2A5TA

Crystal structure of the nr1/nr2a ligand-binding cores complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
284
structure length
271
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subunit arrangement and function in NMDA receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport,membrane protein
molecule keywords N-methyl-D-aspartate receptor NMDAR1-4a subunit
total genus 79
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2a5tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2a5tA02
2XXYA 4G77A 3MZ9A 3S2VA 5I56B 5IAIA 4PQJA 3O28A 3K00A 1LGBC 1USYE 4KD5A 1LAFE 4BDQA 4O3BA 3Q29A 2DWAA 3DELB 4FIMA 4F1UA 3O29A 3M3FA 3QUFA 1B4HA 3MBPA 3PUZE 3U92A 5CRYA 3TPAA 3K1NA 4MFIA 5EYFA 4EUOA 1NNFA 1Y4TA 2RC9A 3GBAA 2XD2A 3TDJA 2RCBA 2PT1A 2B3FA 1H44A 5DVJA 3S9EA 1XT8A 3IX1A 5I84A 2Q2CA 2P0SA 1D4NA 3BFTA 3RGYA 2DWJA 5EHSA 2O1MA 4OERA 3IK6B 5H8HB 4C1UA 3C35A 1J1NA 3FJMA 3TMGA 4F3BA 4LA9A 1POY1 1B3FA 3PV0E 4IY5A 1VFEA 2GHBA 2F6PA 5H8NB 4XKPA 1A8EA 3GBBA 3HSTA 1S7YA 4U4SA 1FCKA 5FTIA 1FW0A 1JQFA 4RA1A 5F1QA 4GOTA 4F3GA 5AA3A 2F7CA 4O3CA 3ONMA 4JXIA 4R9FA 3TTMA 1DMBA 3OD7A 3PPNA 2HAVA 1A55A 4RPOA 2UVHA 3Q27A 3GXAA 3S4UA 1TWYA 2ALUA 2O69A 4PFTA 2I3WA 4Q0CA 4G68A 1DTGA 1MPBA 2YPNA 3TTLA 4YU0A 1URGA 2DP8A 3OMBA 3QAXA 3EHUA 1UTBB 4RK9A 4X9TA 2P1SA 3VXBA 4ELPA 2O84X 1NL5A 1B0HA 1ZBMA 4LP2B 5DVIA 3MPKA 5CBSA 2YLNA 3T9UA 4P11A 3IOTA 4IO6A 3H6UA 1MDP1 4U1ZA 3C36A 4ZE9A 1FQAA 2F7AA 2IEEA 1AL3A 4HCWA 4MH5A 1EU8A 2XXQA 3T66A 3V8XB 4NF8A 4WEDA 5J1DA 3FGSA 1PB7A 2OBGA 2XX7A 3PUVE 2XXUA 3EF7A 4KHZE 1OIBA 4LZ7A 1NMUA 4O3AA 4N6PA 4NF8B 3RT6B 1US5A 2G29A 3QIMA 4GQOA 3CSGA 2FYIA 2Y7WA 4RNSA 4ESWA 1D3KA 3K1MA 3CI8A 1N04A 2HEUA 4R2FA 3FV1A 5CI5A 4N13A 4OEVA 2VOZA 1LB8A 2DS9A 5H8QB 3SEYA 4DCXA 3LUYA 3DM0A 2Q2AA 2I48A 4NF4B 4OTEA 1ELJA 2HZLA 2QMXA 2XXRA 4KQPA 3TZAA 3Q25A 4Z0IA 5KCJB 1N7XA 4TOZA 1JW5A 1DOTA 2THIA 2GRVA 4YMBA 4XKRA 1B7UA 2W7YA 1CE2A 1YAEA 1MDQA 3K6VA 3D4GA 4YKJA 3OXNA 3UP9A 3C9HA 4ZS9A 5ICTA 4IGTA 4YKKA 1LAHE 2DXYA 1RKMA 2XXXA 4HTGA 1M5CA 1FTJA 1Z7NE 3RPWA 3SEXA 1SW1A 1BIYA 2AYSA 1MQHA 2DE4A 4DZ1A 5KDTB 3S9LC 3PMXA 4OFLA 1SVXB 3SERA 4H8IA 3B6QA 4LZ5A 3U94A 3UORA 2Z8FA 3AXFA 4WXJA 1I69A 1B2HA 3USDA 5KDTA 2UXAA 2DWHA 3CSBA 5I57A 4PETA 1IXCA 4HCYA 4IO2A 4DXBA 1A40A 3FIRA 1IEJA 4JSDA 3V89B 2RINA 4G68C 4L17A 3TODA 1NH7A 3ILTB 2ONKE 2DXRA 3BBRA 3HV1A 4OETA 3TTRA 3DLNA 3JV9A 3SDFA 3CR9A 4ZECA 1EZ9A 2XXHA 3CFLA 3PUXE 3WAEA 5TPAA 4F18A 3QXMA 1NNKA 4XKQA 5AE4A 2DE2A 3MVYA 2ZYNA 1QUJA 2XXIA 3FXRA 2RKMA 4EQBA 4GVOA 2H5YA 1FQEA 1TXFA 3PUWE 1RYXA 3KZGA 4LZ8A 3Q26A 1LCTA 3IO6A 4R6HA 2PVUA 4RYAA 3K6WA 3K0VA 1FTLA 3PPQA 1O7TA 1P1QA 2OJTA 1H76A 3K4UA 1SQYA 3U93A 5TPAB 2B3BA 3CVGA 1EZPA 5L9SA 4NF6A 2Y7IA 5K2YA 4YMAA 4GL8A 4I9DA 3EHTA 4NF5B 3CG3A 3VXCA 3N26A 3FUZA 1FTMA 3DP4A 4F3PA 5ELVA 1SD3A 3MJNA 5DT6A 3UIFA 4FEBA 2OCUA 4FJPA 4XTCQ 3FXQA 3OO9A 2AL4A 3TQLA 1UTBA 1OVBA 3I3VA 5CM6A 1BP5A 2R71A 3OO8A 4F2OA 2AL5A 1B6HA 1WVJA 2DQVA 2LAOA 2VHAA 1AMFA 1MS7A 3CFZA 2UYFA 5FHMA 3ECRA 4OHNA 3PD9A 3IJOB 3OO6A 3OSRA 3C33A 4G8HA 1II5A 4TLMB 4BLAA 1M5DA 4P0IA 5DVFA 2R6GE 2V93A 1TT1A 4LONB 4R74A 1B3HA 4EQ9A 4U23A 1ZKBA 4TLLB 4LUBA 4EDPA 3PUYE 3TEPA 4R6KA 2WKYA 1B3EA 1JEUA 1SDXA 2NXOA 3GLBA 3MZ1A 3R26A 4GRKA 1PBPA 3VVEA 1LFIA 3C32A 1IXIA 1ZU0A 1P99A 3OELA 1XVXA 3F11A 4Q30B 1B0LA 5DYHA 3HPIA 3H03A 4XKNA 1DTZA 2PMSA 2QPQA 3KJ7A 3MUQA 4PFUA 4YB7A 2F7BA 3LSXA 1QUKA 1EH3A 2ANJA 4PE5B 5K2XA 3RTWB 1VFDA 3BFUA 1OVTA 4KPTA 2NUVA 3IAZA 4G2ZA 4QFKA 3KEIA 4RJZA 2ABHA 3IOUA 3MZBA 1P1WA 3RQTA 4GD5A 1HSLA 2D21A 5F7VA 5HPQA 5CBRA 3O6HA 1CB6A 4PFYA 4M1VA 1MG1A 5JK4A 2OWSA 1OQHA 2CZLA 3BKIB 4H0WA 1FTKA 5I59B 3V5AA 4ZZEA 4QF9A 4DE8A 1URSA 1HSJA 2V3TA 3KG2A 1US4A 3O6IA 4QFPA 2FNCA 4DIGA 2HCAA 4JWYA 1GR2A 3A3CA 1P1NA 4R6YA 5FTHA 2O51A 3IOVA 3KN8A 2RC8A 3TUSA 1VSOA 2O6AA 1MQIA 4KCDA 5IKBA 2Q8JA 2DE3A 2VD2A 4HS7A 5JTYB 3T96B 4OENA 4WKMA 4BDNA 4ELRA 3SEVA 3G3GA 2QS2A 1O64A 1FTOA 1A7LA 3KJTA 3TTKA 2P2AA 1MXXA 1B05A 2ZXTA 1IITA 3IB0A 4H1XA 5I2KB 1VR5A 2I3VA 3JZJA 3O2AA 3VV5A 3MVZA 3SEUA 5CMBA 3QUJA 2RC7A 2ONSA 4XIGQ 3VLWA 5TU0A 2GH9A 4MBPA 4ZEIA 3TYHA 2X7PA 4AB5A 4F19A 4EXKA 1ZLQA 1ZIUA 4NTLA 3K1PA 3HN0A 5KZTA 3IO4A 1B7HA 1MQJA 2GFEA 1MY2A 4H5FA 3FVOA 4IB2A 3GZGA 3FASA 3H3GA 2QS3A 4RK2A 3K02A 3OSQA 4U21A 4YB6A 3SETA 3OEKA 1BKAA 3KN7A 4UA8A 4ZE8A 4GIZA 3T22A 3ZSFA 4F22A 4JWOA 5H8SA 5BUUA 4DXUA 1S9TA 1Z7ME 3I6VA 3KOSA 2UYEA 2ZYMA 4LQ5A 4QSCA 3W9VA 4KYEA 5AA2D 1M5EA 2YJPA 1SYHA 3C34A 1MY0A 4OFJA 4POXA 4THIA 4UACA 5JTYA 4R72A 4ZDMA 2PBWA 3MAMA 3FATA 3I5OA 4NMYA 4ZEKA 2V3QA 3MPLA 3OEMA 3PMWA 1JETA 2I4CA 3VDFA 1T0KA 4YICA 1IZ1A 3VFJA 5CC2A 1MXYA 1MM7A 4YZZA 5B70A 5AA1A 3V83A 1N3WA 4EQ7A 2X26A 3KBRA 5H8FB 3IB2A 5I59A 1Y1MA 2Z22A 5B7DA 2PT2A 3FVGA 3A3UA 4R75A 4RPNA 5ITOA 4F1VA 3M3LA 4OZ9A 2Q89A 2F6GA 3KN3A 3JYRA 5AA2A 2DVZA 5DTBA 3U72A 3QK6A 1B5JA 1MRPA 3EPEA 3TAJA 1XHYA 4IO7A 4FECA 2QL3A 2I49A 3MW0A 1PEBA 3ODBA 3O97A 2UVIA 3KSXA 4I62A 3G3KA 3PPRA 3SEWA 3U8QA 3RN8A 1N7WA 1Y3NA 3R7XA 4U4XA 4IO4A 3B6TA 4RY1A 3O9PA 2OLBA 1JW4A 2F36A 4XXUA 3PD8A 2I58A 4YKPA 1MY3A 3MQ9A 4C1TA 5ISUA 1NNPA 2V3UA 4X1DA 1AIVA 1LCFA 1M5BA 2Y84A 1QVSA 1RYOA 3H06B 3M8UA 4IO3A 1EZOA 1QW0A 4K3FA 1IIWA 4NF6B 2REJA 4NWDA 1YCJA 1ZMGA 4NWCA 4QSEA 1MM6A 4BDLA 2OK2A 1NFTA 2XX8A 2H9BA 2NWJA 1GVCA 1Y9UA 4FORA 4R9GA 4JSOA 1N0TA 1NNTA 3C31A 3LBSA 5A5XA 1ATGA 2VP1A 2M8CA 3N5LA 2ZYOA 2V84A 4NF5A 3HHGA 3FJ7A 4POWA 1AH5A 2DYXA 3H6WA 4NF4A 2QRYA 1DPEA 3FV2A 1MY1A 4Q8RA 1QKAA 5DEXB 4Q5TA 2I0CA 1B3LA 1JVXA 2H99A 1QKBA 4JBZA 1DPPA 4NEDA 4OEUA 4HW8A 5I2NB 3PMVA 4H5GA 4I8CA 1DSNA 3OENA 4LATA 4OVJA 4QFOA 1D9YA 4QRZA 4RXLA 3G3IA 4X1BA 2ZNUA 4KI0E 5HM4B 3O6GA 4F2QA 1NH8A 2ZNTA 1Y20A 3A09A 3KFMA 4OXVA 2HQ0A 5ICQA 3H7MA 1IUDA 1PB9A 3B6WA 2A5TB 1PB8A 4F39A 1FQBA 2O7IA 2QS4A 5CMMA 4NE4A 1IXGA 2IA4A 4QSDA 1N84A 3MVWA 4MLVA 2Y7PA 4X48A 3KOTA 4OWDA 3R6UA 3LR1A 4YKIA 1FQFA 3G7WA 1PC3A 1N3XA 2I4BA 3DP6A 4JWXA 3W9WA 5TP9A 1LFGA 3FVKA 4R73A 1OQGA 1SW5A 4BDOA 2H25A 2I6EA 3KSJA 4IO5A 1VE4A 4U2RA 4KR5A 1M5FA 1B46A 4E0WA 3D4CA 3HO7A 1L5TA 1SW4A 2V25A 1R6ZA 3IOWA 2QSXA 1USYH 2O68A 1B5IA 1LB9A 5JEIA 3MP8A 3SKPA 2F8DA 4PFWA 3T9XB 1BLFA 3U1OA 2XXPA 2H98A 3LSFB 1LLSA 3H6TA 3M3KA 2XXVA 4GF8A 4BDRA 4BDMA 4OYVA 1H3DA 4FE8A 1B9JA 5HBCA 3THIA 2F34A 2HXWA 5EHMA 3ZKLA 4JB7A 3RTFB 5I2NA 5TP9B 3CG1A 2XX9A 1AOVA 4GXAA 4EXLA 4GWOA 4R2BA 1MY4A 3PPOA 4YAHX 1KWHA 3UGWA 1A54A 1MH3A 2REGA 3IJXB 5BWJA 1Y3QA 4E0XA 5I57B 1SW2A 2X7QA 3L6GA 2F78A 3PPPA 3TQWA 1FQDA 1I6QA 2XHDA 3K6XA 2ZMBA 4F29A 3IB1A 4P0GA 4WEPA 1R1NA 3E4RA 1FQCA 3E13X 4GL0A 5KCJA 3K6UA 1B4ZA 4PP0A 1OLCA 5L9MA 4FEDA 1XVYA 5AA4A 2NOOA 1ZTYA 4AQ4A 2Z8DA 3H6VA 3OO7A 4G4PA 4GFRA 5L8DA 1Q1KA 3QSLA 1D9VA 1H43A 3VE1B 3VVFA 1SI1A 1N76A 3ILUB 3IORA 1LBCA 1MXUA 1SI0A 1Y3PA 2E0SA 3H4ZA 3OOAA 2UVGA 2NVUB 1B32A 5I56A 2A5TA 4KCCA 3CFXA 4OQOA 1A99A 4OFOA 4H67A 4H8JA 4QFLA 4N07A 4IY6A 2O7UA 1UIUA 3FZVA 3W15C 3EN3A 4DLDA 2HAUA 4IGRA 1UQWA 1XS5A 2QS1A 2XXTA 5DEXA 5AA4B 2B65A 3FD3A 3MWBA 2H4IA 4F1YA 1TFAA 1NKXA 4ELOA 4H65A 1URDA 4OMBA 1B5HA 1B3GA 1H45A 2GHAA 2UVJA 3MP6A 4ZEBA 4ECFA 1SYIA 2I0BA 4KYDA 4C0RA 4ELQA 3MC2A 1LSTA 2F97A 3QYTA 4G68B 5A5XB 3S9NC 3RNNA 5FHOA 1LAGE 1UTHB 4ESXA 1MQGA 3K01A 1JW1A 3EHSA 3SESA 2KLFA 1QJMA 1MXZA 5H8QA 3DP8A 5LOMA 4MF3A 2R9JA 3E9XA 3LC8A 5CMKA 1JVYA 1O63A 3EQ1A 3L6HA 4G8NA 4KFQA 2ESNA 4DCYA 1B1XA 4F31B 3HHFA 1B52A 3S9MC 4G8MA 2FA7A 3O66A 5M2VA 1LBBA 2Z8EA 1PBQA 3FXUA 5L9OA 4ZEFA 1OMPA 4QHQA 1B1HA 2O1LA 1B7ZA 3G3FA 1GV8A 4H6DA 2HFBA 4GXSB 2AIXA 1JNFA 1R9QA 1WODA 1QUIA 5I58A 1IQ7A 1P1UA 3LSWA 3TFLA 4FATA 4M4GA 5FHNA 1P1OA 3PU5A 3T9VA 2D3IA 5AA2B 2F35A 3TELA 1YTVA 1MQDA 3N6TA 4ONYA 3CRBA 2DOJA 1QULA 3IL1B 5H8NA 3VLVA 5I2KA 3FVNA 3IR1A 4EF2A 2ZNSA 4OESA 3HCQA 1Y4CA 4FAJA 1I6BA 2DWIA 3RY3A 1WDNA 1Y1ZA 1MXWA 4JDFA 4QFNA 5ITPA 1JEVA 3UA8A 1A8FA 3P7IA 3TCGA 3TCFA 1Q35A 2RCAA 2G93A 1HSEA 3CIJA 2Y7RA 4U1OA 3RLFE 2ONRA 5I58B 3TTNA 2RF1A 4Z7EA 2CMOA 4MLQA 4GLIA 3FJGA 1ANFA 1BTJA 1MPCA 2PX1A 1B51A 1MPDA 1R9LA 2BJJX 1GTKA 2F5XA 1XC1A 2Q9TA 1GGGA 5H8FA 1B40A 3G3JA 4TQUQ 2PYYA 2OWTA 4LQ2A 4ZZAA 2DSFA 2HZKA 2D5WA 3N94A 4KYSA 1PDAA 3Q28A 3WAFA 3VVDA 2QMWA 3ZS6A 2XD3A 1B58A 4I1DA 1LFHA 4EF1A 2Z23A 3MVXA 2VGQA 3ZKKA 4ISUA 1IXHA 4AB6A 4DDDA 1LAXA 1XOCA 3C4MA 1MXVA 1UIVA 3K2DA 3PGFA 2OZZA 1UTHA 3RT8A 4ND9A 3G3HA 3RUMA 3E3KA 5CMCA 3TCHA 1SBPA 1S50A 3B7DA 3KGCA 1YPNA 4ZEDA 3UK4A 3VLUA 3T9HB 3TKDA 2VD3A 3MP1A 4DXCA 1POTA 3LSLA 2ZYKA 4YB5A 3T93B 1OLAA 2A5SA 2QJEA 2Y7KA 2XXWA 1TFDA 4F3SA 3N6UA 1MH4A 1I6AA 2DVCA 4U22A 2E1SA 4LVQA 5H8HA 1F9BA 1ZJLA 3UN6A 2Q88A
chains in the Genus database with same CATH superfamily
2WX9A 4PQJA 1LAFE 4PF6A 3O29A 3M3FA 5IZ3B 3U92A 3K1NA 1VDWA 1Y4TA 3S9EA 1H44A 5DVJA 1XT8A 2DWJA 3IK6B 4LA9A 2GHBA 2F6PA 4MCOA 5FTIA 1JQFA 4RA1A 4GWSA 5ESYA 4JXIA 3TTMA 3OD7A 2UVHA 2OX3A 4Q0CA 4G68A 3TTLA 1URGA 3QAXA 5DVIA 1B0HA 2CZIA 3MPKA 3FBPA 4ZE9A 1FQAA 2F7AA 5I7IA 4WEDA 1PB7A 2OBGA 3A29A 4LZ7A 4O3AA 2G29A 4GQOA 4RNSA 2FYIA 3CI8A 3FV1A 5CI5A 4GX3A 1FBHA 2VOZA 3DM0A 3TZAA 4F1UA 2HZLA 4Z0IA 1N7XA 3U65A 1DOTA 4YMBA 1YAEA 3OXNA 4IGTA 4YKKA 1LAHE 3RPWA 3SEXA 4DZ1A 4PCDA 2Z8FA 3AXFA 1I69A 5KDTA 2CZKA 4JSDA 2QFLA 3PTYA 3BBRA 3JV9A 3PUXE 2XXHA 3WAEA 1NNKA 2XWIA 2ZYNA 3LUZA 4EQBA 4GVOA 5EQ7A 4PFRA 4R6HA 3K0VA 4PAIA 3K4UA 2OWZA 1FTAA 3N26A 5ELVA 1SD3A 4XTCQ 3TQLA 2AL4A 5CM6A 2VHAA 2UYFA 3ECRA 4OHNA 3PD9A 3C33A 4TLMB 1II5A 4EQ9A 4U23A 3TEPA 3PUYE 1B3EA 3MZ1A 4Q30B 1B0LA 3H03A 1DTZA 2PMSA 2QPQA 4PFUA 3MUQA 2ANJA 2PFZA 4GX4A 1P1WA 3RQTA 1HSLA 2D21A 5F7VA 4GX6A 4M1VA 1MG1A 5JK4A 1FTKA 3V5AA 4QF9A 1LBWA 2V3TA 1US4A 4DIGA 2FNCA 2HCAA 3IOVA 4P8BA 2Q8JA 2VD2A 4ELRA 3KJTA 1FTOA 3IB0A 1MXXA 2I3VA 3SEUA 3QUJA 4XIGQ 5TU0A 4OVTA 4AB5A 5KZTA 3SETA 4OVSA 3KN7A 4UA8A 4JWOA 4XFEA 2ZZVA 4DXUA 3KOSA 4N8YA 3W9VA 5AA2D 1M5EA 1SYHA 3C34A 4MIJA 4GWWA 5JTYA 2WBBA 4ZDMA 2PBWA 3FATA 2Q74A 2I4CA 2QVRA 1IZ1A 1MM7A 4YZZA 3IB2A 3FVGA 3A3UA 4RPNA 5ITOA 4OZ9A 2Q89A 5DTBA 5ET8A 1B5JA 4IO7A 2QL3A 4I62A 3KSXA 1EYKA 4O7MA 2F36A 2I58A 4YKPA 3MQ9A 1NNPA 2V3UA 1FPFA 1M5BA 2Y84A 4IR8A 1FPJA 4IO3A 1QW0A 4NF6B 2REJA 4P1LA 1MM6A 1NFTA 1IMFA 2H9BA 1GVCA 5A5XA 1NNTA 3LBSA 2VP1A 3N5LA 1AH5A 3H6WA 5DEXB 1B3LA 4NEDA 3PMVA 3OENA 4DE8A 4RXLA 3O6GA 2ZNTA 4OXVA 1PB9A 3B6WA 2A5TB 4F39A 1FQBA 2O7IA 5CMMA 2IA4A 1FQFA 3G7WA 2VT5A 1BK4A 1NV3A 2XA5A 2V25A 3IOWA 1NV2A 2F8DA 4PFWA 3H6TA 2XXVA 4BDMA 2HXWA 1YXIA 4JB7A 5I2NA 2XX9A 2ZZXA 4R2BA 4YAHX 4AS4A 1NV4A 1SW2A 2X7QA 3L6GA 3PPPA 3K6XA 1FBEA 4N8GA 3E4RA 3E13X 1B4ZA 3OO7A 5L8DA 4PF8A 1CNQA 1Y3PA 4KCCA 4OQOA 1A99A 4DI4B 1UIUA 2HAUA 4IGRA 5DEXA 5AA4B 2B65A 2H4IA 1URDA 2UVJA 2I0BA 1LSTA 5A5XB 3K01A 2KLFA 3MSTA 5LOMA 5J16A 1O63A 3EQ1A 3L6HA 4GWUA 4F31B 3HHFA 2Y5KA 2DDKA 3O66A 2Z8EA 4QHQA 1B7ZA 4MEVA 1JNFA 5I58A 1QUIA 4FATA 3LSWA 3PU5A 1G0HA 1MQDA 4HE2A 4MNCA 1QULA 4PGNA 4AS5A 5H8NA 3VLVA 3IR1A 4NG7A 1Y4CA 2DWIA 3RY3A 1WDNA 1Y1ZA 1DCUA 5IZ3A 5ITPA 5I3SA 3P7IA 4MMPA 1Q35A 3CIJA 1HSEA 4PAKA 3RLFE 2ONRA 5I58B 4QXDA 2CMOA 4XXUA 2Q9TA 1R9LA 1B40A 3G3JA 4TQUQ 2PYYA 2DSFA 3Q28A 3VVDA 1B58A 4I1DA 4I40A 4ISUA 2VPNA 3C4MA 3K2DA 1MXVA 3RT8A 3B7DA 4NQ8A 3UK4A 2VD3A 2ZYKA 2A5SA 4OA4A 4F3SA 3N6UA 5H8HA 1T0KA 3Q29A 1FQEA 3UN6A 2XXYA 4G77A 3MZ9A 5IAIA 3K00A 1USYE 2DWAA 4MJOA 4FIMA 3PUZE 1D9QA 4MFIA 1NUZA 5EYFA 4EUOA 4X8RA 2RC9A 2RCBA 4PAFA 5H8HB 3FJMA 3TMGA 4F3BA 1B3FA 3PV0E 4IY5A 1VFEA 4XF5A 5H8NB 5EQAA 1S7YA 1FCKA 4R9FA 3PPNA 3Q27A 3S4UA 2ALUA 2F3BA 4PFTA 1DTGA 1MPBA 2YPNA 4YU0A 3EHUA 1UTBB 1ZBMA 4P9KA 5CBSA 3T9UA 1MDP1 4MH5A 4JVDA 1EU8A 3T66A 2P3VA 2CEYA 2XX7A 1NV6A 3PUVE 1OIBA 4NF8B 1NUYA 2Y7WA 2HEUA 2DS9A 4NF4B 1ELJA 2XXRA 4KQPA 5KCJB 2GRVA 4XKRA 1MDQA 3K6VA 4YKJA 4ZS9A 4HTGA 3IFCA 1RKMA 1FTJA 1Z7NE 2AYSA 1BIYA 3PMXA 4OFLA 3SERA 4WXJA 3USDA 1B2HA 2BJIA 2UXAA 3CSBA 2ZZWA 1A40A 3FIRA 2FVZA 2RINA 3TTRA 3SDFA 1EZ9A 4F18A 3QXMA 4XKQA 3MVYA 2XXIA 4PC9A 3PUWE 1RYXA 1LCTA 4RYAA 1FTLA 3CVGA 1EZPA 2WBDA 4YMAA 3RYDA 4F3PA 3MJNA 2OCUA 3OO9A 1UTBA 3I3VA 3OO8A 1B6HA 2AL5A 4OMBA 2LAOA 1AMFA 3IJOB 4BLAA 1M5DA 5DVFA 1FSAA 4R74A 4MAGA 4LUBA 4PFBA 2HHMA 3GYYA 1IXIA 3OELA 3HPIA 4N6KA 4XKNA 2QVUA 3LSXA 3RTWB 4PE5B 5K2XA 1OVTA 4QFKA 3IAZA 4G2ZA 3KEIA 3MZBA 1CB6A 4PFYA 1OQHA 2CZLA 4H0WA 5I59B 4ZZEA 1HSJA 3KG2A 4QFPA 4R6YA 5FTHA 5EQ9A 3TUSA 4KCDA 1IMDA 3T96B 4BDNA 1A7LA 3TTKA 2P2AA 1B05A 2ZXTA 3O2AA 3MVZA 5CMBA 2RC7A 2ONSA 1FPKA 4MBPA 4F19A 4EXKA 1ZLQA 4NTLA 1MQJA 2GFEA 4H5FA 3FASA 2QS3A 1BKAA 3ZSFA 4F22A 4GIZA 1S9TA 1Z7ME 3I6VA 2UYEA 2ZYMA 4LQ5A 1DK4A 1LBXA 2YJPA 4OFJA 4R72A 4ZEKA 3MPLA 3VDFA 1FBPA 5B70A 2X26A 4GBVA 4R75A 4F1VA 3M3LA 2F6GA 2DVZA 4PFIA 3U72A 3EPEA 4FECA 2I49A 1PEBA 3ODBA 2UVIA 3G3KA 3RN8A 1N7WA 1LBZA 4IO4A 2OLBA 1JW4A 1MY3A 4X1DA 1AIVA 1LCFA 4K3FA 2OK2A 1Y9UA 4FORA 2ZYOA 2QRYA 1DPEA 1QKAA 4Q5TA 4OEUA 1DPPA 5I2NB 4H5GA 4QFOA 4LATA 4X1BA 2ZNUA 5HM4B 1NH8A 3A09A 5ICQA 1PB8A 2QS4A 1N84A 4OWDA 3R6UA 4OVQA 4JWXA 3KSJA 4U2RA 1VE4A 4KR5A 1SW4A 1USYH 1B5IA 4OVRA 3SKPA 3T9XB 3M3KA 1LLSA 3CG1A 4GXAA 4EXLA 1MY4A 3PPOA 1KWHA 3UGWA 1A54A 5BWJA 3RPLA 3TQWA 4GWZA 2ZMBA 4WEPA 1R1NA 3D1RA 3K6UA 1OLCA 3E79A 4G4PA 4PGPA 3QSLA 4I3EA 1H43A 1SI1A 3ILUB 3IORA 1LBCA 3H4ZA 3OOAA 2A5TA 1AWBA 1FPIA 3EN3A 4F1YA 3MWBA 1TFAA 4ELOA 1B3GA 5FHOA 5EQ8A 1NV5A 3SESA 3DP8A 3E9XA 3S9MC 2PCRA 4JVIA 5M2VA 1OMPA 1B1HA 2O1LA 4H6DA 1IQ7A 1YYZA 2R8TA 4M4GA 5FHNA 1P1OA 4GBWA 2D3IA 2F3DA 5AA2B 3CHGA 3N6TA 3IL1B 3FVNA 4JVCA 4PBQA 4QFNA 4MX6A 4NHBA 2RCAA 2G93A 4MLQA 1ANFA 1BTJA 2BJJX 1GTKA 1XC1A 5H8FA 1GGGA 2OWTA 4ZZAA 1PDAA 4HXVA 2Y5LA 2VGQA 1IXHA 1LAXA 1UTHA 3KBZA 3E3KA 2CZHA 3T9HB 4DXCA 3LSLA 4YB5A 2Y7KA 2XXWA 1MH4A 4U22A 2E1SA 1F9BA 5I56B 3O28A 3DELB 4KXPA 3QUFA 4NAPA 1NNFA 3GBAA 3TDJA 2PT1A 2L5VA 3KC0A 3IX1A 2Q2CA 2P0SA 5EHSA 4OERA 1J1NA 1FPGA 4XKPA 1A8EA 3GBBA 4U4SA 1FW0A 4O3CA 5IZZA 1DMBA 2HAVA 3GXAA 1TWYA 4RK9A 4X9TA 2O84X 4LP2B 4P11A 2IEEA 2CEXA 1FPDA 2XXQA 2WYPA 5J1DA 3FGSA 4KHZE 1NMUA 4N6PA 1US5A 1KA1A 3ROJA 4ESWA 1D3KA 3K1MA 1N04A 4R2FA 4N13A 4OEVA 4DCXA 3SEYA 2QMXA 1K9YA 3KC1A 4TOZA 1JW5A 1CE2A 4PTKA 2DXYA 2DE4A 5KDTB 3U94A 4H8IA 3B6QA 3UORA 4GWYA 2XWKA 4PETA 5ET5A 1IXCA 2JJKA 1LBYA 4QBAA 1IEJA 3V89B 4L17A 1NH7A 3CR9A 4ZECA 4O7IA 5TPAA 2RKMA 2H5YA 3Q26A 1EYJA 3IO6A 3K6WA 3PPQA 3U93A 5FBPA 5TPAB 2B3BA 3EHTA 3CG3A 3VXCA 1FTMA 3UIFA 5DT6A 4FEBA 1FRPA 1BP5A 2R71A 4F2OA 2DQVA 3OO6A 1FBDA 3OSRA 4G8HA 4P0IA 2V93A 4R6KA 1SDXA 2NXOA 3GLBA 3R26A 4GRKA 1RDXA 3C32A 5DYHA 3F11A 1EH3A 1VFDA 3BFUA 4KPTA 2ABHA 2V4CA 5HPQA 1RDYA 2OWSA 1GR2A 3A3CA 1FBFA 4XEQA 3KN8A 2DE3A 4HS7A 4WKMA 3SEVA 3G3GA 4H1XA 1VR5A 3JZJA 3VLWA 1FBGA 2GH9A 3TYHA 1ZIUA 3HN0A 3FVOA 3GZGA 4YB6A 3OSQA 2XWOA 3OEKA 3T22A 4MNIA 5BUUA 5H8SA 4QSCA 4KYEA 4I3YA 1MY0A 4POXA 4UACA 5LDZA 1IMAA 3I5OA 4NMYA 2V3QA 3OEMA 3PMWA 1JETA 4YICA 3VFJA 5CC2A 3V83A 4EQ7A 3KBRA 5I59A 4O94A 2Z22A 4P56A 2PT2A 3SZPA 1Q9DA 3KN3A 1MRPA 3TAJA 1XHYA 4ESXA 3U8QA 1Y3NA 4RY1A 3O9PA 4NGUA 4C1TA 4N6DA 5ISUA 3H06B 4BDLA 1YCJA 4R9GA 4JSOA 1N0TA 3C31A 1NV7A 1ATGA 2WYKA 2M8CA 3BIHA 3FJ7A 2H99A 1JVXA 4JBZA 1QKBA 4QRZA 4I8CA 1D9YA 4PDDA 4F2QA 1LEVA 3KFMA 2HQ0A 3H7MA 5EYGA 4NE4A 1IXGA 4P47A 4QSDA 4MLVA 3MVWA 4X48A 1FPBA 4HE0A 5TP9A 1LFGA 1SW5A 2H25A 4IO5A 5DW8A 4P1EA 1M5FA 4H45A 4E0WA 3U1OA 2H98A 3LSFB 1NUWA 1K9ZA 4BDRA 4OYVA 2MKZA 1H3DA 4FE8A 5HBCA 5IM2A 3ZKLA 4N81A 3RTFB 1AOVA 3IFAA 4GWOA 1MH3A 4X04A 1Y3QA 4E0XA 2F78A 4F29A 5KCJA 4FEDA 1XVYA 5T3JA 2Z8DA 2XXKA 4GFRA 1Q1KA 3VE1B 3VVFA 2E0SA 4N15A 1XI6A 2UVGA 4H8JA 4N07A 4IY6A 3FZVA 4DLDA 2FHYA 1UQWA 1XS5A 2XXTA 3FD3A 5ET6A 1B5HA 2GHAA 4ZEBA 4ELQA 4KYDA 3MC2A 4G68B 3S9NC 3RNNA 1LAGE 1UTHB 1MQGA 1QJMA 5H8QA 4MF3A 2R9JA 5CMKA 3LC8A 1JVYA 4G8NA 4KFQA 3B8BA 1B1XA 4G8MA 2FA7A 5L9OA 1GV8A 2VPOA 4GXSB 4H46A 1R9QA 4PBHA 1P1UA 1RDZA 3T9VA 1NV0A 2F35A 3TELA 4ONYA 3CRBA 5I2KA 4OESA 1I6BA 1JEVA 3UA8A 1A8FA 1INPA 2KR0A 3EKIA 1FJ6A 2Y7RA 2RF1A 4N4UA 1MPCA 2PX1A 1MPDA 3WAFA 2QMWA 2XD3A 4EF1A 2Z23A 3MVXA 2OZZA 4NX1A 4ND9A 5I5PA 3G3HA 3RUMA 1KA0A 4ZEDA 3VLUA 3TKDA 1POTA 3T93B 2QJEA 2HXRA 1I6AA 1EYIA 3S2VA 1LGBC 4KD5A 4BDQA 4O3BA 3QMFA 1B4HA 3MBPA 5CRYA 3TPAA 2XD2A 3T0JA 2B3FA 5I84A 1D4NA 3BFTA 3RGYA 1JP4A 2O1MA 4C1UA 3C35A 3FXBA 1NV1A 1DBZA 1POY1 4HE1A 4N91A 3HSTA 3BIGA 5F1QA 4GOTA 4F3GA 5AA3A 2F7CA 3ONMA 4RPOA 1NI9A 1A55A 2O69A 2I3WA 3B50A 2DP8A 3OMBA 3VXBA 4ELPA 2P1SA 3RPLB 1NL5A 2YLNA 3IOTA 4IO6A 5F24A 3H6UA 4U1ZA 3C36A 4HCWA 1AL3A 3V8XB 4NF8A 2XXUA 3EF7A 3RT6B 3QIMA 3CSGA 4G61A 4PDHA 5ET7A 1LB8A 5H8QB 2QVVA 3LUYA 2Q2AA 2I48A 4OTEA 4DXBA 3Q25A 2THIA 1B7UA 2W7YA 3D4GA 3UP9A 3C9HA 5ICTA 2XXXA 3TODA 1M5CA 1SW1A 1MQHA 3S9LC 1G0IA 1SVXB 4LZ5A 2FBPA 2DWHA 5I57A 5A5LA 4HCYA 4IO2A 4G68C 3ILTB 2ONKE 2DXRA 3HV1A 4OETA 3DLNA 3CFLA 5AE4A 2DE2A 1QUJA 3FXRA 4LZ8A 1TXFA 3KZGA 2PVUA 1O7TA 1P1QA 2OJTA 1H76A 1SQYA 2Q8MA 5L9SA 4NF6A 2Y7IA 5K2YA 4GL8A 4I9DA 4LN5A 4NF5B 3FUZA 3DP4A 4FJPA 3FXQA 4UABA 1OVBA 4DI3D 4LVQA 1WVJA 3CFZA 1MS7A 5FHMA 2B4LA 2R6GE 2XWVA 1TT1A 4LONB 1B3HA 1ZKBA 4TLLB 4EDPA 4NN3A 2WKYA 1JEUA 3VVEA 1PBPA 1LFIA 1ZU0A 1P99A 1XVXA 3KJ7A 4YB7A 2F7BA 1QUKA 2NUVA 4RJZA 3IOUA 4GD5A 5CBRA 3O6HA 3MYUA 3BKIB 1URSA 3O6IA 4JWYA 1P1NA 2O51A 2FIEA 2RC8A 1VSOA 2O6AA 1MQIA 5IKBA 5JTYB 4OENA 2QS2A 1O64A 1IITA 5I2KB 3VV5A 4ZEIA 4OVPA 2X7PA 3K1PA 3IO4A 1B7HA 1MY2A 4IB2A 3H3GA 4RK2A 3K02A 4U21A 4FBPA 4ZE8A 5LTCA 4THIA 3MAMA 4NF0A 1NUXA 1MXYA 5AA1A 1N3WA 2WEFA 5H8FB 2B4MA 1Y1MA 5B7DA 3JYRA 5AA2A 4P3LA 3QK6A 3MW0A 3O97A 3SEWA 3PPRA 3R7XA 4U4XA 3B6TA 3PD8A 1FPLA 1QVSA 1RYOA 3M8UA 1EZOA 4MHFA 1IIWA 4NWCA 4NWDA 4O8MA 4QSEA 1ZMGA 2XX8A 2NWJA 2V84A 4NF5A 3HHGA 4POWA 4Q8RA 2DYXA 4NF4A 3FV2A 1MY1A 2I0CA 3HFUA 5IGAA 1DSNA 4OVJA 4HW8A 3G3IA 4KI0E 1Y20A 1IUDA 2Y7PA 3KOTA 3LR1A 4YKIA 1IMBA 1PC3A 1N3XA 2I4BA 3DP6A 3W9WA 3FVKA 4R73A 1OQGA 4BDOA 1FJ9A 2I6EA 1B46A 3D4CA 3HO7A 1FBCA 2GQ1A 1L5TA 1R6ZA 2QSXA 2O68A 5EYHA 1LB9A 5JEIA 3MP8A 1BLFA 2XXPA 4GF8A 4MNPA 3THIA 1B9JA 2F34A 5EHMA 5TP9B 2REGA 3IJXB 5I57B 1FQDA 1I6QA 2XHDA 3IB1A 4P0GA 1FQCA 4GL0A 4PP0A 5L9MA 5AA4A 2NOOA 1ZTYA 4AQ4A 3H6VA 3LV0A 4GWXA 1D9VA 1QGXA 1N76A 1MXUA 1SI0A 2NVUB 5I56A 1B32A 1IMEA 3CFXA 4OFOA 4H67A 2O7UA 3W15C 1IMCA 2QS1A 4PE3A 1NKXA 4H65A 1H45A 4ECFA 3MP6A 1SYIA 4C0RA 2F97A 3QYTA 2KQZA 1JW1A 3EHSA 1MXZA 2ESNA 4DCYA 1B52A 1LBBA 1PBQA 3FXUA 4ZEFA 3T1BA 1YZ0A 3G3FA 2HFBA 2AIXA 1WODA 2P3NA 3E78A 3TFLA 2FIXA 5IZ1A 4N17A 1YTVA 2HPGA 1SPIA 2DOJA 4EF2A 2ZNSA 3HCQA 4FAJA 3NOHA 1MXWA 4JDFA 3ISPA 3TCGA 3TCFA 1KZ8A 4U1OA 3TTNA 4Z7EA 4GLIA 3FJGA 2PFYA 4QFLA 1B51A 2F5XA 4LQ2A 2HZKA 2D5WA 3N94A 4KYSA 3ZS6A 1FPEA 1LFHA 3ZKKA 4AB6A 4DDDA 1XOCA 3PGFA 1UIVA 5CMCA 3TCHA 1SBPA 1LBVA 1S50A 3KGCA 1YPNA 3MP1A 4OANA 1OLAA 1TFDA 2DVCA 1ZJLA 2Q88A
chains in the Genus database with same CATH topology
2XXYA 4G77A 3MZ9A 3S2VA 5I56B 5IAIA 4PQJA 3O28A 3K00A 1LGBC 1USYE 4KD5A 1LAFE 4BDQA 4O3BA 3Q29A 2DWAA 3DELB 4FIMA 4F1UA 3O29A 3M3FA 3QUFA 1B4HA 3MBPA 3PUZE 3U92A 5CRYA 3TPAA 3K1NA 4MFIA 5EYFA 4EUOA 1NNFA 1Y4TA 2RC9A 3GBAA 2XD2A 3TDJA 2RCBA 2PT1A 2B3FA 1H44A 5DVJA 3S9EA 1XT8A 3IX1A 5I84A 2Q2CA 2P0SA 1D4NA 3BFTA 3RGYA 2DWJA 5EHSA 2O1MA 4OERA 3IK6B 5H8HB 4C1UA 3C35A 1J1NA 3FJMA 3TMGA 4F3BA 4LA9A 1POY1 1B3FA 3PV0E 4IY5A 1VFEA 2GHBA 2F6PA 5H8NB 4XKPA 1A8EA 3GBBA 3HSTA 1S7YA 4U4SA 1FCKA 5FTIA 1FW0A 1JQFA 4RA1A 5F1QA 4GOTA 4F3GA 5AA3A 2F7CA 4O3CA 3ONMA 4JXIA 4R9FA 3TTMA 1DMBA 3OD7A 3PPNA 2HAVA 1A55A 4RPOA 2UVHA 3Q27A 3GXAA 3S4UA 1TWYA 2ALUA 2O69A 4PFTA 2I3WA 4Q0CA 4G68A 1DTGA 1MPBA 2YPNA 3TTLA 4YU0A 1URGA 2DP8A 3OMBA 3QAXA 3EHUA 1UTBB 4RK9A 4X9TA 2P1SA 3VXBA 4ELPA 2O84X 1NL5A 1B0HA 1ZBMA 4LP2B 5DVIA 3MPKA 5CBSA 2YLNA 3T9UA 4P11A 3IOTA 4IO6A 3H6UA 1MDP1 4U1ZA 3C36A 4ZE9A 1FQAA 2F7AA 2IEEA 1AL3A 4HCWA 4MH5A 1EU8A 2XXQA 3T66A 3V8XB 4NF8A 4WEDA 5J1DA 3FGSA 1PB7A 2OBGA 2XX7A 3PUVE 2XXUA 3EF7A 4KHZE 1OIBA 4LZ7A 1NMUA 4O3AA 4N6PA 4NF8B 3RT6B 1US5A 2G29A 3QIMA 4GQOA 3CSGA 2FYIA 2Y7WA 4RNSA 4ESWA 1D3KA 3K1MA 3CI8A 1N04A 2HEUA 4R2FA 3FV1A 5CI5A 4N13A 4OEVA 2VOZA 1LB8A 2DS9A 5H8QB 3SEYA 4DCXA 3LUYA 3DM0A 2Q2AA 2I48A 4NF4B 4OTEA 1ELJA 2HZLA 2QMXA 2XXRA 4KQPA 3TZAA 3Q25A 4Z0IA 5KCJB 1N7XA 4TOZA 1JW5A 1DOTA 2THIA 2GRVA 4YMBA 4XKRA 1B7UA 2W7YA 1CE2A 1YAEA 1MDQA 3K6VA 3D4GA 4YKJA 3OXNA 3UP9A 3C9HA 4ZS9A 5ICTA 4IGTA 4YKKA 1LAHE 2DXYA 1RKMA 2XXXA 4HTGA 1M5CA 1FTJA 1Z7NE 3RPWA 3SEXA 1SW1A 1BIYA 2AYSA 1MQHA 2DE4A 4DZ1A 5KDTB 3S9LC 3PMXA 4OFLA 1SVXB 3SERA 4H8IA 3B6QA 4LZ5A 3U94A 3UORA 2Z8FA 3AXFA 4WXJA 1I69A 1B2HA 3USDA 5KDTA 2UXAA 2DWHA 3CSBA 5I57A 4PETA 1IXCA 4HCYA 4IO2A 4DXBA 1A40A 3FIRA 1IEJA 4JSDA 3V89B 2RINA 4G68C 4L17A 3TODA 1NH7A 3ILTB 2ONKE 2DXRA 3BBRA 3HV1A 4OETA 3TTRA 3DLNA 3JV9A 3SDFA 3CR9A 4ZECA 1EZ9A 2XXHA 3CFLA 3PUXE 3WAEA 5TPAA 4F18A 3QXMA 1NNKA 4XKQA 5AE4A 2DE2A 3MVYA 2ZYNA 1QUJA 2XXIA 3FXRA 2RKMA 4EQBA 4GVOA 2H5YA 1FQEA 1TXFA 3PUWE 1RYXA 3KZGA 4LZ8A 3Q26A 1LCTA 3IO6A 4R6HA 2PVUA 4RYAA 3K6WA 3K0VA 1FTLA 3PPQA 1O7TA 1P1QA 2OJTA 1H76A 3K4UA 1SQYA 3U93A 5TPAB 2B3BA 3CVGA 1EZPA 5L9SA 4NF6A 2Y7IA 5K2YA 4YMAA 4GL8A 4I9DA 3EHTA 4NF5B 3CG3A 3VXCA 3N26A 3FUZA 1FTMA 3DP4A 4F3PA 5ELVA 1SD3A 3MJNA 5DT6A 3UIFA 4FEBA 2OCUA 4FJPA 4XTCQ 3FXQA 3OO9A 2AL4A 3TQLA 1UTBA 1OVBA 3I3VA 5CM6A 1BP5A 2R71A 3OO8A 4F2OA 2AL5A 1B6HA 1WVJA 2DQVA 2LAOA 2VHAA 1AMFA 1MS7A 3CFZA 2UYFA 5FHMA 3ECRA 4OHNA 3PD9A 3IJOB 3OO6A 3OSRA 3C33A 4G8HA 1II5A 4TLMB 4BLAA 1M5DA 4P0IA 5DVFA 2R6GE 2V93A 1TT1A 4LONB 4R74A 1B3HA 4EQ9A 4U23A 1ZKBA 4TLLB 4LUBA 4EDPA 3PUYE 3TEPA 4R6KA 2WKYA 1B3EA 1JEUA 1SDXA 2NXOA 3GLBA 3MZ1A 3R26A 4GRKA 1PBPA 3VVEA 1LFIA 3C32A 1IXIA 1ZU0A 1P99A 3OELA 1XVXA 3F11A 4Q30B 1B0LA 5DYHA 3HPIA 3H03A 4XKNA 1DTZA 2PMSA 2QPQA 3KJ7A 3MUQA 4PFUA 4YB7A 2F7BA 3LSXA 1QUKA 1EH3A 2ANJA 4PE5B 5K2XA 3RTWB 1VFDA 3BFUA 1OVTA 4KPTA 2NUVA 3IAZA 4G2ZA 4QFKA 3KEIA 4RJZA 2ABHA 3IOUA 3MZBA 1P1WA 3RQTA 4GD5A 1HSLA 2D21A 5F7VA 5HPQA 5CBRA 3O6HA 1CB6A 4PFYA 4M1VA 1MG1A 5JK4A 2OWSA 1OQHA 2CZLA 3BKIB 4H0WA 1FTKA 5I59B 3V5AA 4ZZEA 4QF9A 4DE8A 1URSA 1HSJA 2V3TA 3KG2A 1US4A 3O6IA 4QFPA 2FNCA 4DIGA 2HCAA 4JWYA 1GR2A 3A3CA 1P1NA 4R6YA 5FTHA 2O51A 3IOVA 3KN8A 2RC8A 3TUSA 1VSOA 2O6AA 1MQIA 4KCDA 5IKBA 2Q8JA 2DE3A 2VD2A 4HS7A 5JTYB 3T96B 4OENA 4WKMA 4BDNA 4ELRA 3SEVA 3G3GA 2QS2A 1O64A 1FTOA 1A7LA 3KJTA 3TTKA 2P2AA 1MXXA 1B05A 2ZXTA 1IITA 3IB0A 4H1XA 5I2KB 1VR5A 2I3VA 3JZJA 3O2AA 3VV5A 3MVZA 3SEUA 5CMBA 3QUJA 2RC7A 2ONSA 4XIGQ 3VLWA 5TU0A 2GH9A 4MBPA 4ZEIA 3TYHA 2X7PA 4AB5A 4F19A 4EXKA 1ZLQA 1ZIUA 4NTLA 3K1PA 3HN0A 5KZTA 3IO4A 1B7HA 1MQJA 2GFEA 1MY2A 4H5FA 3FVOA 4IB2A 3GZGA 3FASA 3H3GA 2QS3A 4RK2A 3K02A 3OSQA 4U21A 4YB6A 3SETA 3OEKA 1BKAA 3KN7A 4UA8A 4ZE8A 4GIZA 3T22A 3ZSFA 4F22A 4JWOA 5H8SA 5BUUA 4DXUA 1S9TA 1Z7ME 3I6VA 3KOSA 2UYEA 2ZYMA 4LQ5A 4QSCA 3W9VA 4KYEA 5AA2D 1M5EA 2YJPA 1SYHA 3C34A 1MY0A 4OFJA 4POXA 4THIA 4UACA 5JTYA 4R72A 4ZDMA 2PBWA 3MAMA 3FATA 3I5OA 4NMYA 4ZEKA 2V3QA 3MPLA 3OEMA 3PMWA 1JETA 2I4CA 3VDFA 1T0KA 4YICA 1IZ1A 3VFJA 5CC2A 1MXYA 1MM7A 4YZZA 5B70A 5AA1A 3V83A 1N3WA 4EQ7A 2X26A 3KBRA 5H8FB 3IB2A 5I59A 1Y1MA 2Z22A 5B7DA 2PT2A 3FVGA 3A3UA 4R75A 4RPNA 5ITOA 4F1VA 3M3LA 4OZ9A 2Q89A 2F6GA 3KN3A 3JYRA 5AA2A 2DVZA 5DTBA 3U72A 3QK6A 1B5JA 1MRPA 3EPEA 3TAJA 1XHYA 4IO7A 4FECA 2QL3A 2I49A 3MW0A 1PEBA 3ODBA 3O97A 2UVIA 3KSXA 4I62A 3G3KA 3PPRA 3SEWA 3U8QA 3RN8A 1N7WA 1Y3NA 3R7XA 4U4XA 4IO4A 3B6TA 4RY1A 3O9PA 2OLBA 1JW4A 2F36A 4XXUA 3PD8A 2I58A 4YKPA 1MY3A 3MQ9A 4C1TA 5ISUA 1NNPA 2V3UA 4X1DA 1AIVA 1LCFA 1M5BA 2Y84A 1QVSA 1RYOA 3H06B 3M8UA 4IO3A 1EZOA 1QW0A 4K3FA 1IIWA 4NF6B 2REJA 4NWDA 1YCJA 1ZMGA 4NWCA 4QSEA 1MM6A 4BDLA 2OK2A 1NFTA 2XX8A 2H9BA 2NWJA 1GVCA 1Y9UA 4FORA 4R9GA 4JSOA 1N0TA 1NNTA 3C31A 3LBSA 5A5XA 1ATGA 2VP1A 2M8CA 3N5LA 2ZYOA 2V84A 4NF5A 3HHGA 3FJ7A 4POWA 1AH5A 2DYXA 3H6WA 4NF4A 2QRYA 1DPEA 3FV2A 1MY1A 4Q8RA 1QKAA 5DEXB 4Q5TA 2I0CA 1B3LA 1JVXA 2H99A 1QKBA 4JBZA 1DPPA 4NEDA 4OEUA 4HW8A 5I2NB 3PMVA 4H5GA 4I8CA 1DSNA 3OENA 4LATA 4OVJA 4QFOA 1D9YA 4QRZA 4RXLA 3G3IA 4X1BA 2ZNUA 4KI0E 5HM4B 3O6GA 4F2QA 1NH8A 2ZNTA 1Y20A 3A09A 3KFMA 4OXVA 2HQ0A 5ICQA 3H7MA 1IUDA 1PB9A 3B6WA 2A5TB 1PB8A 4F39A 1FQBA 2O7IA 2QS4A 5CMMA 4NE4A 1IXGA 2IA4A 4QSDA 1N84A 3MVWA 4MLVA 2Y7PA 4X48A 3KOTA 4OWDA 3R6UA 3LR1A 4YKIA 1FQFA 3G7WA 1PC3A 1N3XA 2I4BA 3DP6A 4JWXA 3W9WA 5TP9A 1LFGA 3FVKA 4R73A 1OQGA 1SW5A 4BDOA 2H25A 2I6EA 3KSJA 4IO5A 1VE4A 4U2RA 4KR5A 1M5FA 1B46A 4E0WA 3D4CA 3HO7A 1L5TA 1SW4A 2V25A 1R6ZA 3IOWA 2QSXA 1USYH 2O68A 1B5IA 1LB9A 5JEIA 3MP8A 3SKPA 2F8DA 4PFWA 3T9XB 1BLFA 3U1OA 2XXPA 2H98A 3LSFB 1LLSA 3H6TA 3M3KA 2XXVA 4GF8A 4BDRA 4BDMA 4OYVA 1H3DA 4FE8A 1B9JA 5HBCA 3THIA 2F34A 2HXWA 5EHMA 3ZKLA 4JB7A 3RTFB 5I2NA 5TP9B 3CG1A 2XX9A 1AOVA 4GXAA 4EXLA 4GWOA 4R2BA 1MY4A 3PPOA 4YAHX 1KWHA 3UGWA 1A54A 1MH3A 2REGA 3IJXB 5BWJA 1Y3QA 4E0XA 5I57B 1SW2A 2X7QA 3L6GA 2F78A 3PPPA 3TQWA 1FQDA 1I6QA 2XHDA 3K6XA 2ZMBA 4F29A 3IB1A 4P0GA 4WEPA 1R1NA 3E4RA 1FQCA 3E13X 4GL0A 5KCJA 3K6UA 1B4ZA 4PP0A 1OLCA 5L9MA 4FEDA 1XVYA 5AA4A 2NOOA 1ZTYA 4AQ4A 2Z8DA 3H6VA 3OO7A 4G4PA 4GFRA 5L8DA 1Q1KA 3QSLA 1D9VA 1H43A 3VE1B 3VVFA 1SI1A 1N76A 3ILUB 3IORA 1LBCA 1MXUA 1SI0A 1Y3PA 2E0SA 3H4ZA 3OOAA 2UVGA 2NVUB 1B32A 5I56A 2A5TA 4KCCA 3CFXA 4OQOA 1A99A 4OFOA 4H67A 4H8JA 4QFLA 4N07A 4IY6A 2O7UA 1UIUA 3FZVA 3W15C 3EN3A 4DLDA 2HAUA 4IGRA 1UQWA 1XS5A 2QS1A 2XXTA 5DEXA 5AA4B 2B65A 3FD3A 3MWBA 2H4IA 4F1YA 1TFAA 1NKXA 4ELOA 4H65A 1URDA 4OMBA 1B5HA 1B3GA 1H45A 2GHAA 2UVJA 3MP6A 4ZEBA 4ECFA 1SYIA 2I0BA 4KYDA 4C0RA 4ELQA 3MC2A 1LSTA 2F97A 3QYTA 4G68B 5A5XB 3S9NC 3RNNA 5FHOA 1LAGE 1UTHB 4ESXA 1MQGA 3K01A 1JW1A 3EHSA 3SESA 2KLFA 1QJMA 1MXZA 5H8QA 3DP8A 5LOMA 4MF3A 2R9JA 3E9XA 3LC8A 5CMKA 1JVYA 1O63A 3EQ1A 3L6HA 4G8NA 4KFQA 2ESNA 4DCYA 1B1XA 4F31B 3HHFA 1B52A 3S9MC 4G8MA 2FA7A 3O66A 5M2VA 1LBBA 2Z8EA 1PBQA 3FXUA 5L9OA 4ZEFA 1OMPA 4QHQA 1B1HA 2O1LA 1B7ZA 3G3FA 1GV8A 4H6DA 2HFBA 4GXSB 2AIXA 1JNFA 1R9QA 1WODA 1QUIA 5I58A 1IQ7A 1P1UA 3LSWA 3TFLA 4FATA 4M4GA 5FHNA 1P1OA 3PU5A 3T9VA 2D3IA 5AA2B 2F35A 3TELA 1YTVA 1MQDA 3N6TA 4ONYA 3CRBA 2DOJA 1QULA 3IL1B 5H8NA 3VLVA 5I2KA 3FVNA 3IR1A 4EF2A 2ZNSA 4OESA 3HCQA 1Y4CA 4FAJA 1I6BA 2DWIA 3RY3A 1WDNA 1Y1ZA 1MXWA 4JDFA 4QFNA 5ITPA 1JEVA 3UA8A 1A8FA 3P7IA 3TCGA 3TCFA 1Q35A 2RCAA 2G93A 1HSEA 3CIJA 2Y7RA 4U1OA 3RLFE 2ONRA 5I58B 3TTNA 2RF1A 4Z7EA 2CMOA 4MLQA 4GLIA 3FJGA 1ANFA 1BTJA 1MPCA 2PX1A 1B51A 1MPDA 1R9LA 2BJJX 1GTKA 2F5XA 1XC1A 2Q9TA 1GGGA 5H8FA 1B40A 3G3JA 4TQUQ 2PYYA 2OWTA 4LQ2A 4ZZAA 2DSFA 2HZKA 2D5WA 3N94A 4KYSA 1PDAA 3Q28A 3WAFA 3VVDA 2QMWA 3ZS6A 2XD3A 1B58A 4I1DA 1LFHA 4EF1A 2Z23A 3MVXA 2VGQA 3ZKKA 4ISUA 1IXHA 4AB6A 4DDDA 1LAXA 1XOCA 3C4MA 1MXVA 1UIVA 3K2DA 3PGFA 2OZZA 1UTHA 3RT8A 4ND9A 3G3HA 3RUMA 3E3KA 5CMCA 3TCHA 1SBPA 1S50A 3B7DA 3KGCA 1YPNA 4ZEDA 3UK4A 3VLUA 3T9HB 3TKDA 2VD3A 3MP1A 4DXCA 1POTA 3LSLA 2ZYKA 4YB5A 3T93B 1OLAA 2A5SA 2QJEA 2Y7KA 2XXWA 1TFDA 4F3SA 3N6UA 1MH4A 1I6AA 2DVCA 4U22A 2E1SA 4LVQA 5H8HA 1F9BA 1ZJLA 3UN6A 2Q88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXY A;  4G77 A;  3MZ9 A;  3S2V A;  5I56 B;  5IAI A;  4PQJ A;  3O28 A;  3K00 A;  1LGB C;  1USY E;  4KD5 A;  1LAF E;  4BDQ A;  4O3B A;  3Q29 A;  2DWA A;  3DEL B;  4FIM A;  4F1U A;  3O29 A;  3M3F A;  3QUF A;  1B4H A;  3MBP A;  3PUZ E;  3U92 A;  5CRY A;  3TPA A;  3K1N A;  4MFI A;  5EYF A;  4EUO A;  1NNF A;  1Y4T A;  2RC9 A;  3GBA A;  2XD2 A;  3TDJ A;  2RCB A;  2PT1 A;  2B3F A;  1H44 A;  5DVJ A;  3S9E A;  1XT8 A;  3IX1 A;  5I84 A;  2Q2C A;  2P0S A;  1D4N A;  3BFT A;  3RGY A;  2DWJ A;  5EHS A;  2O1M A;  4OER A;  3IK6 B;  5H8H B;  4C1U A;  3C35 A;  1J1N A;  3FJM A;  3TMG A;  4F3B A;  4LA9 A;  1POY 1;  1B3F A;  3PV0 E;  4IY5 A;  1VFE A;  2GHB A;  2F6P A;  5H8N B;  4XKP A;  1A8E A;  3GBB A;  3HST A;  1S7Y A;  4U4S A;  1FCK A;  5FTI A;  1FW0 A;  1JQF A;  4RA1 A;  5F1Q A;  4GOT A;  4F3G A;  5AA3 A;  2F7C A;  4O3C A;  3ONM A;  4JXI A;  4R9F A;  3TTM A;  1DMB A;  3OD7 A;  3PPN A;  2HAV A;  1A55 A;  4RPO A;  2UVH A;  3Q27 A;  3GXA A;  3S4U A;  1TWY A;  2ALU A;  2O69 A;  4PFT A;  2I3W A;  4Q0C A;  4G68 A;  1DTG A;  1MPB A;  2YPN A;  3TTL A;  4YU0 A;  1URG A;  2DP8 A;  3OMB A;  3QAX A;  3EHU A;  1UTB B;  4RK9 A;  4X9T A;  2P1S A;  3VXB A;  4ELP A;  2O84 X;  1NL5 A;  1B0H A;  1ZBM A;  4LP2 B;  5DVI A;  3MPK A;  5CBS A;  2YLN A;  3T9U A;  4P11 A;  3IOT A;  4IO6 A;  3H6U A;  1MDP 1;  4U1Z A;  3C36 A;  4ZE9 A;  1FQA A;  2F7A A;  2IEE A;  1AL3 A;  4HCW A;  4MH5 A;  1EU8 A;  2XXQ A;  3T66 A;  3V8X B;  4NF8 A;  4WED A;  5J1D A;  3FGS A;  1PB7 A;  2OBG A;  2XX7 A;  3PUV E;  2XXU A;  3EF7 A;  4KHZ E;  1OIB A;  4LZ7 A;  1NMU A;  4O3A A;  4N6P A;  4NF8 B;  3RT6 B;  1US5 A;  2G29 A;  3QIM A;  4GQO A;  3CSG A;  2FYI A;  2Y7W A;  4RNS A;  4ESW A;  1D3K A;  3K1M A;  3CI8 A;  1N04 A;  2HEU A;  4R2F A;  3FV1 A;  5CI5 A;  4N13 A;  4OEV A;  2VOZ A;  1LB8 A;  2DS9 A;  5H8Q B;  3SEY A;  4DCX A;  3LUY A;  3DM0 A;  2Q2A A;  2I48 A;  4NF4 B;  4OTE A;  1ELJ A;  2HZL A;  2QMX A;  2XXR A;  4KQP A;  3TZA A;  3Q25 A;  4Z0I A;  5KCJ B;  1N7X A;  4TOZ A;  1JW5 A;  1DOT A;  2THI A;  2GRV A;  4YMB A;  4XKR A;  1B7U A;  2W7Y A;  1CE2 A;  1YAE A;  1MDQ A;  3K6V A;  3D4G A;  4YKJ A;  3OXN A;  3UP9 A;  3C9H A;  4ZS9 A;  5ICT A;  4IGT A;  4YKK A;  1LAH E;  2DXY A;  1RKM A;  2XXX A;  4HTG A;  1M5C A;  1FTJ A;  1Z7N E;  3RPW A;  3SEX A;  1SW1 A;  1BIY A;  2AYS A;  1MQH A;  2DE4 A;  4DZ1 A;  5KDT B;  3S9L C;  3PMX A;  4OFL A;  1SVX B;  3SER A;  4H8I A;  3B6Q A;  4LZ5 A;  3U94 A;  3UOR A;  2Z8F A;  3AXF A;  4WXJ A;  1I69 A;  1B2H A;  3USD A;  5KDT A;  2UXA A;  2DWH A;  3CSB A;  5I57 A;  4PET A;  1IXC A;  4HCY A;  4IO2 A;  4DXB A;  1A40 A;  3FIR A;  1IEJ A;  4JSD A;  3V89 B;  2RIN A;  4G68 C;  4L17 A;  3TOD A;  1NH7 A;  3ILT B;  2ONK E;  2DXR A;  3BBR A;  3HV1 A;  4OET A;  3TTR A;  3DLN A;  3JV9 A;  3SDF A;  3CR9 A;  4ZEC A;  1EZ9 A;  2XXH A;  3CFL A;  3PUX E;  3WAE A;  5TPA A;  4F18 A;  3QXM A;  1NNK A;  4XKQ A;  5AE4 A;  2DE2 A;  3MVY A;  2ZYN A;  1QUJ A;  2XXI A;  3FXR A;  2RKM A;  4EQB A;  4GVO A;  2H5Y A;  1FQE A;  1TXF A;  3PUW E;  1RYX A;  3KZG A;  4LZ8 A;  3Q26 A;  1LCT A;  3IO6 A;  4R6H A;  2PVU A;  4RYA A;  3K6W A;  3K0V A;  1FTL A;  3PPQ A;  1O7T A;  1P1Q A;  2OJT A;  1H76 A;  3K4U A;  1SQY A;  3U93 A;  5TPA B;  2B3B A;  3CVG A;  1EZP A;  5L9S A;  4NF6 A;  2Y7I A;  5K2Y A;  4YMA A;  4GL8 A;  4I9D A;  3EHT A;  4NF5 B;  3CG3 A;  3VXC A;  3N26 A;  3FUZ A;  1FTM A;  3DP4 A;  4F3P A;  5ELV A;  1SD3 A;  3MJN A;  5DT6 A;  3UIF A;  4FEB A;  2OCU A;  4FJP A;  4XTC Q;  3FXQ A;  3OO9 A;  2AL4 A;  3TQL A;  1UTB A;  1OVB A;  3I3V A;  5CM6 A;  1BP5 A;  2R71 A;  3OO8 A;  4F2O A;  2AL5 A;  1B6H A;  1WVJ A;  2DQV A;  2LAO A;  2VHA A;  1AMF A;  1MS7 A;  3CFZ A;  2UYF A;  5FHM A;  3ECR A;  4OHN A;  3PD9 A;  3IJO B;  3OO6 A;  3OSR A;  3C33 A;  4G8H A;  1II5 A;  4TLM B;  4BLA A;  1M5D A;  4P0I A;  5DVF A;  2R6G E;  2V93 A;  1TT1 A;  4LON B;  4R74 A;  1B3H A;  4EQ9 A;  4U23 A;  1ZKB A;  4TLL B;  4LUB A;  4EDP A;  3PUY E;  3TEP A;  4R6K A;  2WKY A;  1B3E A;  1JEU A;  1SDX A;  2NXO A;  3GLB A;  3MZ1 A;  3R26 A;  4GRK A;  1PBP A;  3VVE A;  1LFI A;  3C32 A;  1IXI A;  1ZU0 A;  1P99 A;  3OEL A;  1XVX A;  3F11 A;  4Q30 B;  1B0L A;  5DYH A;  3HPI A;  3H03 A;  4XKN A;  1DTZ A;  2PMS A;  2QPQ A;  3KJ7 A;  3MUQ A;  4PFU A;  4YB7 A;  2F7B A;  3LSX A;  1QUK A;  1EH3 A;  2ANJ A;  4PE5 B;  5K2X A;  3RTW B;  1VFD A;  3BFU A;  1OVT A;  4KPT A;  2NUV A;  3IAZ A;  4G2Z A;  4QFK A;  3KEI A;  4RJZ A;  2ABH A;  3IOU A;  3MZB A;  1P1W A;  3RQT A;  4GD5 A;  1HSL A;  2D21 A;  5F7V A;  5HPQ A;  5CBR A;  3O6H A;  1CB6 A;  4PFY A;  4M1V A;  1MG1 A;  5JK4 A;  2OWS A;  1OQH A;  2CZL A;  3BKI B;  4H0W A;  1FTK A;  5I59 B;  3V5A A;  4ZZE A;  4QF9 A;  4DE8 A;  1URS A;  1HSJ A;  2V3T A;  3KG2 A;  1US4 A;  3O6I A;  4QFP A;  2FNC A;  4DIG A;  2HCA A;  4JWY A;  1GR2 A;  3A3C A;  1P1N A;  4R6Y A;  5FTH A;  2O51 A;  3IOV A;  3KN8 A;  2RC8 A;  3TUS A;  1VSO A;  2O6A A;  1MQI A;  4KCD A;  5IKB A;  2Q8J A;  2DE3 A;  2VD2 A;  4HS7 A;  5JTY B;  3T96 B;  4OEN A;  4WKM A;  4BDN A;  4ELR A;  3SEV A;  3G3G A;  2QS2 A;  1O64 A;  1FTO A;  1A7L A;  3KJT A;  3TTK A;  2P2A A;  1MXX A;  1B05 A;  2ZXT A;  1IIT A;  3IB0 A;  4H1X A;  5I2K B;  1VR5 A;  2I3V A;  3JZJ A;  3O2A A;  3VV5 A;  3MVZ A;  3SEU A;  5CMB A;  3QUJ A;  2RC7 A;  2ONS A;  4XIG Q;  3VLW A;  5TU0 A;  2GH9 A;  4MBP A;  4ZEI A;  3TYH A;  2X7P A;  4AB5 A;  4F19 A;  4EXK A;  1ZLQ A;  1ZIU A;  4NTL A;  3K1P A;  3HN0 A;  5KZT A;  3IO4 A;  1B7H A;  1MQJ A;  2GFE A;  1MY2 A;  4H5F A;  3FVO A;  4IB2 A;  3GZG A;  3FAS A;  3H3G A;  2QS3 A;  4RK2 A;  3K02 A;  3OSQ A;  4U21 A;  4YB6 A;  3SET A;  3OEK A;  1BKA A;  3KN7 A;  4UA8 A;  4ZE8 A;  4GIZ A;  3T22 A;  3ZSF A;  4F22 A;  4JWO A;  5H8S A;  5BUU A;  4DXU A;  1S9T A;  1Z7M E;  3I6V A;  3KOS A;  2UYE A;  2ZYM A;  4LQ5 A;  4QSC A;  3W9V A;  4KYE A;  5AA2 D;  1M5E A;  2YJP A;  1SYH A;  3C34 A;  1MY0 A;  4OFJ A;  4POX A;  4THI A;  4UAC A;  5JTY A;  4R72 A;  4ZDM A;  2PBW A;  3MAM A;  3FAT A;  3I5O A;  4NMY A;  4ZEK A;  2V3Q A;  3MPL A;  3OEM A;  3PMW A;  1JET A;  2I4C A;  3VDF A;  1T0K A;  4YIC A;  1IZ1 A;  3VFJ A;  5CC2 A;  1MXY A;  1MM7 A;  4YZZ A;  5B70 A;  5AA1 A;  3V83 A;  1N3W A;  4EQ7 A;  2X26 A;  3KBR A;  5H8F B;  3IB2 A;  5I59 A;  1Y1M A;  2Z22 A;  5B7D A;  2PT2 A;  3FVG A;  3A3U A;  4R75 A;  4RPN A;  5ITO A;  4F1V A;  3M3L A;  4OZ9 A;  2Q89 A;  2F6G A;  3KN3 A;  3JYR A;  5AA2 A;  2DVZ A;  5DTB A;  3U72 A;  3QK6 A;  1B5J A;  1MRP A;  3EPE A;  3TAJ A;  1XHY A;  4IO7 A;  4FEC A;  2QL3 A;  2I49 A;  3MW0 A;  1PEB A;  3ODB A;  3O97 A;  2UVI A;  3KSX A;  4I62 A;  3G3K A;  3PPR A;  3SEW A;  3U8Q A;  3RN8 A;  1N7W A;  1Y3N A;  3R7X A;  4U4X A;  4IO4 A;  3B6T A;  4RY1 A;  3O9P A;  2OLB A;  1JW4 A;  2F36 A;  4XXU A;  3PD8 A;  2I58 A;  4YKP A;  1MY3 A;  3MQ9 A;  4C1T A;  5ISU A;  1NNP A;  2V3U A;  4X1D A;  1AIV A;  1LCF A;  1M5B A;  2Y84 A;  1QVS A;  1RYO A;  3H06 B;  3M8U A;  4IO3 A;  1EZO A;  1QW0 A;  4K3F A;  1IIW A;  4NF6 B;  2REJ A;  4NWD A;  1YCJ A;  1ZMG A;  4NWC A;  4QSE A;  1MM6 A;  4BDL A;  2OK2 A;  1NFT A;  2XX8 A;  2H9B A;  2NWJ A;  1GVC A;  1Y9U A;  4FOR A;  4R9G A;  4JSO A;  1N0T A;  1NNT A;  3C31 A;  3LBS A;  5A5X A;  1ATG A;  2VP1 A;  2M8C A;  3N5L A;  2ZYO A;  2V84 A;  4NF5 A;  3HHG A;  3FJ7 A;  4POW A;  1AH5 A;  2DYX A;  3H6W A;  4NF4 A;  2QRY A;  1DPE A;  3FV2 A;  1MY1 A;  4Q8R A;  1QKA A;  5DEX B;  4Q5T A;  2I0C A;  1B3L A;  1JVX A;  2H99 A;  1QKB A;  4JBZ A;  1DPP A;  4NED A;  4OEU A;  4HW8 A;  5I2N B;  3PMV A;  4H5G A;  4I8C A;  1DSN A;  3OEN A;  4LAT A;  4OVJ A;  4QFO A;  1D9Y A;  4QRZ A;  4RXL A;  3G3I A;  4X1B A;  2ZNU A;  4KI0 E;  5HM4 B;  3O6G A;  4F2Q A;  1NH8 A;  2ZNT A;  1Y20 A;  3A09 A;  3KFM A;  4OXV A;  2HQ0 A;  5ICQ A;  3H7M A;  1IUD A;  1PB9 A;  3B6W A;  2A5T B;  1PB8 A;  4F39 A;  1FQB A;  2O7I A;  2QS4 A;  5CMM A;  4NE4 A;  1IXG A;  2IA4 A;  4QSD A;  1N84 A;  3MVW A;  4MLV A;  2Y7P A;  4X48 A;  3KOT A;  4OWD A;  3R6U A;  3LR1 A;  4YKI A;  1FQF A;  3G7W A;  1PC3 A;  1N3X A;  2I4B A;  3DP6 A;  4JWX A;  3W9W A;  5TP9 A;  1LFG A;  3FVK A;  4R73 A;  1OQG A;  1SW5 A;  4BDO A;  2H25 A;  2I6E A;  3KSJ A;  4IO5 A;  1VE4 A;  4U2R A;  4KR5 A;  1M5F A;  1B46 A;  4E0W A;  3D4C A;  3HO7 A;  1L5T A;  1SW4 A;  2V25 A;  1R6Z A;  3IOW A;  2QSX A;  1USY H;  2O68 A;  1B5I A;  1LB9 A;  5JEI A;  3MP8 A;  3SKP A;  2F8D A;  4PFW A;  3T9X B;  1BLF A;  3U1O A;  2XXP A;  2H98 A;  3LSF B;  1LLS A;  3H6T A;  3M3K A;  2XXV A;  4GF8 A;  4BDR A;  4BDM A;  4OYV A;  1H3D A;  4FE8 A;  1B9J A;  5HBC A;  3THI A;  2F34 A;  2HXW A;  5EHM A;  3ZKL A;  4JB7 A;  3RTF B;  5I2N A;  5TP9 B;  3CG1 A;  2XX9 A;  1AOV A;  4GXA A;  4EXL A;  4GWO A;  4R2B A;  1MY4 A;  3PPO A;  4YAH X;  1KWH A;  3UGW A;  1A54 A;  1MH3 A;  2REG A;  3IJX B;  5BWJ A;  1Y3Q A;  4E0X A;  5I57 B;  1SW2 A;  2X7Q A;  3L6G A;  2F78 A;  3PPP A;  3TQW A;  1FQD A;  1I6Q A;  2XHD A;  3K6X A;  2ZMB A;  4F29 A;  3IB1 A;  4P0G A;  4WEP A;  1R1N A;  3E4R A;  1FQC A;  3E13 X;  4GL0 A;  5KCJ A;  3K6U A;  1B4Z A;  4PP0 A;  1OLC A;  5L9M A;  4FED A;  1XVY A;  5AA4 A;  2NOO A;  1ZTY A;  4AQ4 A;  2Z8D A;  3H6V A;  3OO7 A;  4G4P A;  4GFR A;  5L8D A;  1Q1K A;  3QSL A;  1D9V A;  1H43 A;  3VE1 B;  3VVF A;  1SI1 A;  1N76 A;  3ILU B;  3IOR A;  1LBC A;  1MXU A;  1SI0 A;  1Y3P A;  2E0S A;  3H4Z A;  3OOA A;  2UVG A;  2NVU B;  1B32 A;  5I56 A;  2A5T A;  4KCC A;  3CFX A;  4OQO A;  1A99 A;  4OFO A;  4H67 A;  4H8J A;  4QFL A;  4N07 A;  4IY6 A;  2O7U A;  1UIU A;  3FZV A;  3W15 C;  3EN3 A;  4DLD A;  2HAU A;  4IGR A;  1UQW A;  1XS5 A;  2QS1 A;  2XXT A;  5DEX A;  5AA4 B;  2B65 A;  3FD3 A;  3MWB A;  2H4I A;  4F1Y A;  1TFA A;  1NKX A;  4ELO A;  4H65 A;  1URD A;  4OMB A;  1B5H A;  1B3G A;  1H45 A;  2GHA A;  2UVJ A;  3MP6 A;  4ZEB A;  4ECF A;  1SYI A;  2I0B A;  4KYD A;  4C0R A;  4ELQ A;  3MC2 A;  1LST A;  2F97 A;  3QYT A;  4G68 B;  5A5X B;  3S9N C;  3RNN A;  5FHO A;  1LAG E;  1UTH B;  4ESX A;  1MQG A;  3K01 A;  1JW1 A;  3EHS A;  3SES A;  2KLF A;  1QJM A;  1MXZ A;  5H8Q A;  3DP8 A;  5LOM A;  4MF3 A;  2R9J A;  3E9X A;  3LC8 A;  5CMK A;  1JVY A;  1O63 A;  3EQ1 A;  3L6H A;  4G8N A;  4KFQ A;  2ESN A;  4DCY A;  1B1X A;  4F31 B;  3HHF A;  1B52 A;  3S9M C;  4G8M A;  2FA7 A;  3O66 A;  5M2V A;  1LBB A;  2Z8E A;  1PBQ A;  3FXU A;  5L9O A;  4ZEF A;  1OMP A;  4QHQ A;  1B1H A;  2O1L A;  1B7Z A;  3G3F A;  1GV8 A;  4H6D A;  2HFB A;  4GXS B;  2AIX A;  1JNF A;  1R9Q A;  1WOD A;  1QUI A;  5I58 A;  1IQ7 A;  1P1U A;  3LSW A;  3TFL A;  4FAT A;  4M4G A;  5FHN A;  1P1O A;  3PU5 A;  3T9V A;  2D3I A;  5AA2 B;  2F35 A;  3TEL A;  1YTV A;  1MQD A;  3N6T A;  4ONY A;  3CRB A;  2DOJ A;  1QUL A;  3IL1 B;  5H8N A;  3VLV A;  5I2K A;  3FVN A;  3IR1 A;  4EF2 A;  2ZNS A;  4OES A;  3HCQ A;  1Y4C A;  4FAJ A;  1I6B A;  2DWI A;  3RY3 A;  1WDN A;  1Y1Z A;  1MXW A;  4JDF A;  4QFN A;  5ITP A;  1JEV A;  3UA8 A;  1A8F A;  3P7I A;  3TCG A;  3TCF A;  1Q35 A;  2RCA A;  2G93 A;  1HSE A;  3CIJ A;  2Y7R A;  4U1O A;  3RLF E;  2ONR A;  5I58 B;  3TTN A;  2RF1 A;  4Z7E A;  2CMO A;  4MLQ A;  4GLI A;  3FJG A;  1ANF A;  1BTJ A;  1MPC A;  2PX1 A;  1B51 A;  1MPD A;  1R9L A;  2BJJ X;  1GTK A;  2F5X A;  1XC1 A;  2Q9T A;  1GGG A;  5H8F A;  1B40 A;  3G3J A;  4TQU Q;  2PYY A;  2OWT A;  4LQ2 A;  4ZZA A;  2DSF A;  2HZK A;  2D5W A;  3N94 A;  4KYS A;  1PDA A;  3Q28 A;  3WAF A;  3VVD A;  2QMW A;  3ZS6 A;  2XD3 A;  1B58 A;  4I1D A;  1LFH A;  4EF1 A;  2Z23 A;  3MVX A;  2VGQ A;  3ZKK A;  4ISU A;  1IXH A;  4AB6 A;  4DDD A;  1LAX A;  1XOC A;  3C4M A;  1MXV A;  1UIV A;  3K2D A;  3PGF A;  2OZZ A;  1UTH A;  3RT8 A;  4ND9 A;  3G3H A;  3RUM A;  3E3K A;  5CMC A;  3TCH A;  1SBP A;  1S50 A;  3B7D A;  3KGC A;  1YPN A;  4ZED A;  3UK4 A;  3VLU A;  3T9H B;  3TKD A;  2VD3 A;  3MP1 A;  4DXC A;  1POT A;  3LSL A;  2ZYK A;  4YB5 A;  3T93 B;  1OLA A;  2A5S A;  2QJE A;  2Y7K A;  2XXW A;  1TFD A;  4F3S A;  3N6U A;  1MH4 A;  1I6A A;  2DVC A;  4U22 A;  2E1S A;  4LVQ A;  5H8H A;  1F9B A;  1ZJL A;  3UN6 A;  2Q88 A; 
#chains in the Genus database with same CATH topology
 2WX9 A;  4PQJ A;  1LAF E;  4PF6 A;  3O29 A;  3M3F A;  5IZ3 B;  3U92 A;  3K1N A;  1VDW A;  1Y4T A;  3S9E A;  1H44 A;  5DVJ A;  1XT8 A;  2DWJ A;  3IK6 B;  4LA9 A;  2GHB A;  2F6P A;  4MCO A;  5FTI A;  1JQF A;  4RA1 A;  4GWS A;  5ESY A;  4JXI A;  3TTM A;  3OD7 A;  2UVH A;  2OX3 A;  4Q0C A;  4G68 A;  3TTL A;  1URG A;  3QAX A;  5DVI A;  1B0H A;  2CZI A;  3MPK A;  3FBP A;  4ZE9 A;  1FQA A;  2F7A A;  5I7I A;  4WED A;  1PB7 A;  2OBG A;  3A29 A;  4LZ7 A;  4O3A A;  2G29 A;  4GQO A;  4RNS A;  2FYI A;  3CI8 A;  3FV1 A;  5CI5 A;  4GX3 A;  1FBH A;  2VOZ A;  3DM0 A;  3TZA A;  4F1U A;  2HZL A;  4Z0I A;  1N7X A;  3U65 A;  1DOT A;  4YMB A;  1YAE A;  3OXN A;  4IGT A;  4YKK A;  1LAH E;  3RPW A;  3SEX A;  4DZ1 A;  4PCD A;  2Z8F A;  3AXF A;  1I69 A;  5KDT A;  2CZK A;  4JSD A;  2QFL A;  3PTY A;  3BBR A;  3JV9 A;  3PUX E;  2XXH A;  3WAE A;  1NNK A;  2XWI A;  2ZYN A;  3LUZ A;  4EQB A;  4GVO A;  5EQ7 A;  4PFR A;  4R6H A;  3K0V A;  4PAI A;  3K4U A;  2OWZ A;  1FTA A;  3N26 A;  5ELV A;  1SD3 A;  4XTC Q;  3TQL A;  2AL4 A;  5CM6 A;  2VHA A;  2UYF A;  3ECR A;  4OHN A;  3PD9 A;  3C33 A;  4TLM B;  1II5 A;  4EQ9 A;  4U23 A;  3TEP A;  3PUY E;  1B3E A;  3MZ1 A;  4Q30 B;  1B0L A;  3H03 A;  1DTZ A;  2PMS A;  2QPQ A;  4PFU A;  3MUQ A;  2ANJ A;  2PFZ A;  4GX4 A;  1P1W A;  3RQT A;  1HSL A;  2D21 A;  5F7V A;  4GX6 A;  4M1V A;  1MG1 A;  5JK4 A;  1FTK A;  3V5A A;  4QF9 A;  1LBW A;  2V3T A;  1US4 A;  4DIG A;  2FNC A;  2HCA A;  3IOV A;  4P8B A;  2Q8J A;  2VD2 A;  4ELR A;  3KJT A;  1FTO A;  3IB0 A;  1MXX A;  2I3V A;  3SEU A;  3QUJ A;  4XIG Q;  5TU0 A;  4OVT A;  4AB5 A;  5KZT A;  3SET A;  4OVS A;  3KN7 A;  4UA8 A;  4JWO A;  4XFE A;  2ZZV A;  4DXU A;  3KOS A;  4N8Y A;  3W9V A;  5AA2 D;  1M5E A;  1SYH A;  3C34 A;  4MIJ A;  4GWW A;  5JTY A;  2WBB A;  4ZDM A;  2PBW A;  3FAT A;  2Q74 A;  2I4C A;  2QVR A;  1IZ1 A;  1MM7 A;  4YZZ A;  3IB2 A;  3FVG A;  3A3U A;  4RPN A;  5ITO A;  4OZ9 A;  2Q89 A;  5DTB A;  5ET8 A;  1B5J A;  4IO7 A;  2QL3 A;  4I62 A;  3KSX A;  1EYK A;  4O7M A;  2F36 A;  2I58 A;  4YKP A;  3MQ9 A;  1NNP A;  2V3U A;  1FPF A;  1M5B A;  2Y84 A;  4IR8 A;  1FPJ A;  4IO3 A;  1QW0 A;  4NF6 B;  2REJ A;  4P1L A;  1MM6 A;  1NFT A;  1IMF A;  2H9B A;  1GVC A;  5A5X A;  1NNT A;  3LBS A;  2VP1 A;  3N5L A;  1AH5 A;  3H6W A;  5DEX B;  1B3L A;  4NED A;  3PMV A;  3OEN A;  4DE8 A;  4RXL A;  3O6G A;  2ZNT A;  4OXV A;  1PB9 A;  3B6W A;  2A5T B;  4F39 A;  1FQB A;  2O7I A;  5CMM A;  2IA4 A;  1FQF A;  3G7W A;  2VT5 A;  1BK4 A;  1NV3 A;  2XA5 A;  2V25 A;  3IOW A;  1NV2 A;  2F8D A;  4PFW A;  3H6T A;  2XXV A;  4BDM A;  2HXW A;  1YXI A;  4JB7 A;  5I2N A;  2XX9 A;  2ZZX A;  4R2B A;  4YAH X;  4AS4 A;  1NV4 A;  1SW2 A;  2X7Q A;  3L6G A;  3PPP A;  3K6X A;  1FBE A;  4N8G A;  3E4R A;  3E13 X;  1B4Z A;  3OO7 A;  5L8D A;  4PF8 A;  1CNQ A;  1Y3P A;  4KCC A;  4OQO A;  1A99 A;  4DI4 B;  1UIU A;  2HAU A;  4IGR A;  5DEX A;  5AA4 B;  2B65 A;  2H4I A;  1URD A;  2UVJ A;  2I0B A;  1LST A;  5A5X B;  3K01 A;  2KLF A;  3MST A;  5LOM A;  5J16 A;  1O63 A;  3EQ1 A;  3L6H A;  4GWU A;  4F31 B;  3HHF A;  2Y5K A;  2DDK A;  3O66 A;  2Z8E A;  4QHQ A;  1B7Z A;  4MEV A;  1JNF A;  5I58 A;  1QUI A;  4FAT A;  3LSW A;  3PU5 A;  1G0H A;  1MQD A;  4HE2 A;  4MNC A;  1QUL A;  4PGN A;  4AS5 A;  5H8N A;  3VLV A;  3IR1 A;  4NG7 A;  1Y4C A;  2DWI A;  3RY3 A;  1WDN A;  1Y1Z A;  1DCU A;  5IZ3 A;  5ITP A;  5I3S A;  3P7I A;  4MMP A;  1Q35 A;  3CIJ A;  1HSE A;  4PAK A;  3RLF E;  2ONR A;  5I58 B;  4QXD A;  2CMO A;  4XXU A;  2Q9T A;  1R9L A;  1B40 A;  3G3J A;  4TQU Q;  2PYY A;  2DSF A;  3Q28 A;  3VVD A;  1B58 A;  4I1D A;  4I40 A;  4ISU A;  2VPN A;  3C4M A;  3K2D A;  1MXV A;  3RT8 A;  3B7D A;  4NQ8 A;  3UK4 A;  2VD3 A;  2ZYK A;  2A5S A;  4OA4 A;  4F3S A;  3N6U A;  5H8H A;  1T0K A;  3Q29 A;  1FQE A;  3UN6 A;  2XXY A;  4G77 A;  3MZ9 A;  5IAI A;  3K00 A;  1USY E;  2DWA A;  4MJO A;  4FIM A;  3PUZ E;  1D9Q A;  4MFI A;  1NUZ A;  5EYF A;  4EUO A;  4X8R A;  2RC9 A;  2RCB A;  4PAF A;  5H8H B;  3FJM A;  3TMG A;  4F3B A;  1B3F A;  3PV0 E;  4IY5 A;  1VFE A;  4XF5 A;  5H8N B;  5EQA A;  1S7Y A;  1FCK A;  4R9F A;  3PPN A;  3Q27 A;  3S4U A;  2ALU A;  2F3B A;  4PFT A;  1DTG A;  1MPB A;  2YPN A;  4YU0 A;  3EHU A;  1UTB B;  1ZBM A;  4P9K A;  5CBS A;  3T9U A;  1MDP 1;  4MH5 A;  4JVD A;  1EU8 A;  3T66 A;  2P3V A;  2CEY A;  2XX7 A;  1NV6 A;  3PUV E;  1OIB A;  4NF8 B;  1NUY A;  2Y7W A;  2HEU A;  2DS9 A;  4NF4 B;  1ELJ A;  2XXR A;  4KQP A;  5KCJ B;  2GRV A;  4XKR A;  1MDQ A;  3K6V A;  4YKJ A;  4ZS9 A;  4HTG A;  3IFC A;  1RKM A;  1FTJ A;  1Z7N E;  2AYS A;  1BIY A;  3PMX A;  4OFL A;  3SER A;  4WXJ A;  3USD A;  1B2H A;  2BJI A;  2UXA A;  3CSB A;  2ZZW A;  1A40 A;  3FIR A;  2FVZ A;  2RIN A;  3TTR A;  3SDF A;  1EZ9 A;  4F18 A;  3QXM A;  4XKQ A;  3MVY A;  2XXI A;  4PC9 A;  3PUW E;  1RYX A;  1LCT A;  4RYA A;  1FTL A;  3CVG A;  1EZP A;  2WBD A;  4YMA A;  3RYD A;  4F3P A;  3MJN A;  2OCU A;  3OO9 A;  1UTB A;  3I3V A;  3OO8 A;  1B6H A;  2AL5 A;  4OMB A;  2LAO A;  1AMF A;  3IJO B;  4BLA A;  1M5D A;  5DVF A;  1FSA A;  4R74 A;  4MAG A;  4LUB A;  4PFB A;  2HHM A;  3GYY A;  1IXI A;  3OEL A;  3HPI A;  4N6K A;  4XKN A;  2QVU A;  3LSX A;  3RTW B;  4PE5 B;  5K2X A;  1OVT A;  4QFK A;  3IAZ A;  4G2Z A;  3KEI A;  3MZB A;  1CB6 A;  4PFY A;  1OQH A;  2CZL A;  4H0W A;  5I59 B;  4ZZE A;  1HSJ A;  3KG2 A;  4QFP A;  4R6Y A;  5FTH A;  5EQ9 A;  3TUS A;  4KCD A;  1IMD A;  3T96 B;  4BDN A;  1A7L A;  3TTK A;  2P2A A;  1B05 A;  2ZXT A;  3O2A A;  3MVZ A;  5CMB A;  2RC7 A;  2ONS A;  1FPK A;  4MBP A;  4F19 A;  4EXK A;  1ZLQ A;  4NTL A;  1MQJ A;  2GFE A;  4H5F A;  3FAS A;  2QS3 A;  1BKA A;  3ZSF A;  4F22 A;  4GIZ A;  1S9T A;  1Z7M E;  3I6V A;  2UYE A;  2ZYM A;  4LQ5 A;  1DK4 A;  1LBX A;  2YJP A;  4OFJ A;  4R72 A;  4ZEK A;  3MPL A;  3VDF A;  1FBP A;  5B70 A;  2X26 A;  4GBV A;  4R75 A;  4F1V A;  3M3L A;  2F6G A;  2DVZ A;  4PFI A;  3U72 A;  3EPE A;  4FEC A;  2I49 A;  1PEB A;  3ODB A;  2UVI A;  3G3K A;  3RN8 A;  1N7W A;  1LBZ A;  4IO4 A;  2OLB A;  1JW4 A;  1MY3 A;  4X1D A;  1AIV A;  1LCF A;  4K3F A;  2OK2 A;  1Y9U A;  4FOR A;  2ZYO A;  2QRY A;  1DPE A;  1QKA A;  4Q5T A;  4OEU A;  1DPP A;  5I2N B;  4H5G A;  4QFO A;  4LAT A;  4X1B A;  2ZNU A;  5HM4 B;  1NH8 A;  3A09 A;  5ICQ A;  1PB8 A;  2QS4 A;  1N84 A;  4OWD A;  3R6U A;  4OVQ A;  4JWX A;  3KSJ A;  4U2R A;  1VE4 A;  4KR5 A;  1SW4 A;  1USY H;  1B5I A;  4OVR A;  3SKP A;  3T9X B;  3M3K A;  1LLS A;  3CG1 A;  4GXA A;  4EXL A;  1MY4 A;  3PPO A;  1KWH A;  3UGW A;  1A54 A;  5BWJ A;  3RPL A;  3TQW A;  4GWZ A;  2ZMB A;  4WEP A;  1R1N A;  3D1R A;  3K6U A;  1OLC A;  3E79 A;  4G4P A;  4PGP A;  3QSL A;  4I3E A;  1H43 A;  1SI1 A;  3ILU B;  3IOR A;  1LBC A;  3H4Z A;  3OOA A;  2A5T A;  1AWB A;  1FPI A;  3EN3 A;  4F1Y A;  3MWB A;  1TFA A;  4ELO A;  1B3G A;  5FHO A;  5EQ8 A;  1NV5 A;  3SES A;  3DP8 A;  3E9X A;  3S9M C;  2PCR A;  4JVI A;  5M2V A;  1OMP A;  1B1H A;  2O1L A;  4H6D A;  1IQ7 A;  1YYZ A;  2R8T A;  4M4G A;  5FHN A;  1P1O A;  4GBW A;  2D3I A;  2F3D A;  5AA2 B;  3CHG A;  3N6T A;  3IL1 B;  3FVN A;  4JVC A;  4PBQ A;  4QFN A;  4MX6 A;  4NHB A;  2RCA A;  2G93 A;  4MLQ A;  1ANF A;  1BTJ A;  2BJJ X;  1GTK A;  1XC1 A;  5H8F A;  1GGG A;  2OWT A;  4ZZA A;  1PDA A;  4HXV A;  2Y5L A;  2VGQ A;  1IXH A;  1LAX A;  1UTH A;  3KBZ A;  3E3K A;  2CZH A;  3T9H B;  4DXC A;  3LSL A;  4YB5 A;  2Y7K A;  2XXW A;  1MH4 A;  4U22 A;  2E1S A;  1F9B A;  5I56 B;  3O28 A;  3DEL B;  4KXP A;  3QUF A;  4NAP A;  1NNF A;  3GBA A;  3TDJ A;  2PT1 A;  2L5V A;  3KC0 A;  3IX1 A;  2Q2C A;  2P0S A;  5EHS A;  4OER A;  1J1N A;  1FPG A;  4XKP A;  1A8E A;  3GBB A;  4U4S A;  1FW0 A;  4O3C A;  5IZZ A;  1DMB A;  2HAV A;  3GXA A;  1TWY A;  4RK9 A;  4X9T A;  2O84 X;  4LP2 B;  4P11 A;  2IEE A;  2CEX A;  1FPD A;  2XXQ A;  2WYP A;  5J1D A;  3FGS A;  4KHZ E;  1NMU A;  4N6P A;  1US5 A;  1KA1 A;  3ROJ A;  4ESW A;  1D3K A;  3K1M A;  1N04 A;  4R2F A;  4N13 A;  4OEV A;  4DCX A;  3SEY A;  2QMX A;  1K9Y A;  3KC1 A;  4TOZ A;  1JW5 A;  1CE2 A;  4PTK A;  2DXY A;  2DE4 A;  5KDT B;  3U94 A;  4H8I A;  3B6Q A;  3UOR A;  4GWY A;  2XWK A;  4PET A;  5ET5 A;  1IXC A;  2JJK A;  1LBY A;  4QBA A;  1IEJ A;  3V89 B;  4L17 A;  1NH7 A;  3CR9 A;  4ZEC A;  4O7I A;  5TPA A;  2RKM A;  2H5Y A;  3Q26 A;  1EYJ A;  3IO6 A;  3K6W A;  3PPQ A;  3U93 A;  5FBP A;  5TPA B;  2B3B A;  3EHT A;  3CG3 A;  3VXC A;  1FTM A;  3UIF A;  5DT6 A;  4FEB A;  1FRP A;  1BP5 A;  2R71 A;  4F2O A;  2DQV A;  3OO6 A;  1FBD A;  3OSR A;  4G8H A;  4P0I A;  2V93 A;  4R6K A;  1SDX A;  2NXO A;  3GLB A;  3R26 A;  4GRK A;  1RDX A;  3C32 A;  5DYH A;  3F11 A;  1EH3 A;  1VFD A;  3BFU A;  4KPT A;  2ABH A;  2V4C A;  5HPQ A;  1RDY A;  2OWS A;  1GR2 A;  3A3C A;  1FBF A;  4XEQ A;  3KN8 A;  2DE3 A;  4HS7 A;  4WKM A;  3SEV A;  3G3G A;  4H1X A;  1VR5 A;  3JZJ A;  3VLW A;  1FBG A;  2GH9 A;  3TYH A;  1ZIU A;  3HN0 A;  3FVO A;  3GZG A;  4YB6 A;  3OSQ A;  2XWO A;  3OEK A;  3T22 A;  4MNI A;  5BUU A;  5H8S A;  4QSC A;  4KYE A;  4I3Y A;  1MY0 A;  4POX A;  4UAC A;  5LDZ A;  1IMA A;  3I5O A;  4NMY A;  2V3Q A;  3OEM A;  3PMW A;  1JET A;  4YIC A;  3VFJ A;  5CC2 A;  3V83 A;  4EQ7 A;  3KBR A;  5I59 A;  4O94 A;  2Z22 A;  4P56 A;  2PT2 A;  3SZP A;  1Q9D A;  3KN3 A;  1MRP A;  3TAJ A;  1XHY A;  4ESX A;  3U8Q A;  1Y3N A;  4RY1 A;  3O9P A;  4NGU A;  4C1T A;  4N6D A;  5ISU A;  3H06 B;  4BDL A;  1YCJ A;  4R9G A;  4JSO A;  1N0T A;  3C31 A;  1NV7 A;  1ATG A;  2WYK A;  2M8C A;  3BIH A;  3FJ7 A;  2H99 A;  1JVX A;  4JBZ A;  1QKB A;  4QRZ A;  4I8C A;  1D9Y A;  4PDD A;  4F2Q A;  1LEV A;  3KFM A;  2HQ0 A;  3H7M A;  5EYG A;  4NE4 A;  1IXG A;  4P47 A;  4QSD A;  4MLV A;  3MVW A;  4X48 A;  1FPB A;  4HE0 A;  5TP9 A;  1LFG A;  1SW5 A;  2H25 A;  4IO5 A;  5DW8 A;  4P1E A;  1M5F A;  4H45 A;  4E0W A;  3U1O A;  2H98 A;  3LSF B;  1NUW A;  1K9Z A;  4BDR A;  4OYV A;  2MKZ A;  1H3D A;  4FE8 A;  5HBC A;  5IM2 A;  3ZKL A;  4N81 A;  3RTF B;  1AOV A;  3IFA A;  4GWO A;  1MH3 A;  4X04 A;  1Y3Q A;  4E0X A;  2F78 A;  4F29 A;  5KCJ A;  4FED A;  1XVY A;  5T3J A;  2Z8D A;  2XXK A;  4GFR A;  1Q1K A;  3VE1 B;  3VVF A;  2E0S A;  4N15 A;  1XI6 A;  2UVG A;  4H8J A;  4N07 A;  4IY6 A;  3FZV A;  4DLD A;  2FHY A;  1UQW A;  1XS5 A;  2XXT A;  3FD3 A;  5ET6 A;  1B5H A;  2GHA A;  4ZEB A;  4ELQ A;  4KYD A;  3MC2 A;  4G68 B;  3S9N C;  3RNN A;  1LAG E;  1UTH B;  1MQG A;  1QJM A;  5H8Q A;  4MF3 A;  2R9J A;  5CMK A;  3LC8 A;  1JVY A;  4G8N A;  4KFQ A;  3B8B A;  1B1X A;  4G8M A;  2FA7 A;  5L9O A;  1GV8 A;  2VPO A;  4GXS B;  4H46 A;  1R9Q A;  4PBH A;  1P1U A;  1RDZ A;  3T9V A;  1NV0 A;  2F35 A;  3TEL A;  4ONY A;  3CRB A;  5I2K A;  4OES A;  1I6B A;  1JEV A;  3UA8 A;  1A8F A;  1INP A;  2KR0 A;  3EKI A;  1FJ6 A;  2Y7R A;  2RF1 A;  4N4U A;  1MPC A;  2PX1 A;  1MPD A;  3WAF A;  2QMW A;  2XD3 A;  4EF1 A;  2Z23 A;  3MVX A;  2OZZ A;  4NX1 A;  4ND9 A;  5I5P A;  3G3H A;  3RUM A;  1KA0 A;  4ZED A;  3VLU A;  3TKD A;  1POT A;  3T93 B;  2QJE A;  2HXR A;  1I6A A;  1EYI A;  3S2V A;  1LGB C;  4KD5 A;  4BDQ A;  4O3B A;  3QMF A;  1B4H A;  3MBP A;  5CRY A;  3TPA A;  2XD2 A;  3T0J A;  2B3F A;  5I84 A;  1D4N A;  3BFT A;  3RGY A;  1JP4 A;  2O1M A;  4C1U A;  3C35 A;  3FXB A;  1NV1 A;  1DBZ A;  1POY 1;  4HE1 A;  4N91 A;  3HST A;  3BIG A;  5F1Q A;  4GOT A;  4F3G A;  5AA3 A;  2F7C A;  3ONM A;  4RPO A;  1NI9 A;  1A55 A;  2O69 A;  2I3W A;  3B50 A;  2DP8 A;  3OMB A;  3VXB A;  4ELP A;  2P1S A;  3RPL B;  1NL5 A;  2YLN A;  3IOT A;  4IO6 A;  5F24 A;  3H6U A;  4U1Z A;  3C36 A;  4HCW A;  1AL3 A;  3V8X B;  4NF8 A;  2XXU A;  3EF7 A;  3RT6 B;  3QIM A;  3CSG A;  4G61 A;  4PDH A;  5ET7 A;  1LB8 A;  5H8Q B;  2QVV A;  3LUY A;  2Q2A A;  2I48 A;  4OTE A;  4DXB A;  3Q25 A;  2THI A;  1B7U A;  2W7Y A;  3D4G A;  3UP9 A;  3C9H A;  5ICT A;  2XXX A;  3TOD A;  1M5C A;  1SW1 A;  1MQH A;  3S9L C;  1G0I A;  1SVX B;  4LZ5 A;  2FBP A;  2DWH A;  5I57 A;  5A5L A;  4HCY A;  4IO2 A;  4G68 C;  3ILT B;  2ONK E;  2DXR A;  3HV1 A;  4OET A;  3DLN A;  3CFL A;  5AE4 A;  2DE2 A;  1QUJ A;  3FXR A;  4LZ8 A;  1TXF A;  3KZG A;  2PVU A;  1O7T A;  1P1Q A;  2OJT A;  1H76 A;  1SQY A;  2Q8M A;  5L9S A;  4NF6 A;  2Y7I A;  5K2Y A;  4GL8 A;  4I9D A;  4LN5 A;  4NF5 B;  3FUZ A;  3DP4 A;  4FJP A;  3FXQ A;  4UAB A;  1OVB A;  4DI3 D;  4LVQ A;  1WVJ A;  3CFZ A;  1MS7 A;  5FHM A;  2B4L A;  2R6G E;  2XWV A;  1TT1 A;  4LON B;  1B3H A;  1ZKB A;  4TLL B;  4EDP A;  4NN3 A;  2WKY A;  1JEU A;  3VVE A;  1PBP A;  1LFI A;  1ZU0 A;  1P99 A;  1XVX A;  3KJ7 A;  4YB7 A;  2F7B A;  1QUK A;  2NUV A;  4RJZ A;  3IOU A;  4GD5 A;  5CBR A;  3O6H A;  3MYU A;  3BKI B;  1URS A;  3O6I A;  4JWY A;  1P1N A;  2O51 A;  2FIE A;  2RC8 A;  1VSO A;  2O6A A;  1MQI A;  5IKB A;  5JTY B;  4OEN A;  2QS2 A;  1O64 A;  1IIT A;  5I2K B;  3VV5 A;  4ZEI A;  4OVP A;  2X7P A;  3K1P A;  3IO4 A;  1B7H A;  1MY2 A;  4IB2 A;  3H3G A;  4RK2 A;  3K02 A;  4U21 A;  4FBP A;  4ZE8 A;  5LTC A;  4THI A;  3MAM A;  4NF0 A;  1NUX A;  1MXY A;  5AA1 A;  1N3W A;  2WEF A;  5H8F B;  2B4M A;  1Y1M A;  5B7D A;  3JYR A;  5AA2 A;  4P3L A;  3QK6 A;  3MW0 A;  3O97 A;  3SEW A;  3PPR A;  3R7X A;  4U4X A;  3B6T A;  3PD8 A;  1FPL A;  1QVS A;  1RYO A;  3M8U A;  1EZO A;  4MHF A;  1IIW A;  4NWC A;  4NWD A;  4O8M A;  4QSE A;  1ZMG A;  2XX8 A;  2NWJ A;  2V84 A;  4NF5 A;  3HHG A;  4POW A;  4Q8R A;  2DYX A;  4NF4 A;  3FV2 A;  1MY1 A;  2I0C A;  3HFU A;  5IGA A;  1DSN A;  4OVJ A;  4HW8 A;  3G3I A;  4KI0 E;  1Y20 A;  1IUD A;  2Y7P A;  3KOT A;  3LR1 A;  4YKI A;  1IMB A;  1PC3 A;  1N3X A;  2I4B A;  3DP6 A;  3W9W A;  3FVK A;  4R73 A;  1OQG A;  4BDO A;  1FJ9 A;  2I6E A;  1B46 A;  3D4C A;  3HO7 A;  1FBC A;  2GQ1 A;  1L5T A;  1R6Z A;  2QSX A;  2O68 A;  5EYH A;  1LB9 A;  5JEI A;  3MP8 A;  1BLF A;  2XXP A;  4GF8 A;  4MNP A;  3THI A;  1B9J A;  2F34 A;  5EHM A;  5TP9 B;  2REG A;  3IJX B;  5I57 B;  1FQD A;  1I6Q A;  2XHD A;  3IB1 A;  4P0G A;  1FQC A;  4GL0 A;  4PP0 A;  5L9M A;  5AA4 A;  2NOO A;  1ZTY A;  4AQ4 A;  3H6V A;  3LV0 A;  4GWX A;  1D9V A;  1QGX A;  1N76 A;  1MXU A;  1SI0 A;  2NVU B;  5I56 A;  1B32 A;  1IME A;  3CFX A;  4OFO A;  4H67 A;  2O7U A;  3W15 C;  1IMC A;  2QS1 A;  4PE3 A;  1NKX A;  4H65 A;  1H45 A;  4ECF A;  3MP6 A;  1SYI A;  4C0R A;  2F97 A;  3QYT A;  2KQZ A;  1JW1 A;  3EHS A;  1MXZ A;  2ESN A;  4DCY A;  1B52 A;  1LBB A;  1PBQ A;  3FXU A;  4ZEF A;  3T1B A;  1YZ0 A;  3G3F A;  2HFB A;  2AIX A;  1WOD A;  2P3N A;  3E78 A;  3TFL A;  2FIX A;  5IZ1 A;  4N17 A;  1YTV A;  2HPG A;  1SPI A;  2DOJ A;  4EF2 A;  2ZNS A;  3HCQ A;  4FAJ A;  3NOH A;  1MXW A;  4JDF A;  3ISP A;  3TCG A;  3TCF A;  1KZ8 A;  4U1O A;  3TTN A;  4Z7E A;  4GLI A;  3FJG A;  2PFY A;  4QFL A;  1B51 A;  2F5X A;  4LQ2 A;  2HZK A;  2D5W A;  3N94 A;  4KYS A;  3ZS6 A;  1FPE A;  1LFH A;  3ZKK A;  4AB6 A;  4DDD A;  1XOC A;  3PGF A;  1UIV A;  5CMC A;  3TCH A;  1SBP A;  1LBV A;  1S50 A;  3KGC A;  1YPN A;  3MP1 A;  4OAN A;  1OLA A;  1TFD A;  2DVC A;  1ZJL A;  2Q88 A; 
#chains in the Genus database with same CATH homology
 2XXY A;  4G77 A;  3MZ9 A;  3S2V A;  5I56 B;  5IAI A;  4PQJ A;  3O28 A;  3K00 A;  1LGB C;  1USY E;  4KD5 A;  1LAF E;  4BDQ A;  4O3B A;  3Q29 A;  2DWA A;  3DEL B;  4FIM A;  4F1U A;  3O29 A;  3M3F A;  3QUF A;  1B4H A;  3MBP A;  3PUZ E;  3U92 A;  5CRY A;  3TPA A;  3K1N A;  4MFI A;  5EYF A;  4EUO A;  1NNF A;  1Y4T A;  2RC9 A;  3GBA A;  2XD2 A;  3TDJ A;  2RCB A;  2PT1 A;  2B3F A;  1H44 A;  5DVJ A;  3S9E A;  1XT8 A;  3IX1 A;  5I84 A;  2Q2C A;  2P0S A;  1D4N A;  3BFT A;  3RGY A;  2DWJ A;  5EHS A;  2O1M A;  4OER A;  3IK6 B;  5H8H B;  4C1U A;  3C35 A;  1J1N A;  3FJM A;  3TMG A;  4F3B A;  4LA9 A;  1POY 1;  1B3F A;  3PV0 E;  4IY5 A;  1VFE A;  2GHB A;  2F6P A;  5H8N B;  4XKP A;  1A8E A;  3GBB A;  3HST A;  1S7Y A;  4U4S A;  1FCK A;  5FTI A;  1FW0 A;  1JQF A;  4RA1 A;  5F1Q A;  4GOT A;  4F3G A;  5AA3 A;  2F7C A;  4O3C A;  3ONM A;  4JXI A;  4R9F A;  3TTM A;  1DMB A;  3OD7 A;  3PPN A;  2HAV A;  1A55 A;  4RPO A;  2UVH A;  3Q27 A;  3GXA A;  3S4U A;  1TWY A;  2ALU A;  2O69 A;  4PFT A;  2I3W A;  4Q0C A;  4G68 A;  1DTG A;  1MPB A;  2YPN A;  3TTL A;  4YU0 A;  1URG A;  2DP8 A;  3OMB A;  3QAX A;  3EHU A;  1UTB B;  4RK9 A;  4X9T A;  2P1S A;  3VXB A;  4ELP A;  2O84 X;  1NL5 A;  1B0H A;  1ZBM A;  4LP2 B;  5DVI A;  3MPK A;  5CBS A;  2YLN A;  3T9U A;  4P11 A;  3IOT A;  4IO6 A;  3H6U A;  1MDP 1;  4U1Z A;  3C36 A;  4ZE9 A;  1FQA A;  2F7A A;  2IEE A;  1AL3 A;  4HCW A;  4MH5 A;  1EU8 A;  2XXQ A;  3T66 A;  3V8X B;  4NF8 A;  4WED A;  5J1D A;  3FGS A;  1PB7 A;  2OBG A;  2XX7 A;  3PUV E;  2XXU A;  3EF7 A;  4KHZ E;  1OIB A;  4LZ7 A;  1NMU A;  4O3A A;  4N6P A;  4NF8 B;  3RT6 B;  1US5 A;  2G29 A;  3QIM A;  4GQO A;  3CSG A;  2FYI A;  2Y7W A;  4RNS A;  4ESW A;  1D3K A;  3K1M A;  3CI8 A;  1N04 A;  2HEU A;  4R2F A;  3FV1 A;  5CI5 A;  4N13 A;  4OEV A;  2VOZ A;  1LB8 A;  2DS9 A;  5H8Q B;  3SEY A;  4DCX A;  3LUY A;  3DM0 A;  2Q2A A;  2I48 A;  4NF4 B;  4OTE A;  1ELJ A;  2HZL A;  2QMX A;  2XXR A;  4KQP A;  3TZA A;  3Q25 A;  4Z0I A;  5KCJ B;  1N7X A;  4TOZ A;  1JW5 A;  1DOT A;  2THI A;  2GRV A;  4YMB A;  4XKR A;  1B7U A;  2W7Y A;  1CE2 A;  1YAE A;  1MDQ A;  3K6V A;  3D4G A;  4YKJ A;  3OXN A;  3UP9 A;  3C9H A;  4ZS9 A;  5ICT A;  4IGT A;  4YKK A;  1LAH E;  2DXY A;  1RKM A;  2XXX A;  4HTG A;  1M5C A;  1FTJ A;  1Z7N E;  3RPW A;  3SEX A;  1SW1 A;  1BIY A;  2AYS A;  1MQH A;  2DE4 A;  4DZ1 A;  5KDT B;  3S9L C;  3PMX A;  4OFL A;  1SVX B;  3SER A;  4H8I A;  3B6Q A;  4LZ5 A;  3U94 A;  3UOR A;  2Z8F A;  3AXF A;  4WXJ A;  1I69 A;  1B2H A;  3USD A;  5KDT A;  2UXA A;  2DWH A;  3CSB A;  5I57 A;  4PET A;  1IXC A;  4HCY A;  4IO2 A;  4DXB A;  1A40 A;  3FIR A;  1IEJ A;  4JSD A;  3V89 B;  2RIN A;  4G68 C;  4L17 A;  3TOD A;  1NH7 A;  3ILT B;  2ONK E;  2DXR A;  3BBR A;  3HV1 A;  4OET A;  3TTR A;  3DLN A;  3JV9 A;  3SDF A;  3CR9 A;  4ZEC A;  1EZ9 A;  2XXH A;  3CFL A;  3PUX E;  3WAE A;  5TPA A;  4F18 A;  3QXM A;  1NNK A;  4XKQ A;  5AE4 A;  2DE2 A;  3MVY A;  2ZYN A;  1QUJ A;  2XXI A;  3FXR A;  2RKM A;  4EQB A;  4GVO A;  2H5Y A;  1FQE A;  1TXF A;  3PUW E;  1RYX A;  3KZG A;  4LZ8 A;  3Q26 A;  1LCT A;  3IO6 A;  4R6H A;  2PVU A;  4RYA A;  3K6W A;  3K0V A;  1FTL A;  3PPQ A;  1O7T A;  1P1Q A;  2OJT A;  1H76 A;  3K4U A;  1SQY A;  3U93 A;  5TPA B;  2B3B A;  3CVG A;  1EZP A;  5L9S A;  4NF6 A;  2Y7I A;  5K2Y A;  4YMA A;  4GL8 A;  4I9D A;  3EHT A;  4NF5 B;  3CG3 A;  3VXC A;  3N26 A;  3FUZ A;  1FTM A;  3DP4 A;  4F3P A;  5ELV A;  1SD3 A;  3MJN A;  5DT6 A;  3UIF A;  4FEB A;  2OCU A;  4FJP A;  4XTC Q;  3FXQ A;  3OO9 A;  2AL4 A;  3TQL A;  1UTB A;  1OVB A;  3I3V A;  5CM6 A;  1BP5 A;  2R71 A;  3OO8 A;  4F2O A;  2AL5 A;  1B6H A;  1WVJ A;  2DQV A;  2LAO A;  2VHA A;  1AMF A;  1MS7 A;  3CFZ A;  2UYF A;  5FHM A;  3ECR A;  4OHN A;  3PD9 A;  3IJO B;  3OO6 A;  3OSR A;  3C33 A;  4G8H A;  1II5 A;  4TLM B;  4BLA A;  1M5D A;  4P0I A;  5DVF A;  2R6G E;  2V93 A;  1TT1 A;  4LON B;  4R74 A;  1B3H A;  4EQ9 A;  4U23 A;  1ZKB A;  4TLL B;  4LUB A;  4EDP A;  3PUY E;  3TEP A;  4R6K A;  2WKY A;  1B3E A;  1JEU A;  1SDX A;  2NXO A;  3GLB A;  3MZ1 A;  3R26 A;  4GRK A;  1PBP A;  3VVE A;  1LFI A;  3C32 A;  1IXI A;  1ZU0 A;  1P99 A;  3OEL A;  1XVX A;  3F11 A;  4Q30 B;  1B0L A;  5DYH A;  3HPI A;  3H03 A;  4XKN A;  1DTZ A;  2PMS A;  2QPQ A;  3KJ7 A;  3MUQ A;  4PFU A;  4YB7 A;  2F7B A;  3LSX A;  1QUK A;  1EH3 A;  2ANJ A;  4PE5 B;  5K2X A;  3RTW B;  1VFD A;  3BFU A;  1OVT A;  4KPT A;  2NUV A;  3IAZ A;  4G2Z A;  4QFK A;  3KEI A;  4RJZ A;  2ABH A;  3IOU A;  3MZB A;  1P1W A;  3RQT A;  4GD5 A;  1HSL A;  2D21 A;  5F7V A;  5HPQ A;  5CBR A;  3O6H A;  1CB6 A;  4PFY A;  4M1V A;  1MG1 A;  5JK4 A;  2OWS A;  1OQH A;  2CZL A;  3BKI B;  4H0W A;  1FTK A;  5I59 B;  3V5A A;  4ZZE A;  4QF9 A;  4DE8 A;  1URS A;  1HSJ A;  2V3T A;  3KG2 A;  1US4 A;  3O6I A;  4QFP A;  2FNC A;  4DIG A;  2HCA A;  4JWY A;  1GR2 A;  3A3C A;  1P1N A;  4R6Y A;  5FTH A;  2O51 A;  3IOV A;  3KN8 A;  2RC8 A;  3TUS A;  1VSO A;  2O6A A;  1MQI A;  4KCD A;  5IKB A;  2Q8J A;  2DE3 A;  2VD2 A;  4HS7 A;  5JTY B;  3T96 B;  4OEN A;  4WKM A;  4BDN A;  4ELR A;  3SEV A;  3G3G A;  2QS2 A;  1O64 A;  1FTO A;  1A7L A;  3KJT A;  3TTK A;  2P2A A;  1MXX A;  1B05 A;  2ZXT A;  1IIT A;  3IB0 A;  4H1X A;  5I2K B;  1VR5 A;  2I3V A;  3JZJ A;  3O2A A;  3VV5 A;  3MVZ A;  3SEU A;  5CMB A;  3QUJ A;  2RC7 A;  2ONS A;  4XIG Q;  3VLW A;  5TU0 A;  2GH9 A;  4MBP A;  4ZEI A;  3TYH A;  2X7P A;  4AB5 A;  4F19 A;  4EXK A;  1ZLQ A;  1ZIU A;  4NTL A;  3K1P A;  3HN0 A;  5KZT A;  3IO4 A;  1B7H A;  1MQJ A;  2GFE A;  1MY2 A;  4H5F A;  3FVO A;  4IB2 A;  3GZG A;  3FAS A;  3H3G A;  2QS3 A;  4RK2 A;  3K02 A;  3OSQ A;  4U21 A;  4YB6 A;  3SET A;  3OEK A;  1BKA A;  3KN7 A;  4UA8 A;  4ZE8 A;  4GIZ A;  3T22 A;  3ZSF A;  4F22 A;  4JWO A;  5H8S A;  5BUU A;  4DXU A;  1S9T A;  1Z7M E;  3I6V A;  3KOS A;  2UYE A;  2ZYM A;  4LQ5 A;  4QSC A;  3W9V A;  4KYE A;  5AA2 D;  1M5E A;  2YJP A;  1SYH A;  3C34 A;  1MY0 A;  4OFJ A;  4POX A;  4THI A;  4UAC A;  5JTY A;  4R72 A;  4ZDM A;  2PBW A;  3MAM A;  3FAT A;  3I5O A;  4NMY A;  4ZEK A;  2V3Q A;  3MPL A;  3OEM A;  3PMW A;  1JET A;  2I4C A;  3VDF A;  1T0K A;  4YIC A;  1IZ1 A;  3VFJ A;  5CC2 A;  1MXY A;  1MM7 A;  4YZZ A;  5B70 A;  5AA1 A;  3V83 A;  1N3W A;  4EQ7 A;  2X26 A;  3KBR A;  5H8F B;  3IB2 A;  5I59 A;  1Y1M A;  2Z22 A;  5B7D A;  2PT2 A;  3FVG A;  3A3U A;  4R75 A;  4RPN A;  5ITO A;  4F1V A;  3M3L A;  4OZ9 A;  2Q89 A;  2F6G A;  3KN3 A;  3JYR A;  5AA2 A;  2DVZ A;  5DTB A;  3U72 A;  3QK6 A;  1B5J A;  1MRP A;  3EPE A;  3TAJ A;  1XHY A;  4IO7 A;  4FEC A;  2QL3 A;  2I49 A;  3MW0 A;  1PEB A;  3ODB A;  3O97 A;  2UVI A;  3KSX A;  4I62 A;  3G3K A;  3PPR A;  3SEW A;  3U8Q A;  3RN8 A;  1N7W A;  1Y3N A;  3R7X A;  4U4X A;  4IO4 A;  3B6T A;  4RY1 A;  3O9P A;  2OLB A;  1JW4 A;  2F36 A;  4XXU A;  3PD8 A;  2I58 A;  4YKP A;  1MY3 A;  3MQ9 A;  4C1T A;  5ISU A;  1NNP A;  2V3U A;  4X1D A;  1AIV A;  1LCF A;  1M5B A;  2Y84 A;  1QVS A;  1RYO A;  3H06 B;  3M8U A;  4IO3 A;  1EZO A;  1QW0 A;  4K3F A;  1IIW A;  4NF6 B;  2REJ A;  4NWD A;  1YCJ A;  1ZMG A;  4NWC A;  4QSE A;  1MM6 A;  4BDL A;  2OK2 A;  1NFT A;  2XX8 A;  2H9B A;  2NWJ A;  1GVC A;  1Y9U A;  4FOR A;  4R9G A;  4JSO A;  1N0T A;  1NNT A;  3C31 A;  3LBS A;  5A5X A;  1ATG A;  2VP1 A;  2M8C A;  3N5L A;  2ZYO A;  2V84 A;  4NF5 A;  3HHG A;  3FJ7 A;  4POW A;  1AH5 A;  2DYX A;  3H6W A;  4NF4 A;  2QRY A;  1DPE A;  3FV2 A;  1MY1 A;  4Q8R A;  1QKA A;  5DEX B;  4Q5T A;  2I0C A;  1B3L A;  1JVX A;  2H99 A;  1QKB A;  4JBZ A;  1DPP A;  4NED A;  4OEU A;  4HW8 A;  5I2N B;  3PMV A;  4H5G A;  4I8C A;  1DSN A;  3OEN A;  4LAT A;  4OVJ A;  4QFO A;  1D9Y A;  4QRZ A;  4RXL A;  3G3I A;  4X1B A;  2ZNU A;  4KI0 E;  5HM4 B;  3O6G A;  4F2Q A;  1NH8 A;  2ZNT A;  1Y20 A;  3A09 A;  3KFM A;  4OXV A;  2HQ0 A;  5ICQ A;  3H7M A;  1IUD A;  1PB9 A;  3B6W A;  2A5T B;  1PB8 A;  4F39 A;  1FQB A;  2O7I A;  2QS4 A;  5CMM A;  4NE4 A;  1IXG A;  2IA4 A;  4QSD A;  1N84 A;  3MVW A;  4MLV A;  2Y7P A;  4X48 A;  3KOT A;  4OWD A;  3R6U A;  3LR1 A;  4YKI A;  1FQF A;  3G7W A;  1PC3 A;  1N3X A;  2I4B A;  3DP6 A;  4JWX A;  3W9W A;  5TP9 A;  1LFG A;  3FVK A;  4R73 A;  1OQG A;  1SW5 A;  4BDO A;  2H25 A;  2I6E A;  3KSJ A;  4IO5 A;  1VE4 A;  4U2R A;  4KR5 A;  1M5F A;  1B46 A;  4E0W A;  3D4C A;  3HO7 A;  1L5T A;  1SW4 A;  2V25 A;  1R6Z A;  3IOW A;  2QSX A;  1USY H;  2O68 A;  1B5I A;  1LB9 A;  5JEI A;  3MP8 A;  3SKP A;  2F8D A;  4PFW A;  3T9X B;  1BLF A;  3U1O A;  2XXP A;  2H98 A;  3LSF B;  1LLS A;  3H6T A;  3M3K A;  2XXV A;  4GF8 A;  4BDR A;  4BDM A;  4OYV A;  1H3D A;  4FE8 A;  1B9J A;  5HBC A;  3THI A;  2F34 A;  2HXW A;  5EHM A;  3ZKL A;  4JB7 A;  3RTF B;  5I2N A;  5TP9 B;  3CG1 A;  2XX9 A;  1AOV A;  4GXA A;  4EXL A;  4GWO A;  4R2B A;  1MY4 A;  3PPO A;  4YAH X;  1KWH A;  3UGW A;  1A54 A;  1MH3 A;  2REG A;  3IJX B;  5BWJ A;  1Y3Q A;  4E0X A;  5I57 B;  1SW2 A;  2X7Q A;  3L6G A;  2F78 A;  3PPP A;  3TQW A;  1FQD A;  1I6Q A;  2XHD A;  3K6X A;  2ZMB A;  4F29 A;  3IB1 A;  4P0G A;  4WEP A;  1R1N A;  3E4R A;  1FQC A;  3E13 X;  4GL0 A;  5KCJ A;  3K6U A;  1B4Z A;  4PP0 A;  1OLC A;  5L9M A;  4FED A;  1XVY A;  5AA4 A;  2NOO A;  1ZTY A;  4AQ4 A;  2Z8D A;  3H6V A;  3OO7 A;  4G4P A;  4GFR A;  5L8D A;  1Q1K A;  3QSL A;  1D9V A;  1H43 A;  3VE1 B;  3VVF A;  1SI1 A;  1N76 A;  3ILU B;  3IOR A;  1LBC A;  1MXU A;  1SI0 A;  1Y3P A;  2E0S A;  3H4Z A;  3OOA A;  2UVG A;  2NVU B;  1B32 A;  5I56 A;  2A5T A;  4KCC A;  3CFX A;  4OQO A;  1A99 A;  4OFO A;  4H67 A;  4H8J A;  4QFL A;  4N07 A;  4IY6 A;  2O7U A;  1UIU A;  3FZV A;  3W15 C;  3EN3 A;  4DLD A;  2HAU A;  4IGR A;  1UQW A;  1XS5 A;  2QS1 A;  2XXT A;  5DEX A;  5AA4 B;  2B65 A;  3FD3 A;  3MWB A;  2H4I A;  4F1Y A;  1TFA A;  1NKX A;  4ELO A;  4H65 A;  1URD A;  4OMB A;  1B5H A;  1B3G A;  1H45 A;  2GHA A;  2UVJ A;  3MP6 A;  4ZEB A;  4ECF A;  1SYI A;  2I0B A;  4KYD A;  4C0R A;  4ELQ A;  3MC2 A;  1LST A;  2F97 A;  3QYT A;  4G68 B;  5A5X B;  3S9N C;  3RNN A;  5FHO A;  1LAG E;  1UTH B;  4ESX A;  1MQG A;  3K01 A;  1JW1 A;  3EHS A;  3SES A;  2KLF A;  1QJM A;  1MXZ A;  5H8Q A;  3DP8 A;  5LOM A;  4MF3 A;  2R9J A;  3E9X A;  3LC8 A;  5CMK A;  1JVY A;  1O63 A;  3EQ1 A;  3L6H A;  4G8N A;  4KFQ A;  2ESN A;  4DCY A;  1B1X A;  4F31 B;  3HHF A;  1B52 A;  3S9M C;  4G8M A;  2FA7 A;  3O66 A;  5M2V A;  1LBB A;  2Z8E A;  1PBQ A;  3FXU A;  5L9O A;  4ZEF A;  1OMP A;  4QHQ A;  1B1H A;  2O1L A;  1B7Z A;  3G3F A;  1GV8 A;  4H6D A;  2HFB A;  4GXS B;  2AIX A;  1JNF A;  1R9Q A;  1WOD A;  1QUI A;  5I58 A;  1IQ7 A;  1P1U A;  3LSW A;  3TFL A;  4FAT A;  4M4G A;  5FHN A;  1P1O A;  3PU5 A;  3T9V A;  2D3I A;  5AA2 B;  2F35 A;  3TEL A;  1YTV A;  1MQD A;  3N6T A;  4ONY A;  3CRB A;  2DOJ A;  1QUL A;  3IL1 B;  5H8N A;  3VLV A;  5I2K A;  3FVN A;  3IR1 A;  4EF2 A;  2ZNS A;  4OES A;  3HCQ A;  1Y4C A;  4FAJ A;  1I6B A;  2DWI A;  3RY3 A;  1WDN A;  1Y1Z A;  1MXW A;  4JDF A;  4QFN A;  5ITP A;  1JEV A;  3UA8 A;  1A8F A;  3P7I A;  3TCG A;  3TCF A;  1Q35 A;  2RCA A;  2G93 A;  1HSE A;  3CIJ A;  2Y7R A;  4U1O A;  3RLF E;  2ONR A;  5I58 B;  3TTN A;  2RF1 A;  4Z7E A;  2CMO A;  4MLQ A;  4GLI A;  3FJG A;  1ANF A;  1BTJ A;  1MPC A;  2PX1 A;  1B51 A;  1MPD A;  1R9L A;  2BJJ X;  1GTK A;  2F5X A;  1XC1 A;  2Q9T A;  1GGG A;  5H8F A;  1B40 A;  3G3J A;  4TQU Q;  2PYY A;  2OWT A;  4LQ2 A;  4ZZA A;  2DSF A;  2HZK A;  2D5W A;  3N94 A;  4KYS A;  1PDA A;  3Q28 A;  3WAF A;  3VVD A;  2QMW A;  3ZS6 A;  2XD3 A;  1B58 A;  4I1D A;  1LFH A;  4EF1 A;  2Z23 A;  3MVX A;  2VGQ A;  3ZKK A;  4ISU A;  1IXH A;  4AB6 A;  4DDD A;  1LAX A;  1XOC A;  3C4M A;  1MXV A;  1UIV A;  3K2D A;  3PGF A;  2OZZ A;  1UTH A;  3RT8 A;  4ND9 A;  3G3H A;  3RUM A;  3E3K A;  5CMC A;  3TCH A;  1SBP A;  1S50 A;  3B7D A;  3KGC A;  1YPN A;  4ZED A;  3UK4 A;  3VLU A;  3T9H B;  3TKD A;  2VD3 A;  3MP1 A;  4DXC A;  1POT A;  3LSL A;  2ZYK A;  4YB5 A;  3T93 B;  1OLA A;  2A5S A;  2QJE A;  2Y7K A;  2XXW A;  1TFD A;  4F3S A;  3N6U A;  1MH4 A;  1I6A A;  2DVC A;  4U22 A;  2E1S A;  4LVQ A;  5H8H A;  1F9B A;  1ZJL A;  3UN6 A;  2Q88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...