5TA 2YICA 3FNHA 4UDYX 2KE5A 2ANBA 3OQIA 4KQJA 4M1EA 5EHXA 3GEBA 3ERCA 3KAJA 5DU2A 2DWUA 4CDNA 4WZAB 1GEGA 5CDFA 1X2BA 3VU0A 3GPLA 4RCVA 4KHPB 3GFFA 1DX6A 2QM7A 4LGMA 4H7DA 2CNWD 4EVIA 2B83A 2IY8A 1P8AA 3VVLA 3FFWA 4JDUA 1RZRD 3FSEA 2D6FA 1U2DA 1N3YA 4RF2A 3U49A 3L6DA 2YWHA 4KIFA 2QR2A 5J63A 3GLQA 721PA 5JASA 3D8HA 4AXBA 2DWOA 3AUYA 4DLWA 1DOAA 4MHTA 1E3TA 1YCFA 4RPGA 3U31A 3AOEA 5EL0A 4ECEA 3P27A 3CB4A 2JNWA 1JW9B 1CBUA 5DBEX 4CHGA 3G49A 1V4NA 2ZATA 1JWLA 2W6JA 1UEIA 3GDHA 4PX5A 2RGDA 3NR2A 5K0NA 2XUOA 3VR3D 2GBLA 1E92A 3H19A 4M9CA 2Y0EA 1KY5A 3GEEA 5K09A 1BMDA 1Z25A 2RGXA 2QN8A 2ZYSA 2GKGA 4WD3A 1UT6A 5ESWA 2IK8A 4HNUA 4HS9A 4UU0A 1WSWA 3ZV4A 4BDTA 3HR8A 2YQ4A 4OIFA 4CG3A 5SY9A 1REQB 2O8EA 1C9JA 1W9HA 5JZVA 2WAAA 1YD7A 4WLVA 3M82A 2H2IA 2FQ1A 5JJBA 1HYEA 1AV7A 3I76A 1WM1A 3EIOA 1AKNA 1O96A 1XDGA 2AJTA 2YXDA 4H4DA 4O2AF 3DMYA 4HP8A 5JSHA 4W7IA 2VTBA 3D2LA 3RK4A 1QX4A 1M2OB 3DEZA 3LWNA 2XMRA 1U1DA 4JT4A 3VSAA 2YFQA 1OLOA 2ZI3A 4MA5A 4JLAA 5BW6B 1OHHD 3HBAA 4M99A 2SECE 4U6QA 3RHFA 1KAOA 1DWPA 3GJQA 5J5AA 5JYEA 5HS4A 4M7PA 4EW2A 5IHXA 2OHIA 1T1SA 4P5EA 5KWEA 2IFTA 1ESEA 3NGLA 3S44A 1GT91 4ZTUB 2G06A 3IS3A 1J2YA 4I0WB 1R1DA 2R66A 1CW2B 1DC4A 1BXKA 1GFZA 1K0FA 2VUTA 5DBIA 3UO8B 2JBWA 2FQQA 4EDFA 1CF4A 1FFDA 3CZRA 3FYUB 4LC1A 1VB5A 5EZYB 2O1EA 3KQNA 1V95A 4UFNA 5ALWA 5F2OA 1PNQA 4QPNA 1BXRA 3TLMA 4P80A 4RZUA 2JLQA 3RJ5A 3HKEB 1HOTA 4NMHA 4PCAA 3GEGA 3BXGA 1PR2A 1XPRA 1I4TD 5BSFA 1VIYA 3KQUA 2A3NA 2C99A 1K5DA 1Y9EA 2OOKA 3ML1A 5B3LA 3ENVA 3UJ9A 4LKRA 3ZWQA 2XDWA 3AZQA 3KQWA 5CURA 3A2LA 3QG5A 3CX6A 621PA 4GBGA 3H0KA 3LHKA 3P9ZA 2NW6A 1HDEA 2YXEA 3B36A 1YC5A 1DC8A 2PMBA 3RS7A 3ANSA 2D5CA 5FFNA 4D2IA 1FBTA 1SXJD 1O6ZA 2I0FA 4FEEA 3F1LA 2BSXA 2CSUA 3BDIA 1SHJA 1GVHA 4GC5A 5AYVA 2WD7A 3R8CA 5L3SB 1LH0A 5INTA 2OCGA 4BO3A 3KVOA 5DP2A 1K97A 2C9DA 4AKIA 4JBLA 2QYSA 3PPXA 2ACWA 1G3UA 1LWNA 1QX3A 2BR3A 2QN3A 1KF0A 2VHEA 1RKBA 3T0IA 1NUHA 1J22A 1HFWA 3QLUA 3TIIA 3PLAE 3DBIA 5CLFA 5KNCH 4KC0A 3AHHA 1JYEA 1P1RA 2X23A 3BXFA 5EESA 2P79A 4EI7A 3NGMA 1E9EA 3NTRA 1IK6A 1C30B 2LPMA 3BRCA 1P2BA 3CLVA 4WQMA 3SF8B 1JFVA 4B6FA 1JFLA 1Z8DA 2C03A 3N70A 4GRAA 4RYDA 4MLCA 1C3XA 4KP7A 3T95A 4A3SA 2A6PA 2B4YA 5A0TA 3RSCA 1P81A 2CLIB 4R81A 1NDQA 1SBHA 3WIEA 5C7IO 2DFNA 1KS2A 3T3OA 2FYTA 2NSLA 1Y80A 1U8EA 1QGAA 3V1NA 4KQHA 2UVQA 2G7MC 5A9TA 4B83A 4MDEA 4XJVA 3T5CA 3AVPA 3PGMA 4KYIB 1CTQA 1OFVA 2ZXFA 3KU1A 2VNAA 4N3NA 4ZU1X 4BWGA 2OBFA 5H7XA 1XRNA 1L8XA 3W34A 4DDVA 5BQPA 1JI3A 3VR5H 2DTEA 1S2LA 2O4UX 1SOWA 4QREA 4TMFA 2Z2JA 2D3TA 5EHGA 3PUZA 3VGJA 2HUPA 5LYJF 4G5SA 2ZAYA 4XYMA 3ICEA 4DG9A 2AR7A 4C07A 4PN3A 1L1RA 1WCIA 4BNMA 3SKXA 8OHMA 2Z2XA 2B20A 2XCIA 3H5OA 4RVOA 5KVAA 3KLMX 5BVGB 2AYZA 1E9RA 2ERCA 4ZI7A 5EERA 4ZMBA 2P9JA 4I5GA 1KFBB 4OA8A 3PICA 1FJHA 4YUXA 5D7NA 1KFEB 4L0QA 5LA6B 1CD5A 4URFA 5H80A 5BMVF 4JT2A 1Y8ZA 1P9LA 2JK1A 4ESVA 4L07A 5KB3A 2SKEA 2Z6QA 2BDTA 1U1FA 4A6PA 2H3EA 1Z0UA 1WRBA 1N32B 3BKWA 2DHCA 2AG0A 1T5SA 2J3DA 4AJ1A 4UM8B 4UMVA 3I9MA 3TMYA 1ZL2A 4RVFA 1IOLA 4UMEA 4Y9TA 1P9WA 2H2FA 2X58A 2WDZA 4CM9A 2AIRA 2PKXA 4NTZA 1QDEA 1XPOA 3LOQA 4QYSA 3BMCA 2CXUA 5MN5A 3KTDA 1KQFA 2OPBA 4TLAA 5HIIA 5JI2E 4IEEA 4Z3DA 3LQQA 4JEIA 3B2NA 3WLRA 2NWQA 2YHIB 3JZIA 1N77A 3F3YA 2J7KA 1C1XA 1SOUA 4L9SA 1E79A 1Y98A 4C7KA 3O1JC 3UKJA 3FDFA 2ZRMA 3OIVA 1AUVA 4L8VA 4Y9UA 4KEAA 1EUCB 1ULZA 3FLEA 1XGKA 2PGJA 1Z5OA 1KTVA 1LRLA 1IUOA 2RK3A 1H05A 2G7ZA 3SXJA 2WOJA 5HUQA 5BSHA 1QBGA 2J6IA 1CQWA 2EKPA 4RM3A 4AP9A 3ZGLA 1T5OA 2UU9B 4GVLA 2POQX 5JJIA 5KYUB 2P75A 2P62A 1D1QA 4HAYA 4NH0A 1E1QA 4Z9XA 5IBRA 4JENA 5BWOA 1DLJA 4YYZA 4DR4B 4M46A 4S1VA 2JI8A 5AJXA 4F2PA 5HDBB 1G2QA 4AROA 2ZKIA 3I1JA 3TUIC 3P20A 1QV7A 2EKZA 4U5QA 2AXQA 3JQ6A 4LBYA 4GI1A 3SQNA 1JHQA 3OMXA 4X24A 2X9QA 2Z4RA 2H1RA 2CXHA 3L1UA 5G0WA 4I1IA 2UYOA 5GJVC 1XKTA 4UM7A 4ZCMA 5T7BA 4GXTA 3S1AB 3E1KA 4UKDA 3KFVA 3EIUA 3L43A 3I72A 5KC9A 4FBLA 3QTBA 2JI7A 2J6CA 1ZIXA 5BNIA 2IL1A 5MF6A 2C82A 1NXXA 3HYRA 3Q3EA 2GN9A 3WS7A 4J0DA 3PKJA 4KCGA 2JGJA 2H4XA 1SUFA 1I0ZA 1S5PA 4Q4JA 4F6CA 4PU0A 1TVKB 5PNTA 3FZEA 3U4GA 2RFLA 4EF5A 1LKZA 2H9AA 2PS1A 2G8LA 5K3BA 4M8IA 4AY5A 1XMOB 1ODSA 1XKXA 1JHDA 5I5EA 3N8NA 4C4RA 1T9KA 2XNKA 1YQTA 2XYVA 2TSYB 3W5SA 1NOJA 4IJKA 4PPNA 5AW6A 4PZPA 4ED9A 1J20A 3VFDA 2C4UA 5I7HA 3EGIA 1WMDA 4NDNE 2RC6A 3KQTA 4GP7A 1NASA 4QYTA 2YRWA 5JAZA 1ECPA 1TQHA 4XXHA 1I2DA 3NBZC 4H7JA 5KOHA 3TLYA 2E2WA 1RZUA 3ZE1B 1JQKA 3W9SA 1RQ2A 2W2LD 1D04A 4B32A 4AJIA 3O4VA 2H48A 3AY3A 4HDRB 4HSEA 5LVAA 3PI6A 3BSWA 4NCIA 5TB5A 1V5FA 1ZK2A 3KO8A 1IZ0A 1XI2A 4MWZA 4XDZA 5CCDA 3B78A 3G2MA 2VJMB 3H11B 3KVNA 4Q1CA 5JO9A 2REQB 3RSHA 4X85A 2EEPA 4J16C 1HEIA 4EBFA 1Z18A 5IKXA 1WP4A 2FE4A 2WF8A 4FKBA 2I6SA 1IRXA 4GKBA 5E38A 1HE5A 1JFFB 4GL4A 5DHPA 4MVJE 4OUDA 5H02A 1YHYA 2VXYA 1T2DA 3IR5A 3W8RA 2WFMA 5DEOA 2XDAA 5CGZA 2X76A 3GLIA 1UXHA 1VL1A 5B53A 1GPAA 4NE7A 4GFDA 2P68A 2R8XA 5DULA 4N82A 5EUBA 2E4ZA 4N49A 3LF2A 1KJJA 2PH5A 3BGIA 4NDAA 2AR0A 4JEMA 2XGOA 2ORWA 3K72B 5GPBA 1PYGA 1JIKA 3U37A 4RMJA 4YRJA 5K0LA 4ZV7A 1FFSA 4C29A 5C1DA 1CDDA 2BFFB 3FPEA 4ZVNA 2W70A 2W2PA 3SZLA 3AKDA 5FOQA 3BULA 2VBFA 4ZQIA 4M8NE 2G5TA 3KBOA 5EJ2A 5IC5A 4ZOQI 2C5EA 3EBLA 3WAGA 1KRXA 2FFJA 1L7VC 4MI9A 5CIYA 1DJNA 1Y3HA 5GVRA 1VKOA 3C7TA 3FJ1A 4FQ5A 3RRZA 2O8BB 1B0ZA 2GZHA 2C42A 2JDIA 3OOYA 3OOJA 4F9GA 4EFLA 2HJSA 5JD6A 1WY7A 4TQGA 2WIDA 1PFUA 4IS2A 2FEOA 1IM8A 1VM6A 2Q3EA 3AJ8A 3DQZA 3FGZA 3PPWA 1ZXLA 3FVWA 3QXSA 1YU6A 4X8LA 3VSCA 2A9VA 5EEGA 4G81A 4BQRA 5C2JB 3BRQA 4JHLA 1G8PA 1KC1A 1D07A 2R85A 3I32A 5B58T 1P5ZB 1XL1A 2J5RA 2P9BA 3UUGA 1WOMA 4YJHA 5KWVA 5KYYB 1YBHA 4CLHA 3IA7A 4U9HS 4ACBA 4CR8A 2C97A 3HL0A 5BSMA 5AKJA 3FW1A 3ELYA 5J4VA 1XMIA 1JHPA 4KWHA 2DUWA 1IPHA 1RRFA 4UFOA 3MWEA 5CCBA 1ECCA 1C0LA 4U2FA 2NUAB 4PFSA 1UC8A 2QRQA 2OORA 3M4XA 1YB5A 2ENUA 4L2IB 3WLMA 4UEWA 2O8NA 4NCKA 3JVUA 2ZRDA 1J8FA 2ASEA 2V98A 3TZEA 5L40A 3AONB 1EBUA 4YCNA 4IJMA 1E9AA 3KQVA 2NTYC 3O8DA 4KWIA 1MAHA 1W9MA 2PSJA 4KVZA 4B43A 4PBTA 4EI2A 1ZD5A 2O3TA 2JFHA 5IANA 3EQZA 1EFRA 1T9DA 5CM8B 3CUSA 3G1UA 4IDCA 2BFEB 3KEFA 4RD1A 4URVR 5L3QB 1RHKA 1UBMS 1SZCA 1Y3FE 3PD1A 3K6SB 4HDSB 2VJNA 1HQKA 1SUDA 3ROTA 3KLOA 2AWNA 2B25A 1VL6A 2HIGA 1W47A 2X86A 1NW8A 4P6VF 1G18A 3TM5A 4PQYA 1OR8A 1W34A 2KQUA 4HN9A 3GARA 4WEOA 3WRXA 5TS3A 1HDGO 5FAKA 4B6QA 1FE8A 3GW8A 1QGUA 4A8JC 2GNOA 1DTSA 4A0GA 3OZCA 2ZSDA 2Q3CA 5LZ5A 2FPLA 3SPXA 3HEAA 3V2UA 5ALPA 1IB6A 3QE0A 2O5RA 4D4KA 4RHYA 3UJ3X 4RA9A 1UP4A 4JBXA 3EWIA 4UJ3A 1TEHA 4XUGB 1U0TA 3KAKA 1ZGJA 2AG8A 1J90A 1NYLA 1C3VA 3DP9A 3ZHXA 4ERNA 5F76A 2R6JA 3JQEA 1NM5C 2XMBA 5BN1A 2NO9A 3GNSA 1GNLA 4JLSA 1TVEA 1I0IA 3QU2A 2AOUB 1QYIA 2JGMA 4EK9A 3QFRA 1USVA 4BFUA 2G71A 3PHHA 3SJAA 3CCFA 5KI6A 3WWOA 1IQUA 3OZTA 2EBUA 4UZSA 2A86A 2DWCA 2VYCA 2XE8A 1U7WA 4O4JA 4BLTA 1JG2A 5HRUA 4XWGA 1GLNA 2EIXA 2PCJA 3GJRA 5CVCA 3UJHA 4UNIA 3VPBA 2AN4A 1KJZA 3D81A 4RH0A 1D2GA 1LX6A 1DIBA 1YTLA 4UREA 1O0BA 4XTRA 1H4QA 1UBNA 2QTMA 5B2EA 2MDTA 1RC8A 2ODAA 1MDFA 2ZROA 4LZLA 4MIYA 4OHCA 4YI5A 3QU4A 4NFLA 2GK7A 3V1MA 2B36A 4H1HA 4XWOA 4CFZA 3EF0A 3HXTA 4ZYYA 4JXZA 4ZDKA 3T1VA 1WIWA 4JL6A 1K2VN 1ZH8A 3EPPA 4O1HA 4P58A 5LDHA 1DKRA 1J0XO 1DEAA 1JIQA 1N57A 4OXIA 3R1IA 1G21A 2F7SA 1FFBA 1Q7TA 2RG1A 3ETJA 3QJGA 5ALSA 5FPPA 4F5WA 4GI5A 4YUZA 2AFVA 1XMPA 1SC9A 2XLCA 3F2VA 2GPTA 3P9NA 4MR7A 2A30A 1HLDA 5IK2A 2ZUEA 1JVSA 1UXIA 2WVGA 1C2TA 4IDPA 2EKDA 2N42A 1A9TA 2NNWB 3D1LA 5ICEA 1QTRA 4IKPA 4LBVA 3ZJ5A 3N8DA 3TG2A 1IMJA 3HXQA 1N9KA 1SZPA 4RDXA 1AZLA 2GN0A 3ZVMA 3A6EA 2QVCA 2VF7A 4RHCA 4Z4FA 3MPUA 5ISMA 1WUHS 2IV3A 5ES4B 4LDNA 1U9IA 2MYTA 4H16A 2UZ3A 1I2ZA 4LSGA 2IYWA 3H16A 3PHCA 1ZMBA 2HAEA 4P4NA 2HCBA 3EXG2 5ALHA 4HQ0A 4GMXA 1H6CA 5JPDA 2P7HA 3K4QA 3GDGA 3AEKA 3EC2A 4P98A 4TRRA 5B1IA 5FPQA 1G5PA 3HYLA 3BBLA 1YDWA 4IR7A 4J1SA 3VISA 1Z5WA 4QYXA 4DCTA 4BO1A 4DLXA 1BTOA 3L0SA 1JIJA 1N7JA 1YQXA 4BNWA 2IVZA 1P17A 4TKVA 1QKKA 3HDQA 5BNWA 5CDSA 5IZCA 4JI7B 2ALJA 1UEXC 4KXNA 5FI5A 1S02A 1OGYA 4D81A 1N8NA 3FTPA 3HMQA 4G24A 1PYDA 4Y6LA 4YMVA 5FTNA 2C59A 4ZXPA 1XWFA 2WWGA 4GLLA 3KB2A 3LNCA 1EFHA 1Y5IA 3AF1A 1HDXA 2QE6A 2WHEA 4JOCA 3WWYA 1T26A 1HO3A 2WJJA 3W1EA 3C1UA 3C5VA 5AHRA 3DV2A 3I4CA 4XWYA 2J3LA 3DWIA 2QY9A 4Q7MB 3BIJA 4UXJA 4FYHA 4MRMA 2X3FA 1EJ0A 1SHTX 4W9RA 4CM8B 4EMTA 2QLTA 3K0BA 4QGGA 3TINA 1GKIA 2JGFA 3IUQA 2C84A 4JN6B 2QUJA 4HDCA 2C94A 3FNFA 3ON5A 2NV2B 4BMZA 4KPEC 3GH3A 1VTKA 4KX3A 5IMSA 3I9V6 2X9VA 3P5BA 1VOTA 2BRUA 2ENWA 4D9GA 1G1AA 2Q4OA 2IF2A 3R0XA 3I5YA 3VZSA 4MS1A 1YKGA 4BBPA 1DQNA 3RSLA 2OGTA 3KD3A 1KQ3A 2OXRA 2I9KA 2W71A 3EFEA 3F6RA 1U2EA 5EIOA 1PJBA 2YV2A 2R6ZA 5DXJA 5IBPA 4QATA 7GPBA 3GRZA 4RHFA 2PO7A 2QVLA 4RK0A 3KSMA 3P2YA 5JJ5A 4D4HA 4R8SA 4MVJH 1GAXA 4QODA 2ZAMA 4RE6A 1OLUB 3ORSA 1KWKA 4TUYA 4X3PA 3IAM6 3WHIA 4EJFA 5JY1A 1F17A 3LVFO 4QYIA 4LV5B 1YFLA 1I3CA 2RHCA 3H84A 1X9HA 4RFVA 3ZU3A 2YWDA 3SI7A 4CMEA 1GUAA 5IJ0B 5JZMA 4U3JA 3IAS1 1JR6A 4BMCA 4HPXB 1C0PA 5HR5A 3IBFA 1NUPA 1NNI1 2BOVA 2VP9A 3ANXA 3DUFA 2QX9A 4S1PA 1B0PA 4Y67A 1FMCA 4YMSA 3V1UA 4B6JA 2FUEA 2MSNA 3QE3A 1M2GA 2IDJA 1GQ2A 2AUMA 3QOYA 4V3BA 1QHYA 4O2RA 1TRKA 4CKXA 1HT3A 1IFXA 4X71A 5K45A 5GADl 4M49A 4F97A 2PTHA 3JQFA 2GCOB 2BFWA 3R7NA 4QRIA 2PQ2A 2UYGA 2KWIA 2CFIA 3MZ0A 1GUDA 3AVWA 3DYVA 1M6VB 1U9JA 2BKEA 2VNIA 4CKWA 1U2GC 4QOFA 4BVBA 1VBMA 3D3QA 5JVDF 1KJWA 1GUZA 3FHLA 4HEA1 1Z13A 2E87A 1WB6A 3KOUA 4V1CB 2CXSA 3IXQA 2R87A 3W3AH 5K2MA 4A03A 2HNAA 3HSSA 1HMPA 4RPCA 4OB8A 4J4TA 4P5DA 1Z4LA 3NNDA 4PNPA 4M36A 1NW7A 4ANFA 3PNBA 1V71A 3DBVO 3FJOA 5JYBA 1ZUHA 2G40A 3ZTTA 1H8EA 3MGGA 5IEBA 3IT1A 1UBGA 2WJYA 3MD9A 4CPDA 4TZTA 5DBOA 1EZ4A 5E2IA 3RVBA 3T7KA 1UMKA 4JFAA 5C1IA 1VPTA 1DU4A 3HY3A 3A58B 1EMDA 2C4MA 5FPHA 5THKA 6Q21A 4N18A 2NYAA 4TWZA 2QD1A 1ZIOA 4OGLA 5HOEA 4DEXA 3EULA 3PT5A 5ER6A 2EKLA 3G1TA 4L7VA 1GGHA 4OMUA 3Q7TA 3OQHA 3THSA 5KOJA 3VVCA 2MR5A 2X0RA 2Z8XA 3OMWA 1EDDA 1NOKA 2JBAB 3GCWA 4M7OA 2BYTA 3NXKA 1ZM7A 3WGJA 1QIKA 4C05A 2C9MA 1ODLA 5T5QA 1N7IA 3QOXA 4Q4LA 4HLQB 3S40A 2X7HA 3PJGA 3A04A 3MCZA 2JEYA 4JUFA 4F6RB 5K3OA 2BEWA 2FWIA 2PNJA 3ROEA 4MRVA 3NDJA 1RXUA 1MJGM 3OX1A 1RYYA 3KDSE 4JUCA 4ZHQB 4Q4HA 3BIOA 4RNDB 5FCDA 3ESYA 3TPCA 4I50B 2F1JA 4OQPA 2BFBB 5ICMA 3QEMB 4R83A 1XXHB 3I2HA 3QKWA 3C6KA 1JVNA 2AN9A 4RGBA 5F33A 4E5MA 1NVDA 3BCHA 4ZT3A 1EKXA 4CV1A 5TQ2B 2R6FA 1T3LA 1T4CB 5JCOC 4QJ5A 1YRLA 4IRXA 3ZZNA 4JOQA 1XWIA 2HBZA 1NVUQ 5ERYA 1I36A 1U5BA 4DCUA 3FJYA 3T1HB 1GU0A 2GVNA 5C81A 2DEUA 4J07A 5AXDA 2PD6A 3C8HA 4U4AA 2NZYA 1SWVA 3Q7RA 3UYKA 4EATA 3EQ2A 4UTPA 1VP9A 3EK2A 2H7CA 3KHSA 3JR7A 1IVSA 4C20A 3TD6A 3TQOA 1VPDA 3VR6D 5A6VA 2J4DA 4D8UA 2X7XA 3E9ZA 3HQ4O 4BMXA 4CF5A 5JEDA 2ZTUA 1XVVA 4DLAA 5EJIA 4DQVA 4I2VA 2HLDA 2OENG 4YROA 1ORIA 4KI0A 4BAGA 4HVTA 1RPNA 3HBMA 3AU8A 1O2DA 1IZ9A 4G0YA 1XCJA 3A0UA 1IOVA 3V8NA 3HXOA 4RSGA 3C5HA 4UCXA 1GKUB 3IIEA 4I8XA 2XUZA 1K1EA 5JCPA 2JVKA 2X1VA 2E18A 5DW0A 1MTOA 1K6MA 1UODA 4YP6A 3SZRA 3ZW9A 1F48A 3AIOA 1YJCA 2VK2A 4PZYA 3LIPA 3GDWA 3OQ6A 3OZEA 4KRXA 1ILEA 5G4KB 4FCWA 1BMTA 2FUNB 1C7JA 4QNNA 5H3HA 2H1FA 3QY0A 1DRUA 1WO8A 3C48A 2BGWA 2PXXA 1KIAA 3F90A 1HYBA 3IQDB 4KWCA 2Q4TA 1WCV1 5BVHA 4FFSA 1XALA 1R5NA 4B4WA 4CKBA 3G5MA 3UBMA 1B16A 1ZD3A 4RGQA 4K9NA 1JT9A 5FNVB 4YMHA 5ED4A 3VPDA 5DP1A 4B33A 3AVUA 2JI4A 2PBRA 2DBYA 2WC1A 2VDRB 2Q49A 5KYXA 1YL7A 1XU9A 1GKKA 4KGZA 5IJ9B 4YT2A 1L7DA 3U4CA 3TX6A 3A70A 3FYSA 6PFKA 1R0XA 1U3GA 4WGFA 3EIEA 1F14A 5KAMA 2JARA 1KXJA 4ARAA 1FXUA 4I14A 2QL7A 1QIIA 4DMGA 2QZPA 2RI0A 4HYTA 5ELLA 3TLKA 1O58A 3QFSA 3EZ6A 3FBWA 1GSOA 4BLUA 4BRZA 1FDSA 3S0JA 4EO7A 1MU0A 2OM2A 3GOQA 4H3VA 1PL0A 4GU5A 3T7TA 2QZJA 4NU5A 4LHXA 2VAVA 4DSAA 2EFEB 4L0MA 3SICE 3EMKA 1OZFA 1S7GA 1YS2X 3CIFA 3WMXA 1EM6A 5AK6A 3O0TA 2OQVA 2IYAA 5BR4A 1JGTA 3K2BA 2A9KA 4Q9IA 4PPQA 2QAIA 3H6GA 4NY1A 3UMGA 3OZWA 2DXIA 1W73A 3I01M 3L7BA 5CA1B 2AX3A 1WMEA 2AQIA 1DMSA 1NQWA 3JVEA 3S4YA 2RSLA 2YIMA 3DAPA 1SCDA 1UXKA 1PQYA 1O9GA 3QF7A 4URUR 3T9BA 3ZY3A 3IP7A 1GRNA 4D0SA 4P3YA 2WAYA 3WBFA 2XWPA 3TLXA 3QU9A 3UMCA 5EJ9A 4QM6A 3SFTA 1TEZA 2PL1A 3HWSA 3E70C 2JFQA 5CT4A 3ZW8A 1CQZA 5DN6D 3HXMA 3QA3E 2O0JA 1AD2A 1BHSA 2FPGA 2AT1A 5LM3A 1VHDA 1WCYA 3SKVA 4FK8A 4AS1A 2BMVA 1SIUA 1J9EA 3DCIA 5U4XA 1PR4A 5C8ZA 4QOSA 4DG8A 3UAVA 1RJ9B 2IQIA 2XLBA 2P2ZA 1PZHA 2YDXA 5GY7A 1EVQA 2CJWB 1KS9A 4OK3A 2K7ZA 3C8MA 1FDUA 1G55A 1M7HA 1YVUA 2ZI4A 4RFLA 4B2PA 1HSZA 2I62A 2G1KA 4A8JB 2BJHA 1T91A 4IUDS 4DQDA 1NVMB 2I1QA 3BWYA 2HPHA 4ARZA 3UCXA 4CF7A 2ZDHA 3T7JA 2IZOA 1Y82A 2FN3A 3NM5A 3KU4A 1ESNA 2YR0A 2YOHA 4FU0A 4X1YB 5FKJA 1E2PA 3WKBA 3FVVA 1B00A 3TN7A 1OXKB 2I7TA 3CMMA 3H3JA 3EVNA 2HJVA 5ARCA 4OG2A 5FRDA 4IGIA 4E2FA 1LPBB 1EINA 2BFMA 2VVTA 5C46F 1W85A 2ECQA 4NG4A 1DEXA 1Y8QB 2R84A 3JASA 5C8VA 4D6PA 2B9VA 2MOKA 4KN9S 4MZXA 5IX8A 1XRQA 1LK0A 2QGFA 2HFKA 4UTOA 1GAJA 1G2PA 4TTVA 4PZLA 1LV8A 2Z30A 2ZRQA 1K66A 3I6MA 4AC9A 3DEKA 4FZRA 2FMHA 3B1JA 4X60A 3PG5A 1QUFA 4WI1A 1XAIA 3NT5A 3PPYA 1PT5A 1XELA 3QVGA 1MRNA 2UYYA 4V0KA 1M0WA 1K8ZB 2LDXA 3SHVA 1QQTA 3NDIA 1P2VA 1PV1A 2GX6A 1U3TA 1XHFA 3MNFA 3GDOA 4FBGA 3OP4A 1AN0A 3AOGA 5BR8B 1KVQA 5CX1B 1JB1A 1II0A 1N0WA 4ESOA 2X13A 4KQ1A 2EP7A 2JCXA 2O2XA 4WZBE 3RRMA 3VKGA 1U0LA 4WL0A 1SKMA 1TZCA 3GFRA 1MGPA 1WD7A 3HCPA 5LCXA 3EEIA 1JLHA 2ADOA 2PT7A 5ALZA 1YZ3A 3U7GA 1O95D 1WTCA 1RWQA 3FLBA 1JLKA 2H8KA 1YMUA 2IP4A 2QM8A 2XSZD 3BB3A 3Q7SA 4HAWA 3MG9A 4P34A 4UAGA 4E4YA 2NZJA 5CDYA 1DBPA 3EAGA 5ESDA 1PUIA 4ITRC 3G85A 1ZI8A 3PLRA 2O7SA 3DQQA 4NKRA 2P8SA 2ILVA 3F98A 3ZGNA 1Q84A 4E2ZA 1OX4A 1KOJA 1NSYA 2FJ0A 2WB4A 3W7AA 4PAWA 4G67A 4TPKA 2X5NA 4U0JA 4DW8A 2QE7D 1S8AA 1MH9A 3NYWA 2I4RA 4FSHA 2QBYB 3R5FA 4Q9HA 3NHMA 3KUUA 5AVYA 1C9NA 1ZJ4A 3EH2A 1IEWA 2QTTA 4G1FA 1IOWA 2P2SA 1TK2A 3A6PC 1JR3A 2ICAA 2NV6A 2OHXA 2VTDA 4GLJA 4ZVKA 3SIPA 3EPKA 1IQPA 1KO5A 3DVQX 3GVHA 5E3HA 1PIWA 1BD3A 3AUFA 1XD9A 4LZJA 3ROFA 2VNHA 1UQUA 4AMUA 4LJ6A 4ZI5A 1OA0A 5KVVA 3ANNA 2R00C 3V3KA 1MRSA 1ZCAA 2O2SA 3P96A 2WY2D 1IWPB 4J1TA 4BVJA 1I0LA 4Q16A 4LE2A 3E3MA 3MOGA 2IC5A 3Q0EA 1DSSG 3EASA 1EFUA 1EGHA 3S70A 3ESXA 4BV8A 1BVHA 1I4EB 1TUEA 3R0IA 2NU6A 2OYCA 2QJFA 3TNDA 1FUKA 4OYLA 1RWWA 4ZJYA 3O8LA 1G7RA 4LRUA 2UZ0A 5DFAA 2FAXA 5FBWB 1IWBB 3BMOB 1A50B 3ZX5A 3L18A 1QZ3A 3LC0A 2V74B 3NIDB 3QVSA 3RFTA 5DK4A 3EXHC 4BUZA 4DDMA 4AKSA 2DT5A 1PQ4A 1V6AA 1ZD2P 2BPOA 2JRLA 4HEHA 3UF0A 3AIIA 5B7QA 4RTKA 2EP8A 3PCRB 2F64A 1F4VA 1GRRA 1HRDA 1GKLA 2D4AA 5T3UA 4DMCA 2GK6A 4D9CA 4NEHB 1ZRMA 1LLCA 1XZLA 2BFDA 4MEBA 2ANCA 4QLBA 1Z6ZA 1A9SA 4MOWA 4IDGA 4QE3A 3EMBA 4WZBB 2A92A 2W83A 5EJGA 4XYGA 3RBVA 4YT8A 5T67A 5K3FB 4HXFB 4MKZA 3OOEA 3RSGA 5EA2A 2JH9A 4R2WA 2DAPA 3F5QA 4GKAA 2Z5LA 5DWQA 4H6VA 2G88A 4YRNA 4YJKA 1RI5A 2ZJYA 3MJTA 1VLZA 1II8A 3C7AA 1JEJA 1U1EA 5KSPA 3WDSA 4ND4A 2Q6IA 1KYVA 4B87A 4G01B 5JRDS 4P4GA 4OATA 4Q1FA 1U7TA 4M1SA 4QO7A 4IM7A 5IKPA 3IO3A 3ADBA 2O2IA 3TW8B 1QHGA 4B4DA 2EEZA 3PC2A 6AT1A 2NZWA 3OQ1A 3EXEA 3RYFA 3D6FA 2R47A 4RF3A 2ZSJA 5EZ6B 3T99A 5H70A 3EVGA 4QEDA 4CQNA 5JJLA 3BWMA 3ZCUA 2Q3FA 4EDHA 4INOA 1P7ZA 2KLBA 4L5IA 1E9BA 1VL8A 3CB2A 4KDRA 4I4TA 4P31A 4D8WA 4YCSA 4OIMA 1DKNA 2PUCA 3WKEA 1XRPA 4IWXA 1XMXA 2CKMA 3KKOA 4KX5A 5FPSA 4JK3A 5JCJD 4JBGA 5CX4A 4DEVA 4YHHB 3EAQA 1GTRA 3RFUA 4G65A 2BHNA 1YTUA 1RYMA 1XLTC 4RWEA 5AIAA 1SHLA 3OCJA 2WSMA 2X8JA 1G42A 2XMZA 3BXOA 2HO5A 3UMSA 1DUIA 1YFKA 3W1WA 2VQFB 4G1CA 2ZUBA 5TQ0A 4BB9A 3LPAA 4OQQA 2FEKA 3PQCA 4GAEA 2OKCA 1FFXB 3U3DA 5LP6A 1ZN2A 3HJNA 1HSOA 2GCEA 5IBCA 1EXVA 421PA 3GMTA 5KNDH 4BLWA 1SQSA 2NSJA 1T1EA 1NJSA 4Y1RB 1GGJA 4ZCQA 1R6AA 2IYZA 3FY4A 3CURA 3AP2A 4RJTA 1ADYA 4M8SA 4E1AA 1S9HA 1DINA 4MV1A 3DKPA 3LKVA 2VJQA 3LT4A 5D8DA 5ESXA 2VPXA 1P31A 3GGCA 5FOSA 3MSCA 4LC9A 1GTL1 3H1BA 3V00A 4A16A 2PHZA 4FDTA 3LD9A 3FI9A 1M1YE 1T24A 2ZTMA 3NNSA 4DCCA 4MCAA 3EQ7A 1R4MA 2X9GA 4DUGA 1Y1RA 4GSLA 3EARA 3FAZA 4UZFA 3V6MA 3SG0A 1UL1X 1Q7RA 4NMWA 3KOZA 5TS2A 1HFKA 2VJBA 4IQGA 1VZ2A 4EA6A 1OILA 3AUSA 2NO0A 2CNDA 1KETA 3PDUA 3UB4A 2RHBA 1TJ3A 4MQFA 1ZVJA 2QQEA 1YB7A 1Z2DA 1U2PA 1C9YA 4XPZA 1A9RA 2ZB4A 5ESRA 4RF5A 2ZXUA 1H66A 1CUYA 4BKRA 2HFJA 1B8PA 1EX1A 3E6AA 5LU9A 3V5NA 1E3WB 4WZ6A 5AKLA 3WYBA 5I7SA 4FM9A 2XAAA 1KYZA 3UAXA 2Z6VA 1CEQA 2OD2A 2GAAA 2P2GA 3PFGA 4Z8XA 3NHLA 4YUAA 3QX8A 4KXYA 3E58A 3KJFA 2W6CX 5IUKC 4EP1A 1T36B 1F60A 1R6UA 3IDOA 1JA9A 3PVSA 5KYWB 1A9XA 3LUFA 1PVOA 3SS9X 2V0NA 1WBJB 2YJ6A 2YC4C 4QZVA 1XNHA 3OEEA 4QVKA 5BSRA 3SYMA 3PE4A 2QMEA 4WY5A 3KYDA 3TLGB 2G9ZA 4Q93A 4GPD1 2QTHA 1Y6FA 4LF5B 3DF7A 4CKEA 2NU9A 5IT9A 3C41J 2IS1A 2BV3A 5A3RA 1Y8RB 2I3GA 3N2KB 1E61A 1N5MA 3BUSA 3G2PA 3JATB 9GPBA 5GONB 4L8YA 1NJ1A 2WTUA 5E9AA 4JLVA 1M54A 3ZEIA 4LY6A 4CEJA 3ECAA 5DLPA 4TKUB 3ZE6A 3V1TC 2D2XA 2XOXA 4US2R 1BCSA 1UBOS 3MJEA 3KLNA 2M32A 3DFKA 4Q37A 1QFMA 2BEVA 5C7OO 3V7UA 5AVKA 3IV7A 3E7DA 2C98A 3EQ6A 4KMRA 4WNAB 3KQHA 1Q7EA 3O91A 4XTCS 2R3SA 3A14A 5CD9A 1EVKA 1EFVA 9ABPA 3HJBA 1QB8A 1E59A 221PA 2GI4A 4TTQA 2HK6A 3JQ9A 1PZFA 4AKEA 2REOA 3VOSA 3JYLA 3MERA 2N1MA 1A8QA 1W5EA 3BH7A 4HDOB 8LDHA 3IAXA 3GIDA 1TZ2A 1VCMA 4XWKA 2JLZA 1JV2B 4M1QA 4NR0A 1SKYE 3V2IA 4PLYA 1J8DA 2P27A 1XE3A 4YIKA 2HN9A 2K2QB 4Z9YA 1T2VA 5HF9A 5EWLB 3VTFA 4GOLD 1OAKA 4P38A 2WW8A 4FQ7A 1Y7PA 3ODPA 5JNUA 4RLQA 1YDMA 2OLKA 1ZNQO 2YINC 5K7SA 2QVZX 4CF3A 1OZGA 3BK1A 5DHFA 3NKLA 3K32A 4UBLA 2D8AA 2IQ5A 2XBUA 4GQBA 4RVGA 5IAKA 3AUUA 2PUAA 3GI1A 1Z7BA 3OM1A 2JD1A 4MS4A 3Q15C 4OV6B 3IVGA 3B53X 4TV8A 3TUZC 4I19A 2D7CA 2Y77A 4GEKA 5DNEA 5AQEA 4E88A 3CVVA 1E1CB 2ZIVB 2LDBA 1N2CE 1I5EA 5LYJB 2XCSB 1M34A 3GGGA 4RY8A 1SCKA 4K9OA 1UKEA 5D6NA 4QFBA 2A14A 2ID9A 2RI6A 4H35A 5DNYB 2H07A 4PHHA 1MPXA 1ZM9A 2IZ5A 3URMA 3JYQA 5BV7A 5E8JA 3IQGX 4NBWA 3HO1A 2WZQA 3EDOA 3HJFA 5IZ4A 1G20A 3F49S 3QYPA 2DJIA 4KK3A 3O75A 4R1LA 3IE1A 3C97A 3OEHA 1P2FA 5HHTA 3QELB 5B3JA 4WXMA 4A2WA 3GN2A 3GEHA 2B4KA 2WIKA 3H8WA 3L4KA 4EG1A 3L8CA 1PZEA 4R3NA 3F4KA 3C85A 3WRYC 1ZUIA 3L6EA 1WDMA 3DTVD 1AUPA 1W94A 2QGNA 3QGMA 1EEHA 3L1KA 5DGXA 5B1HA 3S27A 3ZV3A 3SOPA 4BTEA 2OVBA 1COZA 3MW8A 3EYWA 3DXFA 1FMFA 2QT0A 2XYPA 8GPBA 4C1NA 1B8VA 1BH6A 1V1RA 2HWYA 3B9RA 3C5WP 4HX2A 1KEKA 1U4SA 1YXMA 4EQZA 1I3MA 3KSRA 3AR3A 2GPWA 1YB6A 4XFJA 2J0UA 4X91A 1C9EA 2CL5A 4EY7A 1U8TA 2B1QA 4DR1B 1T5DX 3CRQA 4LMBA 3RLIA 4JBYA 3UFXA 4CJXA 3ESAA 2ABWA 2J0VA 4HH0A 4NC9A 2PUTA 3GIWA 4DARA 4NE9A 2VT3A 3ZY4A 1WV1A 2EERA 3MPOA 3QKIA 4EX7A 5BWLA 1E3LA 3GLRA 3IXMA 5AJHA 4D8XA 1HF3A 1PE0A 4XUDA 4H1WA 3RADC 4P4SB 3OWHA 1GFIA 2CNWA 1F3LA 1KVRA 4RTRA 3H2GA 4MP3A 3GAMA 3WO0A 1GYRA 3ZK8A 1RZRA 4PQEA 2VT6A 4QUKA 1Y8CA 1L4MA 3BYZA 3VJRA 3TZ6A 1FJXA 4B8WA 2FDCA 3QW4B 3ORFA 1RLJA 2GAFA 2RC5A 4EPVA 4G1UC 3I2FA 1GL9B 3IRVA 1A7KA 4Q3OA 2P4QA 1Y48E 1ZEMA 3Q85A 5JADA 2C7RA 2SKCA 3OD1A 1QK5A 1YZTA 2QTVB 4YTEA 2YNMD 1OU0A 4BGUA 4CR6A 4C0LA 1K4KA 3AT1A 4N5HX 1GZHB 1YA8A 1J1IA 2XGGA 3Q7QA 4EY8A 1EFPA 2E4YA 3K2IA 3QBVA 3VR3A 4GPIB 1NX6A 1VL2A 2I6GA 1AF7A 4DSNA 1IM5A 1T6YA 2OV6A 4HQRA 2P2NA 1JDNA 3LGAA 5IVIA 5JSUA 1ZS9A 1X7YB 1DO8A 3E48A 3S3TA 5KQMA 3FROA 4M0CA 4A5OA 1AU9A 2A33A 4WK2B 4DCPA 4BFWA 3T8YA 3U9SA 1KH2A 1H3FA 2X8LA 3CKYA 3LK6A 2Y1OA 4OHRA 5K8LA 1NLMA 4TMVA 4X0EA 2C7GA 4DNQA 1DQRA 1B6TA 2EGUA 4UQPA 3KYCB 3WICA 4OHZA 3RU3A 4HLUA 2VOEA 2EJWA 3ND6A 3HZZA 4TS4A 2WU8A 1QCYA 2QG4A 1Z2NX 3PC8A 4W5RA 2QAGA 2QZ9A 4TM7A 1AXRA 1PK8A 3FDIA 2AE1A 1IHUA 3SY8A 3GLFB 5DRTA 2QHXA 1NVAA 7MDHA 3YASA 4RS4A 2G83A 3GLHA 1IHYA 1U3CA 2WHXA 3QKTA 5DEIA 1OHHA 4UUQA 5JDIA 2AQKA 5ECDA 2W2KA 4HUQA 1YQGA 3V8PA 2UV8A 4TRMA 1QWOA 1QP4A 1XDBA 4DLPA 3T3GA 2LW7A 1A2QA 2OB2A 2XYQA 3IJEB 3KXPA 4AURA 4GP6A 1R9MA 3H5RA 4P3XA 2QTAA 1JHRA 1H2YA 1NR7A 4OU4A 1JVBA 1UPBA 3EXG1 1SD5A 4QKQA 2A4KA 3AC0A 4NV1A 1J56A