2A5TA

Crystal structure of the nr1/nr2a ligand-binding cores complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
284
structure length
271
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subunit arrangement and function in NMDA receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport,membrane protein
molecule keywords N-methyl-D-aspartate receptor NMDAR1-4a subunit
total genus 79
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2a5tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2a5tA02
3CFLA 2NWJA 2H4IA 2QL3A 3A09A 3VFJA 2WKYA 4BLAA 3EHSA 3ILUB 2OWSA 1H76A 4DIGA 4ELPA 4EQBA 1BLFA 3U1OA 2O1LA 3OENA 4OETA 1QULA 2V3QA 1B4HA 1GVCA 1MM7A 1SW1A 2O7UA 1I69A 2O1MA 2UVJA 4G68C 1DSNA 4PETA 2PT1A 1LFGA 5ICTA 1Y4TA 3SEVA 5CMKA 3MVXA 3KBRA 2I0CA 4QF9A 5FHOA 2XXRA 5B70A 3C36A 3G3JA 2IEEA 1EU8A 3MP6A 4QFLA 2RKMA 4H65A 4AB6A 2ABHA 2P0SA 3LC8A 5I57A 2DWAA 2OK2A 1OVBA 3KN8A 1EZOA 4YB6A 3TTLA 4PE5B 2I3WA 5CBRA 1USYE 2XXPA 1MXZA 4ZEKA 4XKPA 3I5OA 1Y4CA 1DPPA 2DSFA 3EN3A 1N04A 3G3GA 1DMBA 1PB7A 1VFDA 3MZ9A 4ESXA 1MDQA 4POXA 1YPNA 1USYH 4LA9A 2R9JA 2A5SA 2GFEA 2DXRA 2UVIA 2Y7RA 2ZNUA 1QJMA 1B9JA 3CI8A 3DP4A 2XXQA 3SKPA 1AH5A 4NF4A 3TTMA 1O64A 3G3KA 3IR1A 3PD8A 4KYDA 3S2VA 1B40A 1S7YA 3HSTA 1TT1A 3UORA 4H8JA 5DVIA 4OVJA 3RGYA 1IZ1A 1Q35A 1URSA 4QFNA 3MZBA 4M1VA 3WAEA 4EUOA 1AIVA 2QS1A 4JWYA 3FUZA 1US5A 3MAMA 4XKQA 3AXFA 4ZS9A 4GRKA 3SEXA 1F9BA 5AA2B 5L9SA 1A55A 1R6ZA 3BBRA 4FECA 5FTHA 1AL3A 1ATGA 2GHBA 2AYSA 3T9HB 3DELB 3Q29A 5I56A 1MG1A 1B6HA 4X9TA 1JNFA 1MXUA 2AIXA 1QUKA 4F39A 2O51A 1MQDA 4NTLA 2REGA 1UTHA 5CMMA 3RUMA 2RINA 3UGWA 4MF3A 4DE8A 3KZGA 5H8NB 3Q26A 3OO7A 4LZ8A 1P99A 3CSBA 2DE3A 4RJZA 1RKMA 1UIVA 4KI0E 1IQ7A 2KLFA 4N07A 4OZ9A 2Y7IA 4QFOA 4F18A 2LAOA 1OQGA 1UTBA 2VP1A 3FVGA 3UIFA 3T9VA 1JEVA 1WODA 3U93A 4FORA 1GV8A 1DTGA 3K00A 1Y9UA 5AA4A 5TPAA 4U2RA 1SYHA 1HSLA 1FTOA 1AOVA 3H7MA 4NF6A 3MPLA 1T0KA 4LVQA 1GGGA 3HHGA 1OLAA 3H6TA 4IO7A 3UA8A 5I2NB 2DOJA 3MBPA 2VGQA 4PFUA 4MLVA 3LSWA 3OSRA 3DM0A 1B7HA 1EH3A 3H6VA 1MY3A 3LSFB 3O6IA 1ZJLA 4L17A 1B3EA 2NOOA 2R71A 3MWBA 4ND9A 2D3IA 3MZ1A 3SEWA 1H45A 2HAVA 3TCGA 1SI0A 3TYHA 3PUWE 5H8FA 5A5XA 3VVDA 3OELA 5HPQA 2QJEA 2F97A 3IK6B 3BFTA 3FVKA 1Y1MA 4U4SA 3M3KA 4O3BA 1PEBA 5DT6A 2A5TA 1LB9A 1VE4A 4FEDA 2YJPA 4XTCQ 2Z8DA 1H43A 4U1ZA 4G68A 5H8HA 4ZZAA 1JW4A 2GRVA 1AMFA 4P11A 3W15C 1A8EA 5TP9B 2AL5A 3O66A 4MBPA 3GBBA 3OSQA 4OMBA 2ZNSA 3FJMA 3KSJA 4R6YA 1O63A 1Z7ME 3L6HA 4GFRA 4ZEDA 3G7WA 5L9OA 3IO4A 4QSDA 1LFIA 2GHAA 4POWA 2HZKA 3IJOB 1B0HA 2XXTA 3PUXE 2D21A 4JWXA 4C1TA 3H6WA 2Q8JA 1B1XA 3KJ7A 4E0XA 5H8QB 5DEXA 1LBBA 1ELJA 4FATA 3H6UA 1I6QA 2I4CA 4NWDA 4OHNA 4XKRA 1N3WA 3T9XB 3EHUA 3S4UA 1M5BA 2QPQA 2QS4A 2B3FA 3FV2A 1ZBMA 3CVGA 3IB0A 2O69A 3BFUA 4JB7A 1B3GA 3K6WA 3T66A 1B51A 5KDTA 1P1NA 1VFEA 4XKNA 5CC2A 4KQPA 4ZDMA 3HHFA 4NEDA 3SETA 4F3SA 1VSOA 2Y84A 1LBCA 1LB8A 3HV1A 4FIMA 1MS7A 2XXXA 3C9HA 4QSEA 5EHSA 1A99A 1FQBA 5AE4A 4F31B 3S9MC 3CRBA 3F11A 1LSTA 3RN8A 1QW0A 4FE8A 1UIUA 1ZKBA 5B7DA 3UK4A 4NF8B 2PVUA 2O6AA 1B5JA 3K1MA 1YAEA 1FQDA 1MY0A 3FGSA 4RPOA 4U21A 4U4XA 5FHMA 4ZEIA 2XXHA 3THIA 1FQCA 3OMBA 3PUYE 2DWIA 1LCTA 3SEUA 1NNPA 1NH8A 1SD3A 4YKJA 4JDFA 1FQAA 4R9FA 1TXFA 4FJPA 1URDA 3V5AA 3N94A 1R9LA 4X48A 3K1NA 3U92A 3HN0A 4DXUA 4I1DA 1H44A 1SBPA 3TCHA 1ANFA 3K1PA 4MLQA 2XX7A 3VXBA 1MXXA 2I3VA 2UYFA 3FIRA 4BDMA 4C0RA 3CFZA 1M5FA 5CMCA 4F2QA 2Y7PA 2DQVA 4I8CA 3VXCA 1M5DA 2G93A 2ZYKA 2F35A 1MY1A 2UVHA 3M3LA 5K2YA 2D5WA 2R6GE 4OTEA 1N7XA 1P1UA 2I58A 2P1SA 5CMBA 3RQTA 3SEYA 3T96B 4F1YA 2RC9A 3HO7A 2QRYA 3PPNA 1HSEA 5BWJA 1N76A 4WEPA 4X1DA 3K01A 1LLSA 2QMWA 1Y3QA 4H0WA 3O6GA 4JWOA 4KR5A 3ZSFA 5F1QA 2XXIA 1FQFA 1P1QA 1POY1 1SQYA 2DE4A 4IO5A 2NVUB 1N3XA 1QKBA 1CB6A 2B65A 3B6QA 3H03A 3IX1A 4DLDA 3QUJA 2DXYA 4G2ZA 3FZVA 1SW4A 3C34A 1MQGA 4YZZA 1B7UA 1R1NA 4LZ5A 5ITOA 4EDPA 5AA2A 1URGA 2CZLA 1MH4A 1VR5A 1IUDA 1II5A 2PX1A 3IO6A 1WVJA 1ZIUA 3EQ1A 4H5FA 2HCAA 4JSOA 3RTFB 5FHNA 4BDLA 3TPAA 4G8HA 2PBWA 4LZ7A 4R9GA 3FV1A 4C1UA 1L5TA 1FW0A 1D9YA 4TLLB 1UTHB 3O97A 1ZU0A 4HS7A 5BUUA 1EZ9A 1EZPA 5ISUA 3TCFA 4ISUA 3Q28A 4Q8RA 1B1HA 1LAHE 5ITPA 4IB2A 3MVZA 4IO3A 4GVOA 4ZE9A 3A3CA 3PPRA 4F3PA 4ZECA 5JEIA 4N13A 5KCJB 3JYRA 3U94A 5DEXB 4F29A 3QAXA 1A8FA 3FJ7A 5I2KB 1B2HA 3H4ZA 3IOWA 1MPBA 2DE2A 5DTBA 2IA4A 4NMYA 2RCBA 3N6TA 1CE2A 2F6PA 4NF4B 4Z7EA 1DTZA 2X7QA 3ODBA 2XXWA 4E0WA 1NH7A 2ZXTA 2XX8A 4PFTA 1OVTA 3ECRA 1SYIA 2RF1A 4G8NA 3GZGA 1IIWA 3LBSA 4GWOA 4GXSB 4H1XA 1IXGA 4RNSA 3OO9A 3GBAA 1NNFA 3KEIA 4RY1A 1QUIA 3SERA 3IJXB 1XT8A 3PPOA 4H8IA 4O3CA 4OQOA 4QHQA 4GF8A 4YAHX 3TAJA 4Q5TA 5A5XB 1SDXA 2XD2A 5I58B 3S9NC 3OXNA 4LQ5A 4H6DA 4ECFA 3VV5A 4F3GA 1DOTA 3C33A 4HW8A 1Y3PA 2THIA 2ZYOA 1MDP1 4OFJA 2X26A 2Y7WA 1Y3NA 2Z8EA 3PMVA 4KCCA 1I6BA 2F7BA 4XXUA 3VLVA 3O6HA 5TP9A 2OBGA 2F6GA 4JSDA 5IKBA 3T93B 4TOZA 3TMGA 1ZLQA 2XXYA 1UQWA 2H99A 1B3LA 4I62A 1LAXA 1JEUA 2XX9A 1XOCA 4Q30B 2V3UA 3FXUA 5TU0A 3RLFE 4FAJA 3UP9A 2V3TA 4WXJA 1RYOA 3L6GA 4BDQA 3LSXA 3W9VA 3O2AA 5ELVA 4QFKA 3PUVE 5DVJA 5I57B 3E9XA 2VD3A 4HCYA 4KYSA 4O3AA 3HPIA 4ELOA 2HEUA 3SESA 1B58A 4N6PA 1FTKA 3R7XA 3RPWA 3IOUA 2REJA 5TPAB 1M5CA 1GTKA 3FJGA 2DP8A 4OEVA 1JW5A 3RY3A 4P0GA 5EYFA 1POTA 3MP8A 2VOZA 1IEJA 1LAGE 1B4ZA 3CFXA 2F36A 2Z23A 3GLBA 3KGCA 4R73A 4H5GA 4DCXA 1IXHA 3RNNA 1NKXA 3P7IA 2ONSA 4P0IA 4G77A 4OFLA 5K2XA 4IO4A 1B5HA 1M5EA 4OEUA 4PQJA 3HCQA 5L9MA 2ZNTA 5H8FB 4XIGQ 3TDJA 1MY4A 2YPNA 2F5XA 5F7VA 1MPDA 2RCAA 1QVSA 3N6UA 2VHAA 1DPEA 3FATA 3OOAA 5AA1A 3C32A 5JTYB 4G4PA 5DYHA 1D3KA 2OLBA 4OFOA 4RK2A 1B7ZA 4OWDA 4F1VA 1TWYA 2HZLA 5I59B 2PMSA 1MY2A 1IITA 5CI5A 4OESA 3WAFA 1MXWA 1OMPA 1ZMGA 3K2DA 4MFIA 4R74A 2XHDA 4BDOA 3TTRA 4MH5A 1LFHA 4NF5B 1NFTA 1BIYA 1NL5A 2H9BA 1XVXA 2QMXA 4RXLA 3K6XA 3ZKKA 2ONKE 3C31A 4GOTA 4QFPA 3CG1A 3E13X 1A54A 2Y7KA 3IL1B 4R2BA 4EQ7A 5AA2D 5IAIA 3MVYA 3PV0E 3PPQA 2FA7A 3K4UA 1OQHA 3KJTA 4JBZA 5AA4B 3N26A 1MH3A 2RC8A 4ZEFA 2B3BA 1QKAA 4HCWA 2F78A 1WDNA 1QUJA 4DXBA 3VVFA 1GR2A 3B6WA 4THIA 1SW2A 2BJJX 1S9TA 3MJNA 1YTVA 4ZZEA 3TTKA 2V84A 4R6HA 3PMWA 4TQUQ 5HBCA 4F1UA 4R72A 3KSXA 3O9PA 1LAFE 3MPKA 1TFAA 2HAUA 2I6EA 5I2NA 3RT8A 1FTMA 2OZZA 5LOMA 2I48A 1MQHA 2XXVA 3MC2A 1IXIA 1P1WA 1FTJA 3DP8A 4G68B 2HXWA 5I58A 1JVYA 1FQEA 3IOVA 4KD5A 4X1BA 4AQ4A 3CG3A 3OEMA 1B5IA 3O28A 2DWHA 3D4CA 4Q0CA 1OIBA 3U8QA 4LQ2A 5I56B 1N0TA 3QIMA 3EHTA 3LR1A 3PMXA 4DDDA 2A5TB 2DWJA 3G3IA 2DVZA 2I4BA 5H8HB 1XVYA 1PB8A 3EF7A 1R9QA 3VVEA 4ESWA 4PP0A 2V25A 3RT6B 2QS2A 5J1DA 1A7LA 2H5YA 2Q2CA 3GXAA 4YMAA 2OWTA 3SDFA 1OLCA 3QSLA 4PFYA 1Y1ZA 2HFBA 2ESNA 4OXVA 3QK6A 5H8NA 2NUVA 5L8DA 2F7CA 3MQ9A 3EPEA 2O84X 3ZS6A 4DCYA 3S9EA 3DLNA 3K02A 3KN3A 5KCJA 3B7DA 2DYXA 3R6UA 1BTJA 3OO8A 3PD9A 4YMBA 5CM6A 2Q88A 2Q9TA 2O7IA 1B3FA 1N84A 2O68A 2QSXA 3ILTB 1KWHA 3KN7A 4U23A 3QUFA 3RTWB 1XC1A 3K0VA 4YB5A 3IORA 5JK4A 4I9DA 4IY6A 5FTIA 2AL4A 4FEBA 4KYEA 5EHMA 3N5LA 4WEDA 4NF6B 3OO6A 3K6VA 4KPTA 4RK9A 3ZKLA 4EF1A 2VD2A 1B52A 3MVWA 1JW1A 2G29A 2H25A 3D4GA 4R75A 3T22A 5KDTB 1US4A 4BDNA 3VDFA 1HSJA 4KFQA 4EXLA 3I6VA 4LP2B 4ELRA 3Q25A 1ZTYA 3UN6A 3CIJA 3IAZA 4LATA 4Z0IA 3B6TA 4JXIA 2CMOA 5I59A 2UVGA 5KZTA 2P2AA 1D4NA 3BKIB 4GIZA 4K3FA 1MPCA 4ZE8A 5JTYA 1PDAA 2V93A 3FD3A 4BDRA 3DP6A 3E4RA 2FNCA 4RYAA 1J1NA 1PBQA 3H3GA 3FASA 4WKMA 3TQWA 1N7WA 4ELQA 2OCUA 5AA3A 1RYXA 4YU0A 3IOTA 2NXOA 2ZYMA 2X7PA 4F19A 4GXAA 3TKDA 2ALUA 3TZAA 2M8CA 4DZ1A 3Q27A 3TUSA 4YKIA 4R6KA 3IB2A 3ONMA 4HTGA 3PU5A 2I0BA 4GQOA 3MW0A 2Z22A 3E3KA 4QRZA 4YB7A 2W7YA 4RA1A 2DS9A 3G3HA 3OD7A 1B32A 3CR9A 4RPNA 2ZMBA 2ONRA 4UA8A 3VLUA 5CRYA 4AB5A 3CSGA 4OERA 3TEPA 1NMUA 1XHYA 2F7AA 1PBPA 3V89B 2YLNA 1B46A 2DVCA 2FYIA 2PYYA 1PC3A 3VE1B 4GD5A 3KOTA 1XS5A 1YCJA 4IY5A 3T9UA 1FCKA 1BP5A 1S50A 4LONB 1JQFA 3U72A 5CBSA 5ICQA 2ANJA 3R26A 3LSLA 2HQ0A 1SVXB 2ZYNA 4NE4A 4KCDA 1MXVA 3KG2A 4UACA 2XXUA 2Z8FA 3G3FA 4LUBA 3M3FA 3TTNA 1IXCA 4EQ9A 5HM4B 4U1OA 1LCFA 3USDA 4EXKA 1B0LA 1MM6A 4R2FA 3TQLA 3JV9A 4NF8A 1MQIA 3S9LC 1NNTA 3KFMA 4YKPA 3LUYA 3VLWA 1Y20A 3O29A 4GL0A 3H06B 3QYTA 4OYVA 3TELA 5M2VA 2Q89A 1JETA 3OEKA 1SI1A 1B3HA 4F3BA 3I3VA 4GLIA 4F22A 4PFWA 3V83A 2F8DA 3M8UA 1TFDA 3TFLA 2F34A 1H3DA 4NF5A 4ONYA 1A40A 3W9WA 3A3UA 4DXCA 1PB9A 1BKAA 3FVNA 1O7TA 2I49A 3TODA 2RC7A 2QS3A 1FTLA 4NWCA 4YKKA 4IO6A 1UTBB 4G8MA 2Q2AA 3K6UA 4IGRA 4EF2A 1P1OA 5H8QA 4YICA 1B05A 3C35A 3FVOA 3FXQA 4GL8A 2PT2A 1D9VA 1MXYA 4IO2A 1JVXA 1I6AA 1LGBC 2H98A 3QXMA 2UYEA 1Z7NE 1NNKA 3PPPA 5I84A 4QSCA 4IGTA 1MQJA 3IB1A 3JZJA 2E1SA 3KOSA 4H67A 4KHZE 4OENA 4F2OA 5I2KA 3MP1A 1Q1KA 3PUZE 2OJTA 2UXAA 3PGFA 1MRPA 2XD3A 2E0SA 4M4GA 5H8SA 4ZEBA 3MUQA 2GH9A 3C4MA 4TLMB 5DVFA 1SW5A 3V8XB 3FXRA 4U22A
chains in the Genus database with same CATH superfamily
3A09A 3EKIA 1H76A 4DIGA 1BLFA 4MNIA 4XF5A 4GWUA 3OENA 1B4HA 2UVJA 4G68C 3C36A 3G3JA 4QFLA 2RKMA 5IZ1A 2ABHA 2P0SA 3LC8A 4N4UA 2DWAA 3ISPA 1EZOA 4YB6A 4ZEKA 1VFDA 4ESXA 2R9JA 2A5SA 2UVIA 2DXRA 3RQTA 1B9JA 4NF4A 1B40A 4H8JA 1IZ1A 4XKQA 4N6DA 3BBRA 3T9HB 1JP4A 5IZ3B 1MXUA 2AIXA 1MQDA 2REGA 4N81A 2RINA 3Q26A 4NHBA 4RJZA 1RKMA 1IQ7A 4N07A 4O8MA 5EQ9A 1FBPA 3KC0A 3T9VA 1JEVA 4PF8A 4FORA 5AA4A 4U2RA 1SYHA 1AOVA 1FPBA 4NF6A 4HE2A 3UA8A 3E78A 3LSFB 2R71A 3TCGA 2WX9A 1H45A 2HAVA 5H8FA 5A5XA 5HPQA 2QJEA 2F97A 3FVKA 1PEBA 2A5TA 1VE4A 4FEDA 4U1ZA 2GRVA 4P11A 1A8EA 2V4CA 3OSQA 2ZNSA 4PDHA 1RDZA 5I7IA 3PUXE 3H6WA 2Q8JA 4FATA 1ELJA 1I6QA 3T9XB 4OHNA 1IMCA 1M5BA 2QS4A 5DW8A 4JB7A 2Q8MA 1NV6A 5CC2A 4KQPA 4ZDMA 4OVTA 4QSEA 3C9HA 1FQBA 4F31B 1UIUA 1ZKBA 3K1MA 4U21A 1FQDA 1MY0A 3FGSA 4U4XA 2XXHA 1FQCA 5ESYA 1SD3A 1NH8A 5I3SA 1TXFA 2QVUA 1URDA 3N94A 1R9LA 4X48A 3K1NA 2XA5A 1ANFA 3K1PA 5CMCA 2ZYKA 2F35A 5CMBA 3T1BA 3HO7A 1HSEA 4GWZA 1N76A 1Y3QA 3ZSFA 1IMDA 1N3XA 3B6QA 3QUJA 3FZVA 1SW4A 3C34A 4YZZA 5ITOA 1URGA 4DI4B 3D1RA 4JSOA 2HCAA 2MKZA 4LZ7A 3FV1A 2PFZA 1EZ9A 3Q28A 2PCRA 1LAHE 5ITPA 1FBEA 4ZE9A 3PPRA 2QVVA 4N13A 5KCJB 3JYRA 3FJ7A 1NV7A 4MCOA 2DE2A 4NMYA 3N6TA 4FBPA 4Z7EA 3ODBA 2XXWA 2XX8A 2RF1A 1IXGA 3OO9A 3KEIA 4GX3A 4QHQA 1FPKA 1G0IA 3S9NC 4ECFA 4H6DA 3VV5A 3C33A 5EYHA 2ZYOA 4KCCA 2Z8EA 5IKBA 3T93B 3TMGA 1ZLQA 2VPNA 2H99A 1B3LA 1LAXA 1JEUA 4Q30B 4WXJA 4BDQA 4QFKA 3PUVE 5I57B 2VD3A 5EQ7A 3HPIA 2FIEA 1POTA 3MP8A 1LAGE 3CFXA 3KGCA 4R73A 2CEXA 1IXHA 3RNNA 4PFBA 2WBBA 4MNPA 5K2XA 4C0RA 1B5HA 4OEUA 2HHMA 3NOHA 4P1LA 5IZ3A 3C32A 4G4PA 4UABA 1TWYA 2HZLA 1IITA 4OESA 3WAFA 1MXWA 3K2DA 4MFIA 1LFHA 2XHDA 3TTRA 4MH5A 4NF5B 1NL5A 3K6XA 2Y7KA 5IAIA 3PV0E 1G0HA 2B3BA 4HCWA 3VVFA 1GR2A 3MSTA 2V84A 5HBCA 4F1UA 2HXRA 3O9PA 3MPKA 1TFAA 1DCUA 3RT8A 2QFLA 3MC2A 3DP8A 4G68B 4KXPA 3IOVA 3OEMA 2DWHA 1IMBA 1N0TA 3QIMA 3EF7A 4ESWA 4G61A 2Q2CA 1EYIA 4YMAA 1OLCA 1LBYA 5L8DA 2NUVA 4N8GA 1BK4A 1FSAA 3KN7A 2O7IA 1N84A 4YB5A 3ROJA 1FPIA 2AL4A 4GX4A 3N5LA 4OVQA 4WEDA 3MVWA 1JW1A 2G29A 3T22A 1FPGA 3VDFA 3CIJA 4LATA 2XWOA 4BDRA 4RYAA 3TQWA 1J1NA 1N7WA 4ELQA 1RYXA 1NV4A 2M8CA 4R6KA 4HTGA 2I0BA 3MW0A 2Z22A 3OD7A 1SPIA 1B46A 4GD5A 3T9UA 1S50A 1JQFA 2HQ0A 4NE4A 2Z8FA 3G3FA 3M3FA 1LCFA 3JV9A 1NNTA 4GL0A 3H06B 5J16A 2Q89A 4F3BA 3LV0A 4PFWA 1TFDA 3A3UA 4DXCA 3TODA 2RC7A 4NWCA 1UTBB 4PGPA 3FXQA 4IO2A 5EYGA 2H98A 1Z7NE 1NNKA 3PPPA 4IGTA 5IZZA 3KOSA 3JZJA 1K9ZA 3MP1A 2OJTA 4O94A 1MRPA 1NUZA 2XD3A 2ZZXA 5DVFA 3B50A 4U22A 2QL3A 4PTKA 2WKYA 4BLAA 3EHSA 4ELPA 3U1OA 2O1LA 2V3QA 1GVCA 1NUYA 1SW1A 2PT1A 1LFGA 1Y4TA 5CMKA 2B4MA 3KBRA 3MVXA 4QF9A 5B70A 1EU8A 5I57A 2OK2A 3TTLA 4PE5B 5CBRA 4XKPA 3I5OA 1Y4CA 3G3GA 1N04A 1DMBA 1MDQA 4POXA 1USYH 4LA9A 5IGAA 4TOZA 3RPLB 3DP4A 3G3KA 1Q35A 1URSA 4QFNA 1AIVA 4JWYA 4PFIA 4MJOA 5L9SA 4ZS9A 4GRKA 1AL3A 3Q29A 1QUKA 4F39A 4NAPA 1FPDA 4MF3A 3KZGA 1VDWA 3OO7A 4LZ8A 4QFOA 4OZ9A 4PDDA 2LAOA 2VP1A 3UIFA 3U93A 3K00A 3H7MA 1T0KA 3CHGA 4LVQA 4GBVA 1GGGA 5I2NB 4IO7A 3MBPA 4MLVA 3LSWA 3OSRA 1B7HA 1EH3A 3O6IA 1ZJLA 3SEWA 3TYHA 1SI0A 3BFTA 1FPLA 5DT6A 1LB9A 4XTCQ 2Z8DA 1H43A 4ZZAA 1JW4A 5TP9B 3O66A 3GBBA 4OMBA 1LEVA 3L6HA 4ZEDA 5L9OA 3IO4A 1LFIA 4POWA 2D21A 4XKRA 3IB0A 2O69A 3BFUA 1B3GA 3K6WA 1B51A 5KDTA 3HHFA 1VSOA 1LBCA 1MS7A 5AE4A 3F11A 3RN8A 2Y5LA 5B7DA 3UK4A 4NF8B 2PVUA 4ZEIA 3THIA 5ET7A 2DWIA 1LCTA 4YKJA 4DXUA 1H44A 3TCHA 1MXXA 2UYFA 3FIRA 1M5FA 3VXCA 2G93A 1MY1A 5K2YA 2D5WA 4OTEA 1N7XA 3SEYA 4F1YA 1EYJA 4WEPA 1FPFA 1LLSA 4H0WA 1FQFA 1POY1 1QKBA 1CB6A 4XFEA 1B7UA 1MH4A 1IUDA 1II5A 4H5FA 3RTFB 1ZIUA 1LBVA 4BDLA 3TPAA 2PBWA 4P56A 4TLLB 3O97A 1EZPA 4ISUA 4Q8RA 1EYKA 1B1HA 4IO3A 5JEIA 5ET6A 1A8FA 1B2HA 1IMEA 3IOWA 1MPBA 2IA4A 4P1EA 2HPGA 1CE2A 1DTZA 2X7QA 4E0WA 1NH7A 2ZXTA 4PFTA 4G8NA 4GWOA 1DBZA 4RY1A 3GBAA 3FXBA 4O3CA 1XT8A 4AS4A 4Q5TA 4H45A 2XD2A 3GYYA 1DOTA 1Y3PA 1FJ6A 2OWZA 2THIA 1MDP1 4MIJA 4OFJA 4NG7A 2Y7WA 1Y3NA 3PMVA 2F7BA 3VLVA 1YYZA 2OBGA 1FRPA 1UQWA 3UP9A 4KYSA 3SESA 1B58A 4N6PA 3R7XA 3RPWA 5TPAB 1M5CA 1GTKA 4P0GA 2F36A 1NKXA 3P7IA 1Q9DA 4OFLA 1M5EA 5L9MA 3HCQA 1MY4A 2RCAA 5AA1A 1DPEA 3OOAA 1D3KA 4RK2A 4OFOA 3SZPA 4OWDA 2PMSA 1MY2A 5CI5A 1ZMGA 1NFTA 1XVXA 4PCDA 3ZKKA 4OVPA 4GOTA 4QFPA 5AA2D 4EQ7A 4GBWA 3PPQA 3N26A 1QUJA 3B6WA 1S9TA 4N8YA 1AWBA 4TQUQ 1LAFE 2I6EA 4OA4A 1FTMA 5LOMA 1MQHA 2XXVA 1P1WA 1FTJA 1JVYA 3O28A 3D4CA 3U8QA 3EHTA 2A5TB 3G3IA 2QS2A 2DDKA 1A7LA 4PFYA 5H8NA 4OXVA 3ZS6A 2F7CA 4DCYA 3DLNA 3K02A 3R6UA 3OO8A 5FTIA 4FEBA 4KYEA 5EHMA 3OO6A 3K6VA 4RK9A 3D4GA 2H25A 4R75A 1US4A 4EXLA 3B6TA 4K3FA 5JTYA 2V93A 3E4RA 4WKMA 3FASA 2OCUA 1LBZA 2NXOA 4F19A 2X7PA 3TKDA 2ALUA 1XI6A 4YKIA 4MX6A 3IB2A 3PU5A 4RPNA 2ZMBA 4OERA 5A5LA 1NMUA 2F7AA 2DVCA 2WYKA 1FCKA 1BP5A 4LONB 2GQ1A 3U72A 5CBSA 2ANJA 3R26A 4NGUA 5LDZA 1SVXB 2ZYNA 4PBHA 4KCDA 2XXUA 3TTNA 4O7MA 1IXCA 2KR0A 3TQLA 1MM6A 3S9LC 1YXIA 1Y20A 3TELA 4OYVA 1NV5A 1KA0A 1JETA 3OEKA 3V83A 1CNQA 4ONYA 3W9WA 1PB9A 1BKAA 3FVNA 2QS3A 1NV0A 3QMFA 4IO6A 4G8MA 4IGRA 1P1OA 1B05A 2PT2A 1D9VA 1I6AA 1RDYA 4N6KA 5I84A 2OX3A 4QSCA 1MQJA 4OENA 2E1SA 4KHZE 3PUZE 4M4GA 2GH9A 1SW5A 2NWJA 2H4IA 5FBPA 4GX6A 4EQBA 4OETA 2O1MA 3SEVA 5FHOA 1RDXA 4H65A 4AB6A 4OANA 1USYE 2XXPA 1YPNA 2Y7RA 2GFEA 3CI8A 5ISUA 2ZNUA 1QJMA 1AH5A 1O64A 3IR1A 3PD8A 4KYDA 3S2VA 1S7YA 1TT1A 4OVJA 3RGYA 4EUOA 4MMPA 1R6ZA 5FTHA 3DELB 1MG1A 1B6HA 1JNFA 3PTYA 4N91A 4HE1A 2O51A 4NTLA 2CZHA 1UTHA 5CMMA 5EQ8A 1NV3A 4PE3A 1P99A 4KI0E 2KLFA 4F18A 1OQGA 1UTBA 3FVGA 4PBQA 1FPJA 1DTGA 1Y9UA 5TPAA 3MPLA 4GWSA 3HHGA 1OLAA 2DOJA 4PFUA 2VGQA 3DM0A 3H6VA 1GV8A 1MY3A 1B3EA 2NOOA 3MWBA 2D3IA 3MZ1A 3PUWE 3IK6B 3M3KA 4O3BA 2YJPA 4G68A 3W15C 2AL5A 3FJMA 1Z7ME 3G7WA 4QSDA 2XXTA 4JWXA 4C1TA 4P3LA 3KJ7A 4E0XA 5DEXA 1LBBA 1N3WA 3EHUA 2QPQA 3CVGA 3T66A 1VFEA 4XKNA 4NEDA 4F3SA 3UN6A 2CZIA 3KBZA 1NI9A 3CRBA 4FE8A 2O6AA 2FHYA 3OMBA 3PUYE 1NNPA 4NF0A 4JDFA 1FQAA 4R9FA 4FJPA 2XXKA 3V5AA 4I1DA 3HFUA 3VXBA 2I3VA 4BDMA 4F2QA 2Y7PA 4NQ8A 4IR8A 2R6GE 1P1UA 1NUXA 3T96B 5BWJA 3K01A 3O6GA 4KR5A 1FBCA 1SQYA 1P1QA 4IO5A 2NVUB 3H03A 2B65A 4OVSA 3IX1A 2DXYA 4EDPA 1QGXA 4LZ5A 2FIXA 1VR5A 2PX1A 3IO6A 5I59A 3EQ1A 4G8HA 4R9GA 4H46A 1L5TA 1FW0A 1UTHB 1ZU0A 4PC9A 4IB2A 3MVZA 4GVOA 1INPA 3A3CA 4I3EA 4F3PA 4NX1A 2WBDA 3H4ZA 2F6PA 4H1XA 3GZGA 1NNFA 2ZZWA 3SERA 3IJXB 4H8IA 3BIGA 3PPOA 3TAJA 5A5XB 4YAHX 4HW8A 4I3YA 4MAGA 1I6BA 4XXUA 2F6GA 2F3DA 2F3BA 2XX9A 3RLFE 3FXUA 5TU0A 4FAJA 2V3TA 3W9VA 3O2AA 5DVJA 3E9XA 4HCYA 4ELOA 3IFCA 2HEUA 1FTKA 3IOUA 2REJA 3FJGA 4OEVA 3RY3A 5EYFA 3GLBA 2Z23A 2JJKA 2Y5KA 2ONSA 4G77A 2ZNTA 2F5XA 1MPDA 1QVSA 2VHAA 5JTYB 5DYHA 5IM2A 4R74A 4BDOA 1NV1A 4HE0A 2H9BA 3IL1B 1A54A 2CZKA 2FA7A 3K4UA 3KJTA 5AA4B 1MH3A 4ZEFA 1QKAA 2F78A 1WDNA 2BJJX 2VT5A 1YTVA 4ZZEA 3TTKA 5LTCA 5I2NA 2OZZA 2I48A 5I58A 4AQ4A 1FQEA 4X1BA 3CG3A 4Q0CA 4LQ2A 3PMXA 4DDDA 2XWIA 2DWJA 2I4BA 5H8HB 1XVYA 1PB8A 4PP0A 2V25A 4JVDA 3RT6B 4P9KA 2OWTA 3SDFA 1Y1ZA 3WAEA 3E79A 3S9EA 3MQ9A 3EPEA 5KCJA 3B7DA 1BTJA 4YMBA 4THIA 5ELVA 2O68A 3ILTB 4U23A 1KWHA 3RTWB 3QUFA 1XC1A 3IORA 5JK4A 4I9DA 4NF6B 3ZKLA 4KPTA 4EF1A 2VD2A 5KDTB 4BDNA 3I6VA 4N17A 4ELRA 3Q25A 1ZTYA 3IAZA 4JXIA 2CMOA 2UVGA 5KZTA 2P2AA 3BKIB 4GIZA 4MEVA 4ZE8A 3DP6A 1LBWA 1PBQA 3H3GA 4YU0A 3IOTA 4GXAA 3TZAA 4DZ1A 3Q27A 3TUSA 3ONMA 4GQOA 4QRZA 3E3KA 4YB7A 4RA1A 2DS9A 3G3HA 2ONRA 3VLUA 3CSGA 3TEPA 1XHYA 3VE1B 4IY5A 1XS5A 1YCJA 4GWWA 5ICQA 3LSLA 1YZ0A 3KG2A 4UACA 4LUBA 4EQ9A 4U1OA 1B0LA 1MQIA 3KFMA 4YKPA 3VLWA 5M2VA 1SI1A 2VPOA 3I3VA 4F22A 3M8UA 2F34A 4NF5A 4LN5A 1O7TA 2I49A 4PAFA 1FTLA 1LBXA 2Q2AA 4EF2A 5H8QA 4YICA 1JVXA 1LGBC 2XWVA 3IB1A 5I2KA 4ZEBA 4TLMB 1K9YA 3V8XB 3FXRA 3CFLA 3VFJA 2P3NA 3ILUB 2OWSA 4X8RA 1FBGA 1FTAA 4XEQA 1KZ8A 3BIHA 4QBAA 1QULA 1MM7A 2O7UA 1DK4A 1I69A 5T3JA 4MNCA 1DSNA 4PETA 5ICTA 2I0CA 2XXRA 2IEEA 3MP6A 1OVBA 2FVZA 3KN8A 2I3WA 1MXZA 1DPPA 2DSFA 3EN3A 1PB7A 3MZ9A 5ET8A 2XXQA 4JVCA 2R8TA 3TTMA 1IMAA 3HSTA 3UORA 5DVIA 3MZBA 4M1VA 2QS1A 3FUZA 1US5A 3MAMA 3AXFA 3SEXA 1F9BA 5AA2B 1A55A 4FECA 2GHBA 1ATGA 2AYSA 5I56A 4X9TA 4HXVA 3RUMA 3UGWA 4DE8A 5H8NB 3CSBA 2DE3A 1UIVA 2Y7IA 2FBPA 5ET5A 1WODA 1NV2A 1HSLA 1FTOA 3H6TA 1FJ9A 4L17A 4ND9A 4GWYA 4P8BA 3VVDA 5EQAA 3OELA 1Y1MA 4U4SA 5H8HA 1AMFA 4MBPA 3KSJA 4R6YA 1O63A 4GFRA 1NUWA 2GHAA 4MHFA 2HZKA 3IJOB 1B0HA 4PGNA 1B1XA 1D9QA 5H8QB 3H6UA 4GWXA 2I4CA 4NWDA 3S4UA 2B3FA 3FV2A 1ZBMA 1P1NA 3SETA 2Y84A 3HV1A 1LB8A 4FIMA 5EHSA 2XXXA 1A99A 3S9MC 1LSTA 1QW0A 1IMFA 2L5VA 1B5JA 1YAEA 4RPOA 5FHMA 3SEUA 2KQZA 3U92A 3HN0A 4NN3A 1SBPA 4MLQA 2XX7A 3CFZA 2DQVA 4I8CA 1M5DA 2BJIA 2UVHA 3M3LA 2ZZVA 2I58A 2P1SA 3T0JA 2RC9A 2CEYA 2QRYA 3PPNA 4X1DA 2QMWA 4JWOA 1FBHA 5F1QA 2XXIA 2DE4A 4DLDA 4G2ZA 5AA2A 2QVRA 1MQGA 1R1NA 2CZLA 2P3VA 1WVJA 5FHNA 4C1UA 1D9YA 4HS7A 5BUUA 3TCFA 4ZECA 3U94A 5DEXB 4F29A 3QAXA 5I2KB 5DTBA 2RCBA 4NF4B 1OVTA 3ECRA 1SYIA 3LBSA 1IIWA 4GXSB 4RNSA 1QUIA 4OQOA 4GF8A 1SDXA 5I58B 4AS5A 3OXNA 4LQ5A 4F3GA 2X26A 4JVIA 3O6HA 5TP9A 4N15A 4JSDA 2XXYA 4I62A 1XOCA 2V3UA 1RYOA 3L6GA 3LSXA 2WYPA 4O3AA 2DP8A 1JW5A 2VOZA 1IEJA 1B4ZA 4DCXA 4H5GA 4P0IA 3SKPA 5F24A 4IO4A 4PQJA 5H8FB 4XIGQ 3TDJA 2YPNA 4PF6A 5F7VA 3N6UA 3FATA 1FBDA 2OLBA 1B7ZA 4F1VA 5I59B 1OMPA 1FPEA 1BIYA 2QMXA 4RXLA 3MYUA 2ONKE 3C31A 3CG1A 3E13X 4R2BA 3MVYA 4JBZA 1OQHA 2RC8A 2XWKA 4DXBA 1SW2A 4QXDA 3MJNA 3RPLA 4R6HA 3PMWA 4R72A 3KSXA 2HAUA 3B8BA 2B4LA 1IXIA 2WEFA 2HXWA 4O7IA 3LUZA 4KD5A 1B5IA 1OIBA 5I56B 3LR1A 2DVZA 1R9QA 3VVEA 3RYDA 5J1DA 2H5YA 3GXAA 3QSLA 4AB5A 2HFBA 2ESNA 3QK6A 2O84X 3KN3A 2DYXA 3PD9A 5CM6A 2Q88A 2Q9TA 1B3FA 2QSXA 4P47A 3K0VA 4IY6A 1B52A 4X04A 1HSJA 4KFQA 4LP2B 4Z0IA 1D4NA 4I40A 1MPCA 1PDAA 4PFRA 3FD3A 2FNCA 5AA3A 5I5PA 2ZYMA 2PFYA 2Q74A 3A29A 2W7YA 3FBPA 1B32A 3CR9A 4UA8A 5CRYA 3V89B 1PBPA 2YLNA 2FYIA 2PYYA 1PC3A 3KOTA 3IFAA 1MXVA 5HM4B 3USDA 4EXKA 4R2FA 4DI3D 4NF8A 3LUYA 3O29A 3QYTA 3U65A 1KA1A 1B3HA 4GLIA 4PAIA 2F8DA 3TFLA 1H3DA 1A40A 4PAKA 4YKKA 4OVRA 1FBFA 3K6UA 3FVOA 3C35A 4GL8A 3KC1A 1MXYA 3QXMA 2UYEA 4H67A 4F2OA 1Q1KA 2UXAA 3PGFA 5H8SA 2E0SA 3MUQA 3C4MA
chains in the Genus database with same CATH topology
3CFLA 2NWJA 2H4IA 2QL3A 3A09A 3VFJA 2WKYA 4BLAA 3EHSA 3ILUB 2OWSA 1H76A 4DIGA 4ELPA 4EQBA 1BLFA 3U1OA 2O1LA 3OENA 4OETA 1QULA 2V3QA 1B4HA 1GVCA 1MM7A 1SW1A 2O7UA 1I69A 2O1MA 2UVJA 4G68C 1DSNA 4PETA 2PT1A 1LFGA 5ICTA 1Y4TA 3SEVA 5CMKA 3MVXA 3KBRA 2I0CA 4QF9A 5FHOA 2XXRA 5B70A 3C36A 3G3JA 2IEEA 1EU8A 3MP6A 4QFLA 2RKMA 4H65A 4AB6A 2ABHA 2P0SA 3LC8A 5I57A 2DWAA 2OK2A 1OVBA 3KN8A 1EZOA 4YB6A 3TTLA 4PE5B 2I3WA 5CBRA 1USYE 2XXPA 1MXZA 4ZEKA 4XKPA 3I5OA 1Y4CA 1DPPA 2DSFA 3EN3A 1N04A 3G3GA 1DMBA 1PB7A 1VFDA 3MZ9A 4ESXA 1MDQA 4POXA 1YPNA 1USYH 4LA9A 2R9JA 2A5SA 2GFEA 2DXRA 2UVIA 2Y7RA 2ZNUA 1QJMA 1B9JA 3CI8A 3DP4A 2XXQA 3SKPA 1AH5A 4NF4A 3TTMA 1O64A 3G3KA 3IR1A 3PD8A 4KYDA 3S2VA 1B40A 1S7YA 3HSTA 1TT1A 3UORA 4H8JA 5DVIA 4OVJA 3RGYA 1IZ1A 1Q35A 1URSA 4QFNA 3MZBA 4M1VA 3WAEA 4EUOA 1AIVA 2QS1A 4JWYA 3FUZA 1US5A 3MAMA 4XKQA 3AXFA 4ZS9A 4GRKA 3SEXA 1F9BA 5AA2B 5L9SA 1A55A 1R6ZA 3BBRA 4FECA 5FTHA 1AL3A 1ATGA 2GHBA 2AYSA 3T9HB 3DELB 3Q29A 5I56A 1MG1A 1B6HA 4X9TA 1JNFA 1MXUA 2AIXA 1QUKA 4F39A 2O51A 1MQDA 4NTLA 2REGA 1UTHA 5CMMA 3RUMA 2RINA 3UGWA 4MF3A 4DE8A 3KZGA 5H8NB 3Q26A 3OO7A 4LZ8A 1P99A 3CSBA 2DE3A 4RJZA 1RKMA 1UIVA 4KI0E 1IQ7A 2KLFA 4N07A 4OZ9A 2Y7IA 4QFOA 4F18A 2LAOA 1OQGA 1UTBA 2VP1A 3FVGA 3UIFA 3T9VA 1JEVA 1WODA 3U93A 4FORA 1GV8A 1DTGA 3K00A 1Y9UA 5AA4A 5TPAA 4U2RA 1SYHA 1HSLA 1FTOA 1AOVA 3H7MA 4NF6A 3MPLA 1T0KA 4LVQA 1GGGA 3HHGA 1OLAA 3H6TA 4IO7A 3UA8A 5I2NB 2DOJA 3MBPA 2VGQA 4PFUA 4MLVA 3LSWA 3OSRA 3DM0A 1B7HA 1EH3A 3H6VA 1MY3A 3LSFB 3O6IA 1ZJLA 4L17A 1B3EA 2NOOA 2R71A 3MWBA 4ND9A 2D3IA 3MZ1A 3SEWA 1H45A 2HAVA 3TCGA 1SI0A 3TYHA 3PUWE 5H8FA 5A5XA 3VVDA 3OELA 5HPQA 2QJEA 2F97A 3IK6B 3BFTA 3FVKA 1Y1MA 4U4SA 3M3KA 4O3BA 1PEBA 5DT6A 2A5TA 1LB9A 1VE4A 4FEDA 2YJPA 4XTCQ 2Z8DA 1H43A 4U1ZA 4G68A 5H8HA 4ZZAA 1JW4A 2GRVA 1AMFA 4P11A 3W15C 1A8EA 5TP9B 2AL5A 3O66A 4MBPA 3GBBA 3OSQA 4OMBA 2ZNSA 3FJMA 3KSJA 4R6YA 1O63A 1Z7ME 3L6HA 4GFRA 4ZEDA 3G7WA 5L9OA 3IO4A 4QSDA 1LFIA 2GHAA 4POWA 2HZKA 3IJOB 1B0HA 2XXTA 3PUXE 2D21A 4JWXA 4C1TA 3H6WA 2Q8JA 1B1XA 3KJ7A 4E0XA 5H8QB 5DEXA 1LBBA 1ELJA 4FATA 3H6UA 1I6QA 2I4CA 4NWDA 4OHNA 4XKRA 1N3WA 3T9XB 3EHUA 3S4UA 1M5BA 2QPQA 2QS4A 2B3FA 3FV2A 1ZBMA 3CVGA 3IB0A 2O69A 3BFUA 4JB7A 1B3GA 3K6WA 3T66A 1B51A 5KDTA 1P1NA 1VFEA 4XKNA 5CC2A 4KQPA 4ZDMA 3HHFA 4NEDA 3SETA 4F3SA 1VSOA 2Y84A 1LBCA 1LB8A 3HV1A 4FIMA 1MS7A 2XXXA 3C9HA 4QSEA 5EHSA 1A99A 1FQBA 5AE4A 4F31B 3S9MC 3CRBA 3F11A 1LSTA 3RN8A 1QW0A 4FE8A 1UIUA 1ZKBA 5B7DA 3UK4A 4NF8B 2PVUA 2O6AA 1B5JA 3K1MA 1YAEA 1FQDA 1MY0A 3FGSA 4RPOA 4U21A 4U4XA 5FHMA 4ZEIA 2XXHA 3THIA 1FQCA 3OMBA 3PUYE 2DWIA 1LCTA 3SEUA 1NNPA 1NH8A 1SD3A 4YKJA 4JDFA 1FQAA 4R9FA 1TXFA 4FJPA 1URDA 3V5AA 3N94A 1R9LA 4X48A 3K1NA 3U92A 3HN0A 4DXUA 4I1DA 1H44A 1SBPA 3TCHA 1ANFA 3K1PA 4MLQA 2XX7A 3VXBA 1MXXA 2I3VA 2UYFA 3FIRA 4BDMA 4C0RA 3CFZA 1M5FA 5CMCA 4F2QA 2Y7PA 2DQVA 4I8CA 3VXCA 1M5DA 2G93A 2ZYKA 2F35A 1MY1A 2UVHA 3M3LA 5K2YA 2D5WA 2R6GE 4OTEA 1N7XA 1P1UA 2I58A 2P1SA 5CMBA 3RQTA 3SEYA 3T96B 4F1YA 2RC9A 3HO7A 2QRYA 3PPNA 1HSEA 5BWJA 1N76A 4WEPA 4X1DA 3K01A 1LLSA 2QMWA 1Y3QA 4H0WA 3O6GA 4JWOA 4KR5A 3ZSFA 5F1QA 2XXIA 1FQFA 1P1QA 1POY1 1SQYA 2DE4A 4IO5A 2NVUB 1N3XA 1QKBA 1CB6A 2B65A 3B6QA 3H03A 3IX1A 4DLDA 3QUJA 2DXYA 4G2ZA 3FZVA 1SW4A 3C34A 1MQGA 4YZZA 1B7UA 1R1NA 4LZ5A 5ITOA 4EDPA 5AA2A 1URGA 2CZLA 1MH4A 1VR5A 1IUDA 1II5A 2PX1A 3IO6A 1WVJA 1ZIUA 3EQ1A 4H5FA 2HCAA 4JSOA 3RTFB 5FHNA 4BDLA 3TPAA 4G8HA 2PBWA 4LZ7A 4R9GA 3FV1A 4C1UA 1L5TA 1FW0A 1D9YA 4TLLB 1UTHB 3O97A 1ZU0A 4HS7A 5BUUA 1EZ9A 1EZPA 5ISUA 3TCFA 4ISUA 3Q28A 4Q8RA 1B1HA 1LAHE 5ITPA 4IB2A 3MVZA 4IO3A 4GVOA 4ZE9A 3A3CA 3PPRA 4F3PA 4ZECA 5JEIA 4N13A 5KCJB 3JYRA 3U94A 5DEXB 4F29A 3QAXA 1A8FA 3FJ7A 5I2KB 1B2HA 3H4ZA 3IOWA 1MPBA 2DE2A 5DTBA 2IA4A 4NMYA 2RCBA 3N6TA 1CE2A 2F6PA 4NF4B 4Z7EA 1DTZA 2X7QA 3ODBA 2XXWA 4E0WA 1NH7A 2ZXTA 2XX8A 4PFTA 1OVTA 3ECRA 1SYIA 2RF1A 4G8NA 3GZGA 1IIWA 3LBSA 4GWOA 4GXSB 4H1XA 1IXGA 4RNSA 3OO9A 3GBAA 1NNFA 3KEIA 4RY1A 1QUIA 3SERA 3IJXB 1XT8A 3PPOA 4H8IA 4O3CA 4OQOA 4QHQA 4GF8A 4YAHX 3TAJA 4Q5TA 5A5XB 1SDXA 2XD2A 5I58B 3S9NC 3OXNA 4LQ5A 4H6DA 4ECFA 3VV5A 4F3GA 1DOTA 3C33A 4HW8A 1Y3PA 2THIA 2ZYOA 1MDP1 4OFJA 2X26A 2Y7WA 1Y3NA 2Z8EA 3PMVA 4KCCA 1I6BA 2F7BA 4XXUA 3VLVA 3O6HA 5TP9A 2OBGA 2F6GA 4JSDA 5IKBA 3T93B 4TOZA 3TMGA 1ZLQA 2XXYA 1UQWA 2H99A 1B3LA 4I62A 1LAXA 1JEUA 2XX9A 1XOCA 4Q30B 2V3UA 3FXUA 5TU0A 3RLFE 4FAJA 3UP9A 2V3TA 4WXJA 1RYOA 3L6GA 4BDQA 3LSXA 3W9VA 3O2AA 5ELVA 4QFKA 3PUVE 5DVJA 5I57B 3E9XA 2VD3A 4HCYA 4KYSA 4O3AA 3HPIA 4ELOA 2HEUA 3SESA 1B58A 4N6PA 1FTKA 3R7XA 3RPWA 3IOUA 2REJA 5TPAB 1M5CA 1GTKA 3FJGA 2DP8A 4OEVA 1JW5A 3RY3A 4P0GA 5EYFA 1POTA 3MP8A 2VOZA 1IEJA 1LAGE 1B4ZA 3CFXA 2F36A 2Z23A 3GLBA 3KGCA 4R73A 4H5GA 4DCXA 1IXHA 3RNNA 1NKXA 3P7IA 2ONSA 4P0IA 4G77A 4OFLA 5K2XA 4IO4A 1B5HA 1M5EA 4OEUA 4PQJA 3HCQA 5L9MA 2ZNTA 5H8FB 4XIGQ 3TDJA 1MY4A 2YPNA 2F5XA 5F7VA 1MPDA 2RCAA 1QVSA 3N6UA 2VHAA 1DPEA 3FATA 3OOAA 5AA1A 3C32A 5JTYB 4G4PA 5DYHA 1D3KA 2OLBA 4OFOA 4RK2A 1B7ZA 4OWDA 4F1VA 1TWYA 2HZLA 5I59B 2PMSA 1MY2A 1IITA 5CI5A 4OESA 3WAFA 1MXWA 1OMPA 1ZMGA 3K2DA 4MFIA 4R74A 2XHDA 4BDOA 3TTRA 4MH5A 1LFHA 4NF5B 1NFTA 1BIYA 1NL5A 2H9BA 1XVXA 2QMXA 4RXLA 3K6XA 3ZKKA 2ONKE 3C31A 4GOTA 4QFPA 3CG1A 3E13X 1A54A 2Y7KA 3IL1B 4R2BA 4EQ7A 5AA2D 5IAIA 3MVYA 3PV0E 3PPQA 2FA7A 3K4UA 1OQHA 3KJTA 4JBZA 5AA4B 3N26A 1MH3A 2RC8A 4ZEFA 2B3BA 1QKAA 4HCWA 2F78A 1WDNA 1QUJA 4DXBA 3VVFA 1GR2A 3B6WA 4THIA 1SW2A 2BJJX 1S9TA 3MJNA 1YTVA 4ZZEA 3TTKA 2V84A 4R6HA 3PMWA 4TQUQ 5HBCA 4F1UA 4R72A 3KSXA 3O9PA 1LAFE 3MPKA 1TFAA 2HAUA 2I6EA 5I2NA 3RT8A 1FTMA 2OZZA 5LOMA 2I48A 1MQHA 2XXVA 3MC2A 1IXIA 1P1WA 1FTJA 3DP8A 4G68B 2HXWA 5I58A 1JVYA 1FQEA 3IOVA 4KD5A 4X1BA 4AQ4A 3CG3A 3OEMA 1B5IA 3O28A 2DWHA 3D4CA 4Q0CA 1OIBA 3U8QA 4LQ2A 5I56B 1N0TA 3QIMA 3EHTA 3LR1A 3PMXA 4DDDA 2A5TB 2DWJA 3G3IA 2DVZA 2I4BA 5H8HB 1XVYA 1PB8A 3EF7A 1R9QA 3VVEA 4ESWA 4PP0A 2V25A 3RT6B 2QS2A 5J1DA 1A7LA 2H5YA 2Q2CA 3GXAA 4YMAA 2OWTA 3SDFA 1OLCA 3QSLA 4PFYA 1Y1ZA 2HFBA 2ESNA 4OXVA 3QK6A 5H8NA 2NUVA 5L8DA 2F7CA 3MQ9A 3EPEA 2O84X 3ZS6A 4DCYA 3S9EA 3DLNA 3K02A 3KN3A 5KCJA 3B7DA 2DYXA 3R6UA 1BTJA 3OO8A 3PD9A 4YMBA 5CM6A 2Q88A 2Q9TA 2O7IA 1B3FA 1N84A 2O68A 2QSXA 3ILTB 1KWHA 3KN7A 4U23A 3QUFA 3RTWB 1XC1A 3K0VA 4YB5A 3IORA 5JK4A 4I9DA 4IY6A 5FTIA 2AL4A 4FEBA 4KYEA 5EHMA 3N5LA 4WEDA 4NF6B 3OO6A 3K6VA 4KPTA 4RK9A 3ZKLA 4EF1A 2VD2A 1B52A 3MVWA 1JW1A 2G29A 2H25A 3D4GA 4R75A 3T22A 5KDTB 1US4A 4BDNA 3VDFA 1HSJA 4KFQA 4EXLA 3I6VA 4LP2B 4ELRA 3Q25A 1ZTYA 3UN6A 3CIJA 3IAZA 4LATA 4Z0IA 3B6TA 4JXIA 2CMOA 5I59A 2UVGA 5KZTA 2P2AA 1D4NA 3BKIB 4GIZA 4K3FA 1MPCA 4ZE8A 5JTYA 1PDAA 2V93A 3FD3A 4BDRA 3DP6A 3E4RA 2FNCA 4RYAA 1J1NA 1PBQA 3H3GA 3FASA 4WKMA 3TQWA 1N7WA 4ELQA 2OCUA 5AA3A 1RYXA 4YU0A 3IOTA 2NXOA 2ZYMA 2X7PA 4F19A 4GXAA 3TKDA 2ALUA 3TZAA 2M8CA 4DZ1A 3Q27A 3TUSA 4YKIA 4R6KA 3IB2A 3ONMA 4HTGA 3PU5A 2I0BA 4GQOA 3MW0A 2Z22A 3E3KA 4QRZA 4YB7A 2W7YA 4RA1A 2DS9A 3G3HA 3OD7A 1B32A 3CR9A 4RPNA 2ZMBA 2ONRA 4UA8A 3VLUA 5CRYA 4AB5A 3CSGA 4OERA 3TEPA 1NMUA 1XHYA 2F7AA 1PBPA 3V89B 2YLNA 1B46A 2DVCA 2FYIA 2PYYA 1PC3A 3VE1B 4GD5A 3KOTA 1XS5A 1YCJA 4IY5A 3T9UA 1FCKA 1BP5A 1S50A 4LONB 1JQFA 3U72A 5CBSA 5ICQA 2ANJA 3R26A 3LSLA 2HQ0A 1SVXB 2ZYNA 4NE4A 4KCDA 1MXVA 3KG2A 4UACA 2XXUA 2Z8FA 3G3FA 4LUBA 3M3FA 3TTNA 1IXCA 4EQ9A 5HM4B 4U1OA 1LCFA 3USDA 4EXKA 1B0LA 1MM6A 4R2FA 3TQLA 3JV9A 4NF8A 1MQIA 3S9LC 1NNTA 3KFMA 4YKPA 3LUYA 3VLWA 1Y20A 3O29A 4GL0A 3H06B 3QYTA 4OYVA 3TELA 5M2VA 2Q89A 1JETA 3OEKA 1SI1A 1B3HA 4F3BA 3I3VA 4GLIA 4F22A 4PFWA 3V83A 2F8DA 3M8UA 1TFDA 3TFLA 2F34A 1H3DA 4NF5A 4ONYA 1A40A 3W9WA 3A3UA 4DXCA 1PB9A 1BKAA 3FVNA 1O7TA 2I49A 3TODA 2RC7A 2QS3A 1FTLA 4NWCA 4YKKA 4IO6A 1UTBB 4G8MA 2Q2AA 3K6UA 4IGRA 4EF2A 1P1OA 5H8QA 4YICA 1B05A 3C35A 3FVOA 3FXQA 4GL8A 2PT2A 1D9VA 1MXYA 4IO2A 1JVXA 1I6AA 1LGBC 2H98A 3QXMA 2UYEA 1Z7NE 1NNKA 3PPPA 5I84A 4QSCA 4IGTA 1MQJA 3IB1A 3JZJA 2E1SA 3KOSA 4H67A 4KHZE 4OENA 4F2OA 5I2KA 3MP1A 1Q1KA 3PUZE 2OJTA 2UXAA 3PGFA 1MRPA 2XD3A 2E0SA 4M4GA 5H8SA 4ZEBA 3MUQA 2GH9A 3C4MA 4TLMB 5DVFA 1SW5A 3V8XB 3FXRA 4U22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFL A;  2NWJ A;  2H4I A;  2QL3 A;  3A09 A;  3VFJ A;  2WKY A;  4BLA A;  3EHS A;  3ILU B;  2OWS A;  1H76 A;  4DIG A;  4ELP A;  4EQB A;  1BLF A;  3U1O A;  2O1L A;  3OEN A;  4OET A;  1QUL A;  2V3Q A;  1B4H A;  1GVC A;  1MM7 A;  1SW1 A;  2O7U A;  1I69 A;  2O1M A;  2UVJ A;  4G68 C;  1DSN A;  4PET A;  2PT1 A;  1LFG A;  5ICT A;  1Y4T A;  3SEV A;  5CMK A;  3MVX A;  3KBR A;  2I0C A;  4QF9 A;  5FHO A;  2XXR A;  5B70 A;  3C36 A;  3G3J A;  2IEE A;  1EU8 A;  3MP6 A;  4QFL A;  2RKM A;  4H65 A;  4AB6 A;  2ABH A;  2P0S A;  3LC8 A;  5I57 A;  2DWA A;  2OK2 A;  1OVB A;  3KN8 A;  1EZO A;  4YB6 A;  3TTL A;  4PE5 B;  2I3W A;  5CBR A;  1USY E;  2XXP A;  1MXZ A;  4ZEK A;  4XKP A;  3I5O A;  1Y4C A;  1DPP A;  2DSF A;  3EN3 A;  1N04 A;  3G3G A;  1DMB A;  1PB7 A;  1VFD A;  3MZ9 A;  4ESX A;  1MDQ A;  4POX A;  1YPN A;  1USY H;  4LA9 A;  2R9J A;  2A5S A;  2GFE A;  2DXR A;  2UVI A;  2Y7R A;  2ZNU A;  1QJM A;  1B9J A;  3CI8 A;  3DP4 A;  2XXQ A;  3SKP A;  1AH5 A;  4NF4 A;  3TTM A;  1O64 A;  3G3K A;  3IR1 A;  3PD8 A;  4KYD A;  3S2V A;  1B40 A;  1S7Y A;  3HST A;  1TT1 A;  3UOR A;  4H8J A;  5DVI A;  4OVJ A;  3RGY A;  1IZ1 A;  1Q35 A;  1URS A;  4QFN A;  3MZB A;  4M1V A;  3WAE A;  4EUO A;  1AIV A;  2QS1 A;  4JWY A;  3FUZ A;  1US5 A;  3MAM A;  4XKQ A;  3AXF A;  4ZS9 A;  4GRK A;  3SEX A;  1F9B A;  5AA2 B;  5L9S A;  1A55 A;  1R6Z A;  3BBR A;  4FEC A;  5FTH A;  1AL3 A;  1ATG A;  2GHB A;  2AYS A;  3T9H B;  3DEL B;  3Q29 A;  5I56 A;  1MG1 A;  1B6H A;  4X9T A;  1JNF A;  1MXU A;  2AIX A;  1QUK A;  4F39 A;  2O51 A;  1MQD A;  4NTL A;  2REG A;  1UTH A;  5CMM A;  3RUM A;  2RIN A;  3UGW A;  4MF3 A;  4DE8 A;  3KZG A;  5H8N B;  3Q26 A;  3OO7 A;  4LZ8 A;  1P99 A;  3CSB A;  2DE3 A;  4RJZ A;  1RKM A;  1UIV A;  4KI0 E;  1IQ7 A;  2KLF A;  4N07 A;  4OZ9 A;  2Y7I A;  4QFO A;  4F18 A;  2LAO A;  1OQG A;  1UTB A;  2VP1 A;  3FVG A;  3UIF A;  3T9V A;  1JEV A;  1WOD A;  3U93 A;  4FOR A;  1GV8 A;  1DTG A;  3K00 A;  1Y9U A;  5AA4 A;  5TPA A;  4U2R A;  1SYH A;  1HSL A;  1FTO A;  1AOV A;  3H7M A;  4NF6 A;  3MPL A;  1T0K A;  4LVQ A;  1GGG A;  3HHG A;  1OLA A;  3H6T A;  4IO7 A;  3UA8 A;  5I2N B;  2DOJ A;  3MBP A;  2VGQ A;  4PFU A;  4MLV A;  3LSW A;  3OSR A;  3DM0 A;  1B7H A;  1EH3 A;  3H6V A;  1MY3 A;  3LSF B;  3O6I A;  1ZJL A;  4L17 A;  1B3E A;  2NOO A;  2R71 A;  3MWB A;  4ND9 A;  2D3I A;  3MZ1 A;  3SEW A;  1H45 A;  2HAV A;  3TCG A;  1SI0 A;  3TYH A;  3PUW E;  5H8F A;  5A5X A;  3VVD A;  3OEL A;  5HPQ A;  2QJE A;  2F97 A;  3IK6 B;  3BFT A;  3FVK A;  1Y1M A;  4U4S A;  3M3K A;  4O3B A;  1PEB A;  5DT6 A;  2A5T A;  1LB9 A;  1VE4 A;  4FED A;  2YJP A;  4XTC Q;  2Z8D A;  1H43 A;  4U1Z A;  4G68 A;  5H8H A;  4ZZA A;  1JW4 A;  2GRV A;  1AMF A;  4P11 A;  3W15 C;  1A8E A;  5TP9 B;  2AL5 A;  3O66 A;  4MBP A;  3GBB A;  3OSQ A;  4OMB A;  2ZNS A;  3FJM A;  3KSJ A;  4R6Y A;  1O63 A;  1Z7M E;  3L6H A;  4GFR A;  4ZED A;  3G7W A;  5L9O A;  3IO4 A;  4QSD A;  1LFI A;  2GHA A;  4POW A;  2HZK A;  3IJO B;  1B0H A;  2XXT A;  3PUX E;  2D21 A;  4JWX A;  4C1T A;  3H6W A;  2Q8J A;  1B1X A;  3KJ7 A;  4E0X A;  5H8Q B;  5DEX A;  1LBB A;  1ELJ A;  4FAT A;  3H6U A;  1I6Q A;  2I4C A;  4NWD A;  4OHN A;  4XKR A;  1N3W A;  3T9X B;  3EHU A;  3S4U A;  1M5B A;  2QPQ A;  2QS4 A;  2B3F A;  3FV2 A;  1ZBM A;  3CVG A;  3IB0 A;  2O69 A;  3BFU A;  4JB7 A;  1B3G A;  3K6W A;  3T66 A;  1B51 A;  5KDT A;  1P1N A;  1VFE A;  4XKN A;  5CC2 A;  4KQP A;  4ZDM A;  3HHF A;  4NED A;  3SET A;  4F3S A;  1VSO A;  2Y84 A;  1LBC A;  1LB8 A;  3HV1 A;  4FIM A;  1MS7 A;  2XXX A;  3C9H A;  4QSE A;  5EHS A;  1A99 A;  1FQB A;  5AE4 A;  4F31 B;  3S9M C;  3CRB A;  3F11 A;  1LST A;  3RN8 A;  1QW0 A;  4FE8 A;  1UIU A;  1ZKB A;  5B7D A;  3UK4 A;  4NF8 B;  2PVU A;  2O6A A;  1B5J A;  3K1M A;  1YAE A;  1FQD A;  1MY0 A;  3FGS A;  4RPO A;  4U21 A;  4U4X A;  5FHM A;  4ZEI A;  2XXH A;  3THI A;  1FQC A;  3OMB A;  3PUY E;  2DWI A;  1LCT A;  3SEU A;  1NNP A;  1NH8 A;  1SD3 A;  4YKJ A;  4JDF A;  1FQA A;  4R9F A;  1TXF A;  4FJP A;  1URD A;  3V5A A;  3N94 A;  1R9L A;  4X48 A;  3K1N A;  3U92 A;  3HN0 A;  4DXU A;  4I1D A;  1H44 A;  1SBP A;  3TCH A;  1ANF A;  3K1P A;  4MLQ A;  2XX7 A;  3VXB A;  1MXX A;  2I3V A;  2UYF A;  3FIR A;  4BDM A;  4C0R A;  3CFZ A;  1M5F A;  5CMC A;  4F2Q A;  2Y7P A;  2DQV A;  4I8C A;  3VXC A;  1M5D A;  2G93 A;  2ZYK A;  2F35 A;  1MY1 A;  2UVH A;  3M3L A;  5K2Y A;  2D5W A;  2R6G E;  4OTE A;  1N7X A;  1P1U A;  2I58 A;  2P1S A;  5CMB A;  3RQT A;  3SEY A;  3T96 B;  4F1Y A;  2RC9 A;  3HO7 A;  2QRY A;  3PPN A;  1HSE A;  5BWJ A;  1N76 A;  4WEP A;  4X1D A;  3K01 A;  1LLS A;  2QMW A;  1Y3Q A;  4H0W A;  3O6G A;  4JWO A;  4KR5 A;  3ZSF A;  5F1Q A;  2XXI A;  1FQF A;  1P1Q A;  1POY 1;  1SQY A;  2DE4 A;  4IO5 A;  2NVU B;  1N3X A;  1QKB A;  1CB6 A;  2B65 A;  3B6Q A;  3H03 A;  3IX1 A;  4DLD A;  3QUJ A;  2DXY A;  4G2Z A;  3FZV A;  1SW4 A;  3C34 A;  1MQG A;  4YZZ A;  1B7U A;  1R1N A;  4LZ5 A;  5ITO A;  4EDP A;  5AA2 A;  1URG A;  2CZL A;  1MH4 A;  1VR5 A;  1IUD A;  1II5 A;  2PX1 A;  3IO6 A;  1WVJ A;  1ZIU A;  3EQ1 A;  4H5F A;  2HCA A;  4JSO A;  3RTF B;  5FHN A;  4BDL A;  3TPA A;  4G8H A;  2PBW A;  4LZ7 A;  4R9G A;  3FV1 A;  4C1U A;  1L5T A;  1FW0 A;  1D9Y A;  4TLL B;  1UTH B;  3O97 A;  1ZU0 A;  4HS7 A;  5BUU A;  1EZ9 A;  1EZP A;  5ISU A;  3TCF A;  4ISU A;  3Q28 A;  4Q8R A;  1B1H A;  1LAH E;  5ITP A;  4IB2 A;  3MVZ A;  4IO3 A;  4GVO A;  4ZE9 A;  3A3C A;  3PPR A;  4F3P A;  4ZEC A;  5JEI A;  4N13 A;  5KCJ B;  3JYR A;  3U94 A;  5DEX B;  4F29 A;  3QAX A;  1A8F A;  3FJ7 A;  5I2K B;  1B2H A;  3H4Z A;  3IOW A;  1MPB A;  2DE2 A;  5DTB A;  2IA4 A;  4NMY A;  2RCB A;  3N6T A;  1CE2 A;  2F6P A;  4NF4 B;  4Z7E A;  1DTZ A;  2X7Q A;  3ODB A;  2XXW A;  4E0W A;  1NH7 A;  2ZXT A;  2XX8 A;  4PFT A;  1OVT A;  3ECR A;  1SYI A;  2RF1 A;  4G8N A;  3GZG A;  1IIW A;  3LBS A;  4GWO A;  4GXS B;  4H1X A;  1IXG A;  4RNS A;  3OO9 A;  3GBA A;  1NNF A;  3KEI A;  4RY1 A;  1QUI A;  3SER A;  3IJX B;  1XT8 A;  3PPO A;  4H8I A;  4O3C A;  4OQO A;  4QHQ A;  4GF8 A;  4YAH X;  3TAJ A;  4Q5T A;  5A5X B;  1SDX A;  2XD2 A;  5I58 B;  3S9N C;  3OXN A;  4LQ5 A;  4H6D A;  4ECF A;  3VV5 A;  4F3G A;  1DOT A;  3C33 A;  4HW8 A;  1Y3P A;  2THI A;  2ZYO A;  1MDP 1;  4OFJ A;  2X26 A;  2Y7W A;  1Y3N A;  2Z8E A;  3PMV A;  4KCC A;  1I6B A;  2F7B A;  4XXU A;  3VLV A;  3O6H A;  5TP9 A;  2OBG A;  2F6G A;  4JSD A;  5IKB A;  3T93 B;  4TOZ A;  3TMG A;  1ZLQ A;  2XXY A;  1UQW A;  2H99 A;  1B3L A;  4I62 A;  1LAX A;  1JEU A;  2XX9 A;  1XOC A;  4Q30 B;  2V3U A;  3FXU A;  5TU0 A;  3RLF E;  4FAJ A;  3UP9 A;  2V3T A;  4WXJ A;  1RYO A;  3L6G A;  4BDQ A;  3LSX A;  3W9V A;  3O2A A;  5ELV A;  4QFK A;  3PUV E;  5DVJ A;  5I57 B;  3E9X A;  2VD3 A;  4HCY A;  4KYS A;  4O3A A;  3HPI A;  4ELO A;  2HEU A;  3SES A;  1B58 A;  4N6P A;  1FTK A;  3R7X A;  3RPW A;  3IOU A;  2REJ A;  5TPA B;  1M5C A;  1GTK A;  3FJG A;  2DP8 A;  4OEV A;  1JW5 A;  3RY3 A;  4P0G A;  5EYF A;  1POT A;  3MP8 A;  2VOZ A;  1IEJ A;  1LAG E;  1B4Z A;  3CFX A;  2F36 A;  2Z23 A;  3GLB A;  3KGC A;  4R73 A;  4H5G A;  4DCX A;  1IXH A;  3RNN A;  1NKX A;  3P7I A;  2ONS A;  4P0I A;  4G77 A;  4OFL A;  5K2X A;  4IO4 A;  1B5H A;  1M5E A;  4OEU A;  4PQJ A;  3HCQ A;  5L9M A;  2ZNT A;  5H8F B;  4XIG Q;  3TDJ A;  1MY4 A;  2YPN A;  2F5X A;  5F7V A;  1MPD A;  2RCA A;  1QVS A;  3N6U A;  2VHA A;  1DPE A;  3FAT A;  3OOA A;  5AA1 A;  3C32 A;  5JTY B;  4G4P A;  5DYH A;  1D3K A;  2OLB A;  4OFO A;  4RK2 A;  1B7Z A;  4OWD A;  4F1V A;  1TWY A;  2HZL A;  5I59 B;  2PMS A;  1MY2 A;  1IIT A;  5CI5 A;  4OES A;  3WAF A;  1MXW A;  1OMP A;  1ZMG A;  3K2D A;  4MFI A;  4R74 A;  2XHD A;  4BDO A;  3TTR A;  4MH5 A;  1LFH A;  4NF5 B;  1NFT A;  1BIY A;  1NL5 A;  2H9B A;  1XVX A;  2QMX A;  4RXL A;  3K6X A;  3ZKK A;  2ONK E;  3C31 A;  4GOT A;  4QFP A;  3CG1 A;  3E13 X;  1A54 A;  2Y7K A;  3IL1 B;  4R2B A;  4EQ7 A;  5AA2 D;  5IAI A;  3MVY A;  3PV0 E;  3PPQ A;  2FA7 A;  3K4U A;  1OQH A;  3KJT A;  4JBZ A;  5AA4 B;  3N26 A;  1MH3 A;  2RC8 A;  4ZEF A;  2B3B A;  1QKA A;  4HCW A;  2F78 A;  1WDN A;  1QUJ A;  4DXB A;  3VVF A;  1GR2 A;  3B6W A;  4THI A;  1SW2 A;  2BJJ X;  1S9T A;  3MJN A;  1YTV A;  4ZZE A;  3TTK A;  2V84 A;  4R6H A;  3PMW A;  4TQU Q;  5HBC A;  4F1U A;  4R72 A;  3KSX A;  3O9P A;  1LAF E;  3MPK A;  1TFA A;  2HAU A;  2I6E A;  5I2N A;  3RT8 A;  1FTM A;  2OZZ A;  5LOM A;  2I48 A;  1MQH A;  2XXV A;  3MC2 A;  1IXI A;  1P1W A;  1FTJ A;  3DP8 A;  4G68 B;  2HXW A;  5I58 A;  1JVY A;  1FQE A;  3IOV A;  4KD5 A;  4X1B A;  4AQ4 A;  3CG3 A;  3OEM A;  1B5I A;  3O28 A;  2DWH A;  3D4C A;  4Q0C A;  1OIB A;  3U8Q A;  4LQ2 A;  5I56 B;  1N0T A;  3QIM A;  3EHT A;  3LR1 A;  3PMX A;  4DDD A;  2A5T B;  2DWJ A;  3G3I A;  2DVZ A;  2I4B A;  5H8H B;  1XVY A;  1PB8 A;  3EF7 A;  1R9Q A;  3VVE A;  4ESW A;  4PP0 A;  2V25 A;  3RT6 B;  2QS2 A;  5J1D A;  1A7L A;  2H5Y A;  2Q2C A;  3GXA A;  4YMA A;  2OWT A;  3SDF A;  1OLC A;  3QSL A;  4PFY A;  1Y1Z A;  2HFB A;  2ESN A;  4OXV A;  3QK6 A;  5H8N A;  2NUV A;  5L8D A;  2F7C A;  3MQ9 A;  3EPE A;  2O84 X;  3ZS6 A;  4DCY A;  3S9E A;  3DLN A;  3K02 A;  3KN3 A;  5KCJ A;  3B7D A;  2DYX A;  3R6U A;  1BTJ A;  3OO8 A;  3PD9 A;  4YMB A;  5CM6 A;  2Q88 A;  2Q9T A;  2O7I A;  1B3F A;  1N84 A;  2O68 A;  2QSX A;  3ILT B;  1KWH A;  3KN7 A;  4U23 A;  3QUF A;  3RTW B;  1XC1 A;  3K0V A;  4YB5 A;  3IOR A;  5JK4 A;  4I9D A;  4IY6 A;  5FTI A;  2AL4 A;  4FEB A;  4KYE A;  5EHM A;  3N5L A;  4WED A;  4NF6 B;  3OO6 A;  3K6V A;  4KPT A;  4RK9 A;  3ZKL A;  4EF1 A;  2VD2 A;  1B52 A;  3MVW A;  1JW1 A;  2G29 A;  2H25 A;  3D4G A;  4R75 A;  3T22 A;  5KDT B;  1US4 A;  4BDN A;  3VDF A;  1HSJ A;  4KFQ A;  4EXL A;  3I6V A;  4LP2 B;  4ELR A;  3Q25 A;  1ZTY A;  3UN6 A;  3CIJ A;  3IAZ A;  4LAT A;  4Z0I A;  3B6T A;  4JXI A;  2CMO A;  5I59 A;  2UVG A;  5KZT A;  2P2A A;  1D4N A;  3BKI B;  4GIZ A;  4K3F A;  1MPC A;  4ZE8 A;  5JTY A;  1PDA A;  2V93 A;  3FD3 A;  4BDR A;  3DP6 A;  3E4R A;  2FNC A;  4RYA A;  1J1N A;  1PBQ A;  3H3G A;  3FAS A;  4WKM A;  3TQW A;  1N7W A;  4ELQ A;  2OCU A;  5AA3 A;  1RYX A;  4YU0 A;  3IOT A;  2NXO A;  2ZYM A;  2X7P A;  4F19 A;  4GXA A;  3TKD A;  2ALU A;  3TZA A;  2M8C A;  4DZ1 A;  3Q27 A;  3TUS A;  4YKI A;  4R6K A;  3IB2 A;  3ONM A;  4HTG A;  3PU5 A;  2I0B A;  4GQO A;  3MW0 A;  2Z22 A;  3E3K A;  4QRZ A;  4YB7 A;  2W7Y A;  4RA1 A;  2DS9 A;  3G3H A;  3OD7 A;  1B32 A;  3CR9 A;  4RPN A;  2ZMB A;  2ONR A;  4UA8 A;  3VLU A;  5CRY A;  4AB5 A;  3CSG A;  4OER A;  3TEP A;  1NMU A;  1XHY A;  2F7A A;  1PBP A;  3V89 B;  2YLN A;  1B46 A;  2DVC A;  2FYI A;  2PYY A;  1PC3 A;  3VE1 B;  4GD5 A;  3KOT A;  1XS5 A;  1YCJ A;  4IY5 A;  3T9U A;  1FCK A;  1BP5 A;  1S50 A;  4LON B;  1JQF A;  3U72 A;  5CBS A;  5ICQ A;  2ANJ A;  3R26 A;  3LSL A;  2HQ0 A;  1SVX B;  2ZYN A;  4NE4 A;  4KCD A;  1MXV A;  3KG2 A;  4UAC A;  2XXU A;  2Z8F A;  3G3F A;  4LUB A;  3M3F A;  3TTN A;  1IXC A;  4EQ9 A;  5HM4 B;  4U1O A;  1LCF A;  3USD A;  4EXK A;  1B0L A;  1MM6 A;  4R2F A;  3TQL A;  3JV9 A;  4NF8 A;  1MQI A;  3S9L C;  1NNT A;  3KFM A;  4YKP A;  3LUY A;  3VLW A;  1Y20 A;  3O29 A;  4GL0 A;  3H06 B;  3QYT A;  4OYV A;  3TEL A;  5M2V A;  2Q89 A;  1JET A;  3OEK A;  1SI1 A;  1B3H A;  4F3B A;  3I3V A;  4GLI A;  4F22 A;  4PFW A;  3V83 A;  2F8D A;  3M8U A;  1TFD A;  3TFL A;  2F34 A;  1H3D A;  4NF5 A;  4ONY A;  1A40 A;  3W9W A;  3A3U A;  4DXC A;  1PB9 A;  1BKA A;  3FVN A;  1O7T A;  2I49 A;  3TOD A;  2RC7 A;  2QS3 A;  1FTL A;  4NWC A;  4YKK A;  4IO6 A;  1UTB B;  4G8M A;  2Q2A A;  3K6U A;  4IGR A;  4EF2 A;  1P1O A;  5H8Q A;  4YIC A;  1B05 A;  3C35 A;  3FVO A;  3FXQ A;  4GL8 A;  2PT2 A;  1D9V A;  1MXY A;  4IO2 A;  1JVX A;  1I6A A;  1LGB C;  2H98 A;  3QXM A;  2UYE A;  1Z7N E;  1NNK A;  3PPP A;  5I84 A;  4QSC A;  4IGT A;  1MQJ A;  3IB1 A;  3JZJ A;  2E1S A;  3KOS A;  4H67 A;  4KHZ E;  4OEN A;  4F2O A;  5I2K A;  3MP1 A;  1Q1K A;  3PUZ E;  2OJT A;  2UXA A;  3PGF A;  1MRP A;  2XD3 A;  2E0S A;  4M4G A;  5H8S A;  4ZEB A;  3MUQ A;  2GH9 A;  3C4M A;  4TLM B;  5DVF A;  1SW5 A;  3V8X B;  3FXR A;  4U22 A; 
#chains in the Genus database with same CATH topology
 3A09 A;  3EKI A;  1H76 A;  4DIG A;  1BLF A;  4MNI A;  4XF5 A;  4GWU A;  3OEN A;  1B4H A;  2UVJ A;  4G68 C;  3C36 A;  3G3J A;  4QFL A;  2RKM A;  5IZ1 A;  2ABH A;  2P0S A;  3LC8 A;  4N4U A;  2DWA A;  3ISP A;  1EZO A;  4YB6 A;  4ZEK A;  1VFD A;  4ESX A;  2R9J A;  2A5S A;  2UVI A;  2DXR A;  3RQT A;  1B9J A;  4NF4 A;  1B40 A;  4H8J A;  1IZ1 A;  4XKQ A;  4N6D A;  3BBR A;  3T9H B;  1JP4 A;  5IZ3 B;  1MXU A;  2AIX A;  1MQD A;  2REG A;  4N81 A;  2RIN A;  3Q26 A;  4NHB A;  4RJZ A;  1RKM A;  1IQ7 A;  4N07 A;  4O8M A;  5EQ9 A;  1FBP A;  3KC0 A;  3T9V A;  1JEV A;  4PF8 A;  4FOR A;  5AA4 A;  4U2R A;  1SYH A;  1AOV A;  1FPB A;  4NF6 A;  4HE2 A;  3UA8 A;  3E78 A;  3LSF B;  2R71 A;  3TCG A;  2WX9 A;  1H45 A;  2HAV A;  5H8F A;  5A5X A;  5HPQ A;  2QJE A;  2F97 A;  3FVK A;  1PEB A;  2A5T A;  1VE4 A;  4FED A;  4U1Z A;  2GRV A;  4P11 A;  1A8E A;  2V4C A;  3OSQ A;  2ZNS A;  4PDH A;  1RDZ A;  5I7I A;  3PUX E;  3H6W A;  2Q8J A;  4FAT A;  1ELJ A;  1I6Q A;  3T9X B;  4OHN A;  1IMC A;  1M5B A;  2QS4 A;  5DW8 A;  4JB7 A;  2Q8M A;  1NV6 A;  5CC2 A;  4KQP A;  4ZDM A;  4OVT A;  4QSE A;  3C9H A;  1FQB A;  4F31 B;  1UIU A;  1ZKB A;  3K1M A;  4U21 A;  1FQD A;  1MY0 A;  3FGS A;  4U4X A;  2XXH A;  1FQC A;  5ESY A;  1SD3 A;  1NH8 A;  5I3S A;  1TXF A;  2QVU A;  1URD A;  3N94 A;  1R9L A;  4X48 A;  3K1N A;  2XA5 A;  1ANF A;  3K1P A;  5CMC A;  2ZYK A;  2F35 A;  5CMB A;  3T1B A;  3HO7 A;  1HSE A;  4GWZ A;  1N76 A;  1Y3Q A;  3ZSF A;  1IMD A;  1N3X A;  3B6Q A;  3QUJ A;  3FZV A;  1SW4 A;  3C34 A;  4YZZ A;  5ITO A;  1URG A;  4DI4 B;  3D1R A;  4JSO A;  2HCA A;  2MKZ A;  4LZ7 A;  3FV1 A;  2PFZ A;  1EZ9 A;  3Q28 A;  2PCR A;  1LAH E;  5ITP A;  1FBE A;  4ZE9 A;  3PPR A;  2QVV A;  4N13 A;  5KCJ B;  3JYR A;  3FJ7 A;  1NV7 A;  4MCO A;  2DE2 A;  4NMY A;  3N6T A;  4FBP A;  4Z7E A;  3ODB A;  2XXW A;  2XX8 A;  2RF1 A;  1IXG A;  3OO9 A;  3KEI A;  4GX3 A;  4QHQ A;  1FPK A;  1G0I A;  3S9N C;  4ECF A;  4H6D A;  3VV5 A;  3C33 A;  5EYH A;  2ZYO A;  4KCC A;  2Z8E A;  5IKB A;  3T93 B;  3TMG A;  1ZLQ A;  2VPN A;  2H99 A;  1B3L A;  1LAX A;  1JEU A;  4Q30 B;  4WXJ A;  4BDQ A;  4QFK A;  3PUV E;  5I57 B;  2VD3 A;  5EQ7 A;  3HPI A;  2FIE A;  1POT A;  3MP8 A;  1LAG E;  3CFX A;  3KGC A;  4R73 A;  2CEX A;  1IXH A;  3RNN A;  4PFB A;  2WBB A;  4MNP A;  5K2X A;  4C0R A;  1B5H A;  4OEU A;  2HHM A;  3NOH A;  4P1L A;  5IZ3 A;  3C32 A;  4G4P A;  4UAB A;  1TWY A;  2HZL A;  1IIT A;  4OES A;  3WAF A;  1MXW A;  3K2D A;  4MFI A;  1LFH A;  2XHD A;  3TTR A;  4MH5 A;  4NF5 B;  1NL5 A;  3K6X A;  2Y7K A;  5IAI A;  3PV0 E;  1G0H A;  2B3B A;  4HCW A;  3VVF A;  1GR2 A;  3MST A;  2V84 A;  5HBC A;  4F1U A;  2HXR A;  3O9P A;  3MPK A;  1TFA A;  1DCU A;  3RT8 A;  2QFL A;  3MC2 A;  3DP8 A;  4G68 B;  4KXP A;  3IOV A;  3OEM A;  2DWH A;  1IMB A;  1N0T A;  3QIM A;  3EF7 A;  4ESW A;  4G61 A;  2Q2C A;  1EYI A;  4YMA A;  1OLC A;  1LBY A;  5L8D A;  2NUV A;  4N8G A;  1BK4 A;  1FSA A;  3KN7 A;  2O7I A;  1N84 A;  4YB5 A;  3ROJ A;  1FPI A;  2AL4 A;  4GX4 A;  3N5L A;  4OVQ A;  4WED A;  3MVW A;  1JW1 A;  2G29 A;  3T22 A;  1FPG A;  3VDF A;  3CIJ A;  4LAT A;  2XWO A;  4BDR A;  4RYA A;  3TQW A;  1J1N A;  1N7W A;  4ELQ A;  1RYX A;  1NV4 A;  2M8C A;  4R6K A;  4HTG A;  2I0B A;  3MW0 A;  2Z22 A;  3OD7 A;  1SPI A;  1B46 A;  4GD5 A;  3T9U A;  1S50 A;  1JQF A;  2HQ0 A;  4NE4 A;  2Z8F A;  3G3F A;  3M3F A;  1LCF A;  3JV9 A;  1NNT A;  4GL0 A;  3H06 B;  5J16 A;  2Q89 A;  4F3B A;  3LV0 A;  4PFW A;  1TFD A;  3A3U A;  4DXC A;  3TOD A;  2RC7 A;  4NWC A;  1UTB B;  4PGP A;  3FXQ A;  4IO2 A;  5EYG A;  2H98 A;  1Z7N E;  1NNK A;  3PPP A;  4IGT A;  5IZZ A;  3KOS A;  3JZJ A;  1K9Z A;  3MP1 A;  2OJT A;  4O94 A;  1MRP A;  1NUZ A;  2XD3 A;  2ZZX A;  5DVF A;  3B50 A;  4U22 A;  2QL3 A;  4PTK A;  2WKY A;  4BLA A;  3EHS A;  4ELP A;  3U1O A;  2O1L A;  2V3Q A;  1GVC A;  1NUY A;  1SW1 A;  2PT1 A;  1LFG A;  1Y4T A;  5CMK A;  2B4M A;  3KBR A;  3MVX A;  4QF9 A;  5B70 A;  1EU8 A;  5I57 A;  2OK2 A;  3TTL A;  4PE5 B;  5CBR A;  4XKP A;  3I5O A;  1Y4C A;  3G3G A;  1N04 A;  1DMB A;  1MDQ A;  4POX A;  1USY H;  4LA9 A;  5IGA A;  4TOZ A;  3RPL B;  3DP4 A;  3G3K A;  1Q35 A;  1URS A;  4QFN A;  1AIV A;  4JWY A;  4PFI A;  4MJO A;  5L9S A;  4ZS9 A;  4GRK A;  1AL3 A;  3Q29 A;  1QUK A;  4F39 A;  4NAP A;  1FPD A;  4MF3 A;  3KZG A;  1VDW A;  3OO7 A;  4LZ8 A;  4QFO A;  4OZ9 A;  4PDD A;  2LAO A;  2VP1 A;  3UIF A;  3U93 A;  3K00 A;  3H7M A;  1T0K A;  3CHG A;  4LVQ A;  4GBV A;  1GGG A;  5I2N B;  4IO7 A;  3MBP A;  4MLV A;  3LSW A;  3OSR A;  1B7H A;  1EH3 A;  3O6I A;  1ZJL A;  3SEW A;  3TYH A;  1SI0 A;  3BFT A;  1FPL A;  5DT6 A;  1LB9 A;  4XTC Q;  2Z8D A;  1H43 A;  4ZZA A;  1JW4 A;  5TP9 B;  3O66 A;  3GBB A;  4OMB A;  1LEV A;  3L6H A;  4ZED A;  5L9O A;  3IO4 A;  1LFI A;  4POW A;  2D21 A;  4XKR A;  3IB0 A;  2O69 A;  3BFU A;  1B3G A;  3K6W A;  1B51 A;  5KDT A;  3HHF A;  1VSO A;  1LBC A;  1MS7 A;  5AE4 A;  3F11 A;  3RN8 A;  2Y5L A;  5B7D A;  3UK4 A;  4NF8 B;  2PVU A;  4ZEI A;  3THI A;  5ET7 A;  2DWI A;  1LCT A;  4YKJ A;  4DXU A;  1H44 A;  3TCH A;  1MXX A;  2UYF A;  3FIR A;  1M5F A;  3VXC A;  2G93 A;  1MY1 A;  5K2Y A;  2D5W A;  4OTE A;  1N7X A;  3SEY A;  4F1Y A;  1EYJ A;  4WEP A;  1FPF A;  1LLS A;  4H0W A;  1FQF A;  1POY 1;  1QKB A;  1CB6 A;  4XFE A;  1B7U A;  1MH4 A;  1IUD A;  1II5 A;  4H5F A;  3RTF B;  1ZIU A;  1LBV A;  4BDL A;  3TPA A;  2PBW A;  4P56 A;  4TLL B;  3O97 A;  1EZP A;  4ISU A;  4Q8R A;  1EYK A;  1B1H A;  4IO3 A;  5JEI A;  5ET6 A;  1A8F A;  1B2H A;  1IME A;  3IOW A;  1MPB A;  2IA4 A;  4P1E A;  2HPG A;  1CE2 A;  1DTZ A;  2X7Q A;  4E0W A;  1NH7 A;  2ZXT A;  4PFT A;  4G8N A;  4GWO A;  1DBZ A;  4RY1 A;  3GBA A;  3FXB A;  4O3C A;  1XT8 A;  4AS4 A;  4Q5T A;  4H45 A;  2XD2 A;  3GYY A;  1DOT A;  1Y3P A;  1FJ6 A;  2OWZ A;  2THI A;  1MDP 1;  4MIJ A;  4OFJ A;  4NG7 A;  2Y7W A;  1Y3N A;  3PMV A;  2F7B A;  3VLV A;  1YYZ A;  2OBG A;  1FRP A;  1UQW A;  3UP9 A;  4KYS A;  3SES A;  1B58 A;  4N6P A;  3R7X A;  3RPW A;  5TPA B;  1M5C A;  1GTK A;  4P0G A;  2F36 A;  1NKX A;  3P7I A;  1Q9D A;  4OFL A;  1M5E A;  5L9M A;  3HCQ A;  1MY4 A;  2RCA A;  5AA1 A;  1DPE A;  3OOA A;  1D3K A;  4RK2 A;  4OFO A;  3SZP A;  4OWD A;  2PMS A;  1MY2 A;  5CI5 A;  1ZMG A;  1NFT A;  1XVX A;  4PCD A;  3ZKK A;  4OVP A;  4GOT A;  4QFP A;  5AA2 D;  4EQ7 A;  4GBW A;  3PPQ A;  3N26 A;  1QUJ A;  3B6W A;  1S9T A;  4N8Y A;  1AWB A;  4TQU Q;  1LAF E;  2I6E A;  4OA4 A;  1FTM A;  5LOM A;  1MQH A;  2XXV A;  1P1W A;  1FTJ A;  1JVY A;  3O28 A;  3D4C A;  3U8Q A;  3EHT A;  2A5T B;  3G3I A;  2QS2 A;  2DDK A;  1A7L A;  4PFY A;  5H8N A;  4OXV A;  3ZS6 A;  2F7C A;  4DCY A;  3DLN A;  3K02 A;  3R6U A;  3OO8 A;  5FTI A;  4FEB A;  4KYE A;  5EHM A;  3OO6 A;  3K6V A;  4RK9 A;  3D4G A;  2H25 A;  4R75 A;  1US4 A;  4EXL A;  3B6T A;  4K3F A;  5JTY A;  2V93 A;  3E4R A;  4WKM A;  3FAS A;  2OCU A;  1LBZ A;  2NXO A;  4F19 A;  2X7P A;  3TKD A;  2ALU A;  1XI6 A;  4YKI A;  4MX6 A;  3IB2 A;  3PU5 A;  4RPN A;  2ZMB A;  4OER A;  5A5L A;  1NMU A;  2F7A A;  2DVC A;  2WYK A;  1FCK A;  1BP5 A;  4LON B;  2GQ1 A;  3U72 A;  5CBS A;  2ANJ A;  3R26 A;  4NGU A;  5LDZ A;  1SVX B;  2ZYN A;  4PBH A;  4KCD A;  2XXU A;  3TTN A;  4O7M A;  1IXC A;  2KR0 A;  3TQL A;  1MM6 A;  3S9L C;  1YXI A;  1Y20 A;  3TEL A;  4OYV A;  1NV5 A;  1KA0 A;  1JET A;  3OEK A;  3V83 A;  1CNQ A;  4ONY A;  3W9W A;  1PB9 A;  1BKA A;  3FVN A;  2QS3 A;  1NV0 A;  3QMF A;  4IO6 A;  4G8M A;  4IGR A;  1P1O A;  1B05 A;  2PT2 A;  1D9V A;  1I6A A;  1RDY A;  4N6K A;  5I84 A;  2OX3 A;  4QSC A;  1MQJ A;  4OEN A;  2E1S A;  4KHZ E;  3PUZ E;  4M4G A;  2GH9 A;  1SW5 A;  2NWJ A;  2H4I A;  5FBP A;  4GX6 A;  4EQB A;  4OET A;  2O1M A;  3SEV A;  5FHO A;  1RDX A;  4H65 A;  4AB6 A;  4OAN A;  1USY E;  2XXP A;  1YPN A;  2Y7R A;  2GFE A;  3CI8 A;  5ISU A;  2ZNU A;  1QJM A;  1AH5 A;  1O64 A;  3IR1 A;  3PD8 A;  4KYD A;  3S2V A;  1S7Y A;  1TT1 A;  4OVJ A;  3RGY A;  4EUO A;  4MMP A;  1R6Z A;  5FTH A;  3DEL B;  1MG1 A;  1B6H A;  1JNF A;  3PTY A;  4N91 A;  4HE1 A;  2O51 A;  4NTL A;  2CZH A;  1UTH A;  5CMM A;  5EQ8 A;  1NV3 A;  4PE3 A;  1P99 A;  4KI0 E;  2KLF A;  4F18 A;  1OQG A;  1UTB A;  3FVG A;  4PBQ A;  1FPJ A;  1DTG A;  1Y9U A;  5TPA A;  3MPL A;  4GWS A;  3HHG A;  1OLA A;  2DOJ A;  4PFU A;  2VGQ A;  3DM0 A;  3H6V A;  1GV8 A;  1MY3 A;  1B3E A;  2NOO A;  3MWB A;  2D3I A;  3MZ1 A;  3PUW E;  3IK6 B;  3M3K A;  4O3B A;  2YJP A;  4G68 A;  3W15 C;  2AL5 A;  3FJM A;  1Z7M E;  3G7W A;  4QSD A;  2XXT A;  4JWX A;  4C1T A;  4P3L A;  3KJ7 A;  4E0X A;  5DEX A;  1LBB A;  1N3W A;  3EHU A;  2QPQ A;  3CVG A;  3T66 A;  1VFE A;  4XKN A;  4NED A;  4F3S A;  3UN6 A;  2CZI A;  3KBZ A;  1NI9 A;  3CRB A;  4FE8 A;  2O6A A;  2FHY A;  3OMB A;  3PUY E;  1NNP A;  4NF0 A;  4JDF A;  1FQA A;  4R9F A;  4FJP A;  2XXK A;  3V5A A;  4I1D A;  3HFU A;  3VXB A;  2I3V A;  4BDM A;  4F2Q A;  2Y7P A;  4NQ8 A;  4IR8 A;  2R6G E;  1P1U A;  1NUX A;  3T96 B;  5BWJ A;  3K01 A;  3O6G A;  4KR5 A;  1FBC A;  1SQY A;  1P1Q A;  4IO5 A;  2NVU B;  3H03 A;  2B65 A;  4OVS A;  3IX1 A;  2DXY A;  4EDP A;  1QGX A;  4LZ5 A;  2FIX A;  1VR5 A;  2PX1 A;  3IO6 A;  5I59 A;  3EQ1 A;  4G8H A;  4R9G A;  4H46 A;  1L5T A;  1FW0 A;  1UTH B;  1ZU0 A;  4PC9 A;  4IB2 A;  3MVZ A;  4GVO A;  1INP A;  3A3C A;  4I3E A;  4F3P A;  4NX1 A;  2WBD A;  3H4Z A;  2F6P A;  4H1X A;  3GZG A;  1NNF A;  2ZZW A;  3SER A;  3IJX B;  4H8I A;  3BIG A;  3PPO A;  3TAJ A;  5A5X B;  4YAH X;  4HW8 A;  4I3Y A;  4MAG A;  1I6B A;  4XXU A;  2F6G A;  2F3D A;  2F3B A;  2XX9 A;  3RLF E;  3FXU A;  5TU0 A;  4FAJ A;  2V3T A;  3W9V A;  3O2A A;  5DVJ A;  3E9X A;  4HCY A;  4ELO A;  3IFC A;  2HEU A;  1FTK A;  3IOU A;  2REJ A;  3FJG A;  4OEV A;  3RY3 A;  5EYF A;  3GLB A;  2Z23 A;  2JJK A;  2Y5K A;  2ONS A;  4G77 A;  2ZNT A;  2F5X A;  1MPD A;  1QVS A;  2VHA A;  5JTY B;  5DYH A;  5IM2 A;  4R74 A;  4BDO A;  1NV1 A;  4HE0 A;  2H9B A;  3IL1 B;  1A54 A;  2CZK A;  2FA7 A;  3K4U A;  3KJT A;  5AA4 B;  1MH3 A;  4ZEF A;  1QKA A;  2F78 A;  1WDN A;  2BJJ X;  2VT5 A;  1YTV A;  4ZZE A;  3TTK A;  5LTC A;  5I2N A;  2OZZ A;  2I48 A;  5I58 A;  4AQ4 A;  1FQE A;  4X1B A;  3CG3 A;  4Q0C A;  4LQ2 A;  3PMX A;  4DDD A;  2XWI A;  2DWJ A;  2I4B A;  5H8H B;  1XVY A;  1PB8 A;  4PP0 A;  2V25 A;  4JVD A;  3RT6 B;  4P9K A;  2OWT A;  3SDF A;  1Y1Z A;  3WAE A;  3E79 A;  3S9E A;  3MQ9 A;  3EPE A;  5KCJ A;  3B7D A;  1BTJ A;  4YMB A;  4THI A;  5ELV A;  2O68 A;  3ILT B;  4U23 A;  1KWH A;  3RTW B;  3QUF A;  1XC1 A;  3IOR A;  5JK4 A;  4I9D A;  4NF6 B;  3ZKL A;  4KPT A;  4EF1 A;  2VD2 A;  5KDT B;  4BDN A;  3I6V A;  4N17 A;  4ELR A;  3Q25 A;  1ZTY A;  3IAZ A;  4JXI A;  2CMO A;  2UVG A;  5KZT A;  2P2A A;  3BKI B;  4GIZ A;  4MEV A;  4ZE8 A;  3DP6 A;  1LBW A;  1PBQ A;  3H3G A;  4YU0 A;  3IOT A;  4GXA A;  3TZA A;  4DZ1 A;  3Q27 A;  3TUS A;  3ONM A;  4GQO A;  4QRZ A;  3E3K A;  4YB7 A;  4RA1 A;  2DS9 A;  3G3H A;  2ONR A;  3VLU A;  3CSG A;  3TEP A;  1XHY A;  3VE1 B;  4IY5 A;  1XS5 A;  1YCJ A;  4GWW A;  5ICQ A;  3LSL A;  1YZ0 A;  3KG2 A;  4UAC A;  4LUB A;  4EQ9 A;  4U1O A;  1B0L A;  1MQI A;  3KFM A;  4YKP A;  3VLW A;  5M2V A;  1SI1 A;  2VPO A;  3I3V A;  4F22 A;  3M8U A;  2F34 A;  4NF5 A;  4LN5 A;  1O7T A;  2I49 A;  4PAF A;  1FTL A;  1LBX A;  2Q2A A;  4EF2 A;  5H8Q A;  4YIC A;  1JVX A;  1LGB C;  2XWV A;  3IB1 A;  5I2K A;  4ZEB A;  4TLM B;  1K9Y A;  3V8X B;  3FXR A;  3CFL A;  3VFJ A;  2P3N A;  3ILU B;  2OWS A;  4X8R A;  1FBG A;  1FTA A;  4XEQ A;  1KZ8 A;  3BIH A;  4QBA A;  1QUL A;  1MM7 A;  2O7U A;  1DK4 A;  1I69 A;  5T3J A;  4MNC A;  1DSN A;  4PET A;  5ICT A;  2I0C A;  2XXR A;  2IEE A;  3MP6 A;  1OVB A;  2FVZ A;  3KN8 A;  2I3W A;  1MXZ A;  1DPP A;  2DSF A;  3EN3 A;  1PB7 A;  3MZ9 A;  5ET8 A;  2XXQ A;  4JVC A;  2R8T A;  3TTM A;  1IMA A;  3HST A;  3UOR A;  5DVI A;  3MZB A;  4M1V A;  2QS1 A;  3FUZ A;  1US5 A;  3MAM A;  3AXF A;  3SEX A;  1F9B A;  5AA2 B;  1A55 A;  4FEC A;  2GHB A;  1ATG A;  2AYS A;  5I56 A;  4X9T A;  4HXV A;  3RUM A;  3UGW A;  4DE8 A;  5H8N B;  3CSB A;  2DE3 A;  1UIV A;  2Y7I A;  2FBP A;  5ET5 A;  1WOD A;  1NV2 A;  1HSL A;  1FTO A;  3H6T A;  1FJ9 A;  4L17 A;  4ND9 A;  4GWY A;  4P8B A;  3VVD A;  5EQA A;  3OEL A;  1Y1M A;  4U4S A;  5H8H A;  1AMF A;  4MBP A;  3KSJ A;  4R6Y A;  1O63 A;  4GFR A;  1NUW A;  2GHA A;  4MHF A;  2HZK A;  3IJO B;  1B0H A;  4PGN A;  1B1X A;  1D9Q A;  5H8Q B;  3H6U A;  4GWX A;  2I4C A;  4NWD A;  3S4U A;  2B3F A;  3FV2 A;  1ZBM A;  1P1N A;  3SET A;  2Y84 A;  3HV1 A;  1LB8 A;  4FIM A;  5EHS A;  2XXX A;  1A99 A;  3S9M C;  1LST A;  1QW0 A;  1IMF A;  2L5V A;  1B5J A;  1YAE A;  4RPO A;  5FHM A;  3SEU A;  2KQZ A;  3U92 A;  3HN0 A;  4NN3 A;  1SBP A;  4MLQ A;  2XX7 A;  3CFZ A;  2DQV A;  4I8C A;  1M5D A;  2BJI A;  2UVH A;  3M3L A;  2ZZV A;  2I58 A;  2P1S A;  3T0J A;  2RC9 A;  2CEY A;  2QRY A;  3PPN A;  4X1D A;  2QMW A;  4JWO A;  1FBH A;  5F1Q A;  2XXI A;  2DE4 A;  4DLD A;  4G2Z A;  5AA2 A;  2QVR A;  1MQG A;  1R1N A;  2CZL A;  2P3V A;  1WVJ A;  5FHN A;  4C1U A;  1D9Y A;  4HS7 A;  5BUU A;  3TCF A;  4ZEC A;  3U94 A;  5DEX B;  4F29 A;  3QAX A;  5I2K B;  5DTB A;  2RCB A;  4NF4 B;  1OVT A;  3ECR A;  1SYI A;  3LBS A;  1IIW A;  4GXS B;  4RNS A;  1QUI A;  4OQO A;  4GF8 A;  1SDX A;  5I58 B;  4AS5 A;  3OXN A;  4LQ5 A;  4F3G A;  2X26 A;  4JVI A;  3O6H A;  5TP9 A;  4N15 A;  4JSD A;  2XXY A;  4I62 A;  1XOC A;  2V3U A;  1RYO A;  3L6G A;  3LSX A;  2WYP A;  4O3A A;  2DP8 A;  1JW5 A;  2VOZ A;  1IEJ A;  1B4Z A;  4DCX A;  4H5G A;  4P0I A;  3SKP A;  5F24 A;  4IO4 A;  4PQJ A;  5H8F B;  4XIG Q;  3TDJ A;  2YPN A;  4PF6 A;  5F7V A;  3N6U A;  3FAT A;  1FBD A;  2OLB A;  1B7Z A;  4F1V A;  5I59 B;  1OMP A;  1FPE A;  1BIY A;  2QMX A;  4RXL A;  3MYU A;  2ONK E;  3C31 A;  3CG1 A;  3E13 X;  4R2B A;  3MVY A;  4JBZ A;  1OQH A;  2RC8 A;  2XWK A;  4DXB A;  1SW2 A;  4QXD A;  3MJN A;  3RPL A;  4R6H A;  3PMW A;  4R72 A;  3KSX A;  2HAU A;  3B8B A;  2B4L A;  1IXI A;  2WEF A;  2HXW A;  4O7I A;  3LUZ A;  4KD5 A;  1B5I A;  1OIB A;  5I56 B;  3LR1 A;  2DVZ A;  1R9Q A;  3VVE A;  3RYD A;  5J1D A;  2H5Y A;  3GXA A;  3QSL A;  4AB5 A;  2HFB A;  2ESN A;  3QK6 A;  2O84 X;  3KN3 A;  2DYX A;  3PD9 A;  5CM6 A;  2Q88 A;  2Q9T A;  1B3F A;  2QSX A;  4P47 A;  3K0V A;  4IY6 A;  1B52 A;  4X04 A;  1HSJ A;  4KFQ A;  4LP2 B;  4Z0I A;  1D4N A;  4I40 A;  1MPC A;  1PDA A;  4PFR A;  3FD3 A;  2FNC A;  5AA3 A;  5I5P A;  2ZYM A;  2PFY A;  2Q74 A;  3A29 A;  2W7Y A;  3FBP A;  1B32 A;  3CR9 A;  4UA8 A;  5CRY A;  3V89 B;  1PBP A;  2YLN A;  2FYI A;  2PYY A;  1PC3 A;  3KOT A;  3IFA A;  1MXV A;  5HM4 B;  3USD A;  4EXK A;  4R2F A;  4DI3 D;  4NF8 A;  3LUY A;  3O29 A;  3QYT A;  3U65 A;  1KA1 A;  1B3H A;  4GLI A;  4PAI A;  2F8D A;  3TFL A;  1H3D A;  1A40 A;  4PAK A;  4YKK A;  4OVR A;  1FBF A;  3K6U A;  3FVO A;  3C35 A;  4GL8 A;  3KC1 A;  1MXY A;  3QXM A;  2UYE A;  4H67 A;  4F2O A;  1Q1K A;  2UXA A;  3PGF A;  5H8S A;  2E0S A;  3MUQ A;  3C4M A; 
#chains in the Genus database with same CATH homology
 3CFL A;  2NWJ A;  2H4I A;  2QL3 A;  3A09 A;  3VFJ A;  2WKY A;  4BLA A;  3EHS A;  3ILU B;  2OWS A;  1H76 A;  4DIG A;  4ELP A;  4EQB A;  1BLF A;  3U1O A;  2O1L A;  3OEN A;  4OET A;  1QUL A;  2V3Q A;  1B4H A;  1GVC A;  1MM7 A;  1SW1 A;  2O7U A;  1I69 A;  2O1M A;  2UVJ A;  4G68 C;  1DSN A;  4PET A;  2PT1 A;  1LFG A;  5ICT A;  1Y4T A;  3SEV A;  5CMK A;  3MVX A;  3KBR A;  2I0C A;  4QF9 A;  5FHO A;  2XXR A;  5B70 A;  3C36 A;  3G3J A;  2IEE A;  1EU8 A;  3MP6 A;  4QFL A;  2RKM A;  4H65 A;  4AB6 A;  2ABH A;  2P0S A;  3LC8 A;  5I57 A;  2DWA A;  2OK2 A;  1OVB A;  3KN8 A;  1EZO A;  4YB6 A;  3TTL A;  4PE5 B;  2I3W A;  5CBR A;  1USY E;  2XXP A;  1MXZ A;  4ZEK A;  4XKP A;  3I5O A;  1Y4C A;  1DPP A;  2DSF A;  3EN3 A;  1N04 A;  3G3G A;  1DMB A;  1PB7 A;  1VFD A;  3MZ9 A;  4ESX A;  1MDQ A;  4POX A;  1YPN A;  1USY H;  4LA9 A;  2R9J A;  2A5S A;  2GFE A;  2DXR A;  2UVI A;  2Y7R A;  2ZNU A;  1QJM A;  1B9J A;  3CI8 A;  3DP4 A;  2XXQ A;  3SKP A;  1AH5 A;  4NF4 A;  3TTM A;  1O64 A;  3G3K A;  3IR1 A;  3PD8 A;  4KYD A;  3S2V A;  1B40 A;  1S7Y A;  3HST A;  1TT1 A;  3UOR A;  4H8J A;  5DVI A;  4OVJ A;  3RGY A;  1IZ1 A;  1Q35 A;  1URS A;  4QFN A;  3MZB A;  4M1V A;  3WAE A;  4EUO A;  1AIV A;  2QS1 A;  4JWY A;  3FUZ A;  1US5 A;  3MAM A;  4XKQ A;  3AXF A;  4ZS9 A;  4GRK A;  3SEX A;  1F9B A;  5AA2 B;  5L9S A;  1A55 A;  1R6Z A;  3BBR A;  4FEC A;  5FTH A;  1AL3 A;  1ATG A;  2GHB A;  2AYS A;  3T9H B;  3DEL B;  3Q29 A;  5I56 A;  1MG1 A;  1B6H A;  4X9T A;  1JNF A;  1MXU A;  2AIX A;  1QUK A;  4F39 A;  2O51 A;  1MQD A;  4NTL A;  2REG A;  1UTH A;  5CMM A;  3RUM A;  2RIN A;  3UGW A;  4MF3 A;  4DE8 A;  3KZG A;  5H8N B;  3Q26 A;  3OO7 A;  4LZ8 A;  1P99 A;  3CSB A;  2DE3 A;  4RJZ A;  1RKM A;  1UIV A;  4KI0 E;  1IQ7 A;  2KLF A;  4N07 A;  4OZ9 A;  2Y7I A;  4QFO A;  4F18 A;  2LAO A;  1OQG A;  1UTB A;  2VP1 A;  3FVG A;  3UIF A;  3T9V A;  1JEV A;  1WOD A;  3U93 A;  4FOR A;  1GV8 A;  1DTG A;  3K00 A;  1Y9U A;  5AA4 A;  5TPA A;  4U2R A;  1SYH A;  1HSL A;  1FTO A;  1AOV A;  3H7M A;  4NF6 A;  3MPL A;  1T0K A;  4LVQ A;  1GGG A;  3HHG A;  1OLA A;  3H6T A;  4IO7 A;  3UA8 A;  5I2N B;  2DOJ A;  3MBP A;  2VGQ A;  4PFU A;  4MLV A;  3LSW A;  3OSR A;  3DM0 A;  1B7H A;  1EH3 A;  3H6V A;  1MY3 A;  3LSF B;  3O6I A;  1ZJL A;  4L17 A;  1B3E A;  2NOO A;  2R71 A;  3MWB A;  4ND9 A;  2D3I A;  3MZ1 A;  3SEW A;  1H45 A;  2HAV A;  3TCG A;  1SI0 A;  3TYH A;  3PUW E;  5H8F A;  5A5X A;  3VVD A;  3OEL A;  5HPQ A;  2QJE A;  2F97 A;  3IK6 B;  3BFT A;  3FVK A;  1Y1M A;  4U4S A;  3M3K A;  4O3B A;  1PEB A;  5DT6 A;  2A5T A;  1LB9 A;  1VE4 A;  4FED A;  2YJP A;  4XTC Q;  2Z8D A;  1H43 A;  4U1Z A;  4G68 A;  5H8H A;  4ZZA A;  1JW4 A;  2GRV A;  1AMF A;  4P11 A;  3W15 C;  1A8E A;  5TP9 B;  2AL5 A;  3O66 A;  4MBP A;  3GBB A;  3OSQ A;  4OMB A;  2ZNS A;  3FJM A;  3KSJ A;  4R6Y A;  1O63 A;  1Z7M E;  3L6H A;  4GFR A;  4ZED A;  3G7W A;  5L9O A;  3IO4 A;  4QSD A;  1LFI A;  2GHA A;  4POW A;  2HZK A;  3IJO B;  1B0H A;  2XXT A;  3PUX E;  2D21 A;  4JWX A;  4C1T A;  3H6W A;  2Q8J A;  1B1X A;  3KJ7 A;  4E0X A;  5H8Q B;  5DEX A;  1LBB A;  1ELJ A;  4FAT A;  3H6U A;  1I6Q A;  2I4C A;  4NWD A;  4OHN A;  4XKR A;  1N3W A;  3T9X B;  3EHU A;  3S4U A;  1M5B A;  2QPQ A;  2QS4 A;  2B3F A;  3FV2 A;  1ZBM A;  3CVG A;  3IB0 A;  2O69 A;  3BFU A;  4JB7 A;  1B3G A;  3K6W A;  3T66 A;  1B51 A;  5KDT A;  1P1N A;  1VFE A;  4XKN A;  5CC2 A;  4KQP A;  4ZDM A;  3HHF A;  4NED A;  3SET A;  4F3S A;  1VSO A;  2Y84 A;  1LBC A;  1LB8 A;  3HV1 A;  4FIM A;  1MS7 A;  2XXX A;  3C9H A;  4QSE A;  5EHS A;  1A99 A;  1FQB A;  5AE4 A;  4F31 B;  3S9M C;  3CRB A;  3F11 A;  1LST A;  3RN8 A;  1QW0 A;  4FE8 A;  1UIU A;  1ZKB A;  5B7D A;  3UK4 A;  4NF8 B;  2PVU A;  2O6A A;  1B5J A;  3K1M A;  1YAE A;  1FQD A;  1MY0 A;  3FGS A;  4RPO A;  4U21 A;  4U4X A;  5FHM A;  4ZEI A;  2XXH A;  3THI A;  1FQC A;  3OMB A;  3PUY E;  2DWI A;  1LCT A;  3SEU A;  1NNP A;  1NH8 A;  1SD3 A;  4YKJ A;  4JDF A;  1FQA A;  4R9F A;  1TXF A;  4FJP A;  1URD A;  3V5A A;  3N94 A;  1R9L A;  4X48 A;  3K1N A;  3U92 A;  3HN0 A;  4DXU A;  4I1D A;  1H44 A;  1SBP A;  3TCH A;  1ANF A;  3K1P A;  4MLQ A;  2XX7 A;  3VXB A;  1MXX A;  2I3V A;  2UYF A;  3FIR A;  4BDM A;  4C0R A;  3CFZ A;  1M5F A;  5CMC A;  4F2Q A;  2Y7P A;  2DQV A;  4I8C A;  3VXC A;  1M5D A;  2G93 A;  2ZYK A;  2F35 A;  1MY1 A;  2UVH A;  3M3L A;  5K2Y A;  2D5W A;  2R6G E;  4OTE A;  1N7X A;  1P1U A;  2I58 A;  2P1S A;  5CMB A;  3RQT A;  3SEY A;  3T96 B;  4F1Y A;  2RC9 A;  3HO7 A;  2QRY A;  3PPN A;  1HSE A;  5BWJ A;  1N76 A;  4WEP A;  4X1D A;  3K01 A;  1LLS A;  2QMW A;  1Y3Q A;  4H0W A;  3O6G A;  4JWO A;  4KR5 A;  3ZSF A;  5F1Q A;  2XXI A;  1FQF A;  1P1Q A;  1POY 1;  1SQY A;  2DE4 A;  4IO5 A;  2NVU B;  1N3X A;  1QKB A;  1CB6 A;  2B65 A;  3B6Q A;  3H03 A;  3IX1 A;  4DLD A;  3QUJ A;  2DXY A;  4G2Z A;  3FZV A;  1SW4 A;  3C34 A;  1MQG A;  4YZZ A;  1B7U A;  1R1N A;  4LZ5 A;  5ITO A;  4EDP A;  5AA2 A;  1URG A;  2CZL A;  1MH4 A;  1VR5 A;  1IUD A;  1II5 A;  2PX1 A;  3IO6 A;  1WVJ A;  1ZIU A;  3EQ1 A;  4H5F A;  2HCA A;  4JSO A;  3RTF B;  5FHN A;  4BDL A;  3TPA A;  4G8H A;  2PBW A;  4LZ7 A;  4R9G A;  3FV1 A;  4C1U A;  1L5T A;  1FW0 A;  1D9Y A;  4TLL B;  1UTH B;  3O97 A;  1ZU0 A;  4HS7 A;  5BUU A;  1EZ9 A;  1EZP A;  5ISU A;  3TCF A;  4ISU A;  3Q28 A;  4Q8R A;  1B1H A;  1LAH E;  5ITP A;  4IB2 A;  3MVZ A;  4IO3 A;  4GVO A;  4ZE9 A;  3A3C A;  3PPR A;  4F3P A;  4ZEC A;  5JEI A;  4N13 A;  5KCJ B;  3JYR A;  3U94 A;  5DEX B;  4F29 A;  3QAX A;  1A8F A;  3FJ7 A;  5I2K B;  1B2H A;  3H4Z A;  3IOW A;  1MPB A;  2DE2 A;  5DTB A;  2IA4 A;  4NMY A;  2RCB A;  3N6T A;  1CE2 A;  2F6P A;  4NF4 B;  4Z7E A;  1DTZ A;  2X7Q A;  3ODB A;  2XXW A;  4E0W A;  1NH7 A;  2ZXT A;  2XX8 A;  4PFT A;  1OVT A;  3ECR A;  1SYI A;  2RF1 A;  4G8N A;  3GZG A;  1IIW A;  3LBS A;  4GWO A;  4GXS B;  4H1X A;  1IXG A;  4RNS A;  3OO9 A;  3GBA A;  1NNF A;  3KEI A;  4RY1 A;  1QUI A;  3SER A;  3IJX B;  1XT8 A;  3PPO A;  4H8I A;  4O3C A;  4OQO A;  4QHQ A;  4GF8 A;  4YAH X;  3TAJ A;  4Q5T A;  5A5X B;  1SDX A;  2XD2 A;  5I58 B;  3S9N C;  3OXN A;  4LQ5 A;  4H6D A;  4ECF A;  3VV5 A;  4F3G A;  1DOT A;  3C33 A;  4HW8 A;  1Y3P A;  2THI A;  2ZYO A;  1MDP 1;  4OFJ A;  2X26 A;  2Y7W A;  1Y3N A;  2Z8E A;  3PMV A;  4KCC A;  1I6B A;  2F7B A;  4XXU A;  3VLV A;  3O6H A;  5TP9 A;  2OBG A;  2F6G A;  4JSD A;  5IKB A;  3T93 B;  4TOZ A;  3TMG A;  1ZLQ A;  2XXY A;  1UQW A;  2H99 A;  1B3L A;  4I62 A;  1LAX A;  1JEU A;  2XX9 A;  1XOC A;  4Q30 B;  2V3U A;  3FXU A;  5TU0 A;  3RLF E;  4FAJ A;  3UP9 A;  2V3T A;  4WXJ A;  1RYO A;  3L6G A;  4BDQ A;  3LSX A;  3W9V A;  3O2A A;  5ELV A;  4QFK A;  3PUV E;  5DVJ A;  5I57 B;  3E9X A;  2VD3 A;  4HCY A;  4KYS A;  4O3A A;  3HPI A;  4ELO A;  2HEU A;  3SES A;  1B58 A;  4N6P A;  1FTK A;  3R7X A;  3RPW A;  3IOU A;  2REJ A;  5TPA B;  1M5C A;  1GTK A;  3FJG A;  2DP8 A;  4OEV A;  1JW5 A;  3RY3 A;  4P0G A;  5EYF A;  1POT A;  3MP8 A;  2VOZ A;  1IEJ A;  1LAG E;  1B4Z A;  3CFX A;  2F36 A;  2Z23 A;  3GLB A;  3KGC A;  4R73 A;  4H5G A;  4DCX A;  1IXH A;  3RNN A;  1NKX A;  3P7I A;  2ONS A;  4P0I A;  4G77 A;  4OFL A;  5K2X A;  4IO4 A;  1B5H A;  1M5E A;  4OEU A;  4PQJ A;  3HCQ A;  5L9M A;  2ZNT A;  5H8F B;  4XIG Q;  3TDJ A;  1MY4 A;  2YPN A;  2F5X A;  5F7V A;  1MPD A;  2RCA A;  1QVS A;  3N6U A;  2VHA A;  1DPE A;  3FAT A;  3OOA A;  5AA1 A;  3C32 A;  5JTY B;  4G4P A;  5DYH A;  1D3K A;  2OLB A;  4OFO A;  4RK2 A;  1B7Z A;  4OWD A;  4F1V A;  1TWY A;  2HZL A;  5I59 B;  2PMS A;  1MY2 A;  1IIT A;  5CI5 A;  4OES A;  3WAF A;  1MXW A;  1OMP A;  1ZMG A;  3K2D A;  4MFI A;  4R74 A;  2XHD A;  4BDO A;  3TTR A;  4MH5 A;  1LFH A;  4NF5 B;  1NFT A;  1BIY A;  1NL5 A;  2H9B A;  1XVX A;  2QMX A;  4RXL A;  3K6X A;  3ZKK A;  2ONK E;  3C31 A;  4GOT A;  4QFP A;  3CG1 A;  3E13 X;  1A54 A;  2Y7K A;  3IL1 B;  4R2B A;  4EQ7 A;  5AA2 D;  5IAI A;  3MVY A;  3PV0 E;  3PPQ A;  2FA7 A;  3K4U A;  1OQH A;  3KJT A;  4JBZ A;  5AA4 B;  3N26 A;  1MH3 A;  2RC8 A;  4ZEF A;  2B3B A;  1QKA A;  4HCW A;  2F78 A;  1WDN A;  1QUJ A;  4DXB A;  3VVF A;  1GR2 A;  3B6W A;  4THI A;  1SW2 A;  2BJJ X;  1S9T A;  3MJN A;  1YTV A;  4ZZE A;  3TTK A;  2V84 A;  4R6H A;  3PMW A;  4TQU Q;  5HBC A;  4F1U A;  4R72 A;  3KSX A;  3O9P A;  1LAF E;  3MPK A;  1TFA A;  2HAU A;  2I6E A;  5I2N A;  3RT8 A;  1FTM A;  2OZZ A;  5LOM A;  2I48 A;  1MQH A;  2XXV A;  3MC2 A;  1IXI A;  1P1W A;  1FTJ A;  3DP8 A;  4G68 B;  2HXW A;  5I58 A;  1JVY A;  1FQE A;  3IOV A;  4KD5 A;  4X1B A;  4AQ4 A;  3CG3 A;  3OEM A;  1B5I A;  3O28 A;  2DWH A;  3D4C A;  4Q0C A;  1OIB A;  3U8Q A;  4LQ2 A;  5I56 B;  1N0T A;  3QIM A;  3EHT A;  3LR1 A;  3PMX A;  4DDD A;  2A5T B;  2DWJ A;  3G3I A;  2DVZ A;  2I4B A;  5H8H B;  1XVY A;  1PB8 A;  3EF7 A;  1R9Q A;  3VVE A;  4ESW A;  4PP0 A;  2V25 A;  3RT6 B;  2QS2 A;  5J1D A;  1A7L A;  2H5Y A;  2Q2C A;  3GXA A;  4YMA A;  2OWT A;  3SDF A;  1OLC A;  3QSL A;  4PFY A;  1Y1Z A;  2HFB A;  2ESN A;  4OXV A;  3QK6 A;  5H8N A;  2NUV A;  5L8D A;  2F7C A;  3MQ9 A;  3EPE A;  2O84 X;  3ZS6 A;  4DCY A;  3S9E A;  3DLN A;  3K02 A;  3KN3 A;  5KCJ A;  3B7D A;  2DYX A;  3R6U A;  1BTJ A;  3OO8 A;  3PD9 A;  4YMB A;  5CM6 A;  2Q88 A;  2Q9T A;  2O7I A;  1B3F A;  1N84 A;  2O68 A;  2QSX A;  3ILT B;  1KWH A;  3KN7 A;  4U23 A;  3QUF A;  3RTW B;  1XC1 A;  3K0V A;  4YB5 A;  3IOR A;  5JK4 A;  4I9D A;  4IY6 A;  5FTI A;  2AL4 A;  4FEB A;  4KYE A;  5EHM A;  3N5L A;  4WED A;  4NF6 B;  3OO6 A;  3K6V A;  4KPT A;  4RK9 A;  3ZKL A;  4EF1 A;  2VD2 A;  1B52 A;  3MVW A;  1JW1 A;  2G29 A;  2H25 A;  3D4G A;  4R75 A;  3T22 A;  5KDT B;  1US4 A;  4BDN A;  3VDF A;  1HSJ A;  4KFQ A;  4EXL A;  3I6V A;  4LP2 B;  4ELR A;  3Q25 A;  1ZTY A;  3UN6 A;  3CIJ A;  3IAZ A;  4LAT A;  4Z0I A;  3B6T A;  4JXI A;  2CMO A;  5I59 A;  2UVG A;  5KZT A;  2P2A A;  1D4N A;  3BKI B;  4GIZ A;  4K3F A;  1MPC A;  4ZE8 A;  5JTY A;  1PDA A;  2V93 A;  3FD3 A;  4BDR A;  3DP6 A;  3E4R A;  2FNC A;  4RYA A;  1J1N A;  1PBQ A;  3H3G A;  3FAS A;  4WKM A;  3TQW A;  1N7W A;  4ELQ A;  2OCU A;  5AA3 A;  1RYX A;  4YU0 A;  3IOT A;  2NXO A;  2ZYM A;  2X7P A;  4F19 A;  4GXA A;  3TKD A;  2ALU A;  3TZA A;  2M8C A;  4DZ1 A;  3Q27 A;  3TUS A;  4YKI A;  4R6K A;  3IB2 A;  3ONM A;  4HTG A;  3PU5 A;  2I0B A;  4GQO A;  3MW0 A;  2Z22 A;  3E3K A;  4QRZ A;  4YB7 A;  2W7Y A;  4RA1 A;  2DS9 A;  3G3H A;  3OD7 A;  1B32 A;  3CR9 A;  4RPN A;  2ZMB A;  2ONR A;  4UA8 A;  3VLU A;  5CRY A;  4AB5 A;  3CSG A;  4OER A;  3TEP A;  1NMU A;  1XHY A;  2F7A A;  1PBP A;  3V89 B;  2YLN A;  1B46 A;  2DVC A;  2FYI A;  2PYY A;  1PC3 A;  3VE1 B;  4GD5 A;  3KOT A;  1XS5 A;  1YCJ A;  4IY5 A;  3T9U A;  1FCK A;  1BP5 A;  1S50 A;  4LON B;  1JQF A;  3U72 A;  5CBS A;  5ICQ A;  2ANJ A;  3R26 A;  3LSL A;  2HQ0 A;  1SVX B;  2ZYN A;  4NE4 A;  4KCD A;  1MXV A;  3KG2 A;  4UAC A;  2XXU A;  2Z8F A;  3G3F A;  4LUB A;  3M3F A;  3TTN A;  1IXC A;  4EQ9 A;  5HM4 B;  4U1O A;  1LCF A;  3USD A;  4EXK A;  1B0L A;  1MM6 A;  4R2F A;  3TQL A;  3JV9 A;  4NF8 A;  1MQI A;  3S9L C;  1NNT A;  3KFM A;  4YKP A;  3LUY A;  3VLW A;  1Y20 A;  3O29 A;  4GL0 A;  3H06 B;  3QYT A;  4OYV A;  3TEL A;  5M2V A;  2Q89 A;  1JET A;  3OEK A;  1SI1 A;  1B3H A;  4F3B A;  3I3V A;  4GLI A;  4F22 A;  4PFW A;  3V83 A;  2F8D A;  3M8U A;  1TFD A;  3TFL A;  2F34 A;  1H3D A;  4NF5 A;  4ONY A;  1A40 A;  3W9W A;  3A3U A;  4DXC A;  1PB9 A;  1BKA A;  3FVN A;  1O7T A;  2I49 A;  3TOD A;  2RC7 A;  2QS3 A;  1FTL A;  4NWC A;  4YKK A;  4IO6 A;  1UTB B;  4G8M A;  2Q2A A;  3K6U A;  4IGR A;  4EF2 A;  1P1O A;  5H8Q A;  4YIC A;  1B05 A;  3C35 A;  3FVO A;  3FXQ A;  4GL8 A;  2PT2 A;  1D9V A;  1MXY A;  4IO2 A;  1JVX A;  1I6A A;  1LGB C;  2H98 A;  3QXM A;  2UYE A;  1Z7N E;  1NNK A;  3PPP A;  5I84 A;  4QSC A;  4IGT A;  1MQJ A;  3IB1 A;  3JZJ A;  2E1S A;  3KOS A;  4H67 A;  4KHZ E;  4OEN A;  4F2O A;  5I2K A;  3MP1 A;  1Q1K A;  3PUZ E;  2OJT A;  2UXA A;  3PGF A;  1MRP A;  2XD3 A;  2E0S A;  4M4G A;  5H8S A;  4ZEB A;  3MUQ A;  2GH9 A;  3C4M A;  4TLM B;  5DVF A;  1SW5 A;  3V8X B;  3FXR A;  4U22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...