2A5TA

Crystal structure of the nr1/nr2a ligand-binding cores complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
284
structure length
271
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-methyl-D-aspartate receptor NMDAR1-4a subunit
publication title Subunit arrangement and function in NMDA receptors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport,membrane protein
total genus 79
structure length 271
sequence length 284
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2a5tA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2a5tA02
3BKIB 4PP0A 3PPQA 3G7WA 3E9XA 1IQ7A 1FCKA 1OQHA 3U94A 3K02A 5HPQA 2LAOA 4GWOA 2I6EA 1JEVA 2GH9A 5TPAB 4HTGA 3VV5A 1HSJA 2FYIA 2X7QA 4FIMA 4NF5B 4ZEFA 4JBZA 3PPNA 2Z8EA 3O66A 3ECRA 5ELVA 3B7DA 5CC2A 3TQLA 3VLVA 2Q8JA 2XXPA 4F3SA 2XXQA 4YICA 3RTWB 3JV9A 2R71A 4FORA 1FQAA 1N3WA 5AA3A 3T93B 2F78A 4DLDA 5KCJA 2PVUA 5KDTA 1FQBA 5H8FB 1NNFA 5I58A 2VOZA 4IY6A 4C1UA 3MP1A 5DTBA 2A5TA 3ZKLA 1B32A 1MM6A 2M8CA 1N0TA 4WXJA 1PB8A 2CMOA 1MXWA 1Y20A 2NVUB 1Y9UA 1NFTA 2DWAA 1JETA 3WAFA 3M3FA 1SI1A 2GHBA 3G3IA 1VE4A 2PX1A 1LB9A 3SDFA 3IOUA 1LAGE 3SEXA 4U22A 4XIGQ 4NWCA 1FQEA 3G3HA 4LATA 4OHNA 1MQDA 1O64A 3TKDA 1DTGA 4QFOA 1VFEA 3IORA 3HN0A 5J1DA 4ZEDA 3HV1A 4JWOA 5F1QA 1IITA 3PGFA 2IA4A 1EZPA 1UTBB 4BDQA 3HO7A 2ANJA 1B4HA 2XX8A 4YZZA 4XKQA 1JW4A 1POTA 2HQ0A 3PUZE 1GV8A 3RTFB 4IGTA 4F1YA 4QFKA 1OVBA 5I57B 2HCAA 3TMGA 1XHYA 4GOTA 1R9QA 2F7BA 1P1QA 2ZMBA 3K6UA 4FECA 5ICQA 1QUIA 1A8EA 3C36A 3K0VA 4ZS9A 1NH7A 3W9WA 4ELRA 1LLSA 1MDP1 4FJPA 2XX7A 2H9BA 2DOJA 3F11A 4JWYA 1MPCA 3K01A 5AA2A 2W7YA 1PDAA 4HS7A 3U1OA 5TP9A 3K4UA 1FTJA 4OFOA 3CG3A 3U92A 1POY1 3C35A 4OTEA 1SI0A 3K6VA 4N6PA 4H5GA 3K1PA 5LOMA 2B3BA 3QYTA 1ZMGA 2HXWA 3FJMA 3JZJA 4X1BA 4IO5A 3FASA 1S7YA 4U4XA 2XX9A 3FGSA 5B70A 5JTYA 4NF8B 1XOCA 1SYIA 2ZXTA 3FZVA 3KZGA 2Y7IA 1LFHA 1XVYA 5I59B 2DVCA 4YKJA 3T9UA 1MM7A 4GD5A 3WAEA 5ITPA 2O68A 5FHMA 1SW4A 2VD2A 4IY5A 4WEPA 1US4A 4OWDA 4WKMA 1TT1A 4KCDA 5BWJA 2H98A 4N07A 2QRYA 3GXAA 1PC3A 4R2FA 3K1NA 5CBRA 3K1MA 3T96B 2OBGA 3TPAA 1WDNA 2DWJA 4X48A 4ESXA 1B4ZA 4F3PA 3LSWA 1B51A 2UVJA 3HCQA 3MWBA 1A54A 4RK9A 1B46A 4OMBA 2QS2A 4E0XA 1HSLA 4BDRA 2REGA 1JQFA 4FEDA 4YB7A 1N04A 3C33A 1R6ZA 3T9XB 1ZTYA 1I6QA 2QMWA 3KG2A 3UN6A 4EDPA 1M5FA 2Q2CA 1MQIA 3SEUA 4PFYA 2V3QA 1IXIA 3M3KA 1AOVA 4NMYA 1OQGA 4ELPA 3OSRA 1XS5A 1LAXA 1MQHA 3QXMA 3VE1B 2PT2A 3SKPA 4JB7A 1QJMA 4H65A 4ZECA 3DP4A 3Q29A 4NEDA 2ZYMA 2AIXA 3I5OA 4ZEKA 5H8HA 5I56A 4O3BA 3AXFA 3Q25A 4NF4B 1URGA 4KFQA 3PV0E 3FD3A 5L8DA 4IO7A 4M4GA 4YKKA 3N6TA 1Y1ZA 3ZS6A 1EZOA 1B0HA 1N84A 4BDOA 1IXGA 5ICTA 1KWHA 3CVGA 4EF1A 3IO6A 4X1DA 1OMPA 4MLQA 4R6YA 4RNSA 3RPWA 1JW1A 3MZ9A 3KJTA 3KEIA 3OXNA 3H6UA 2Z8FA 3QUJA 1Q1KA 1N3XA 3O2AA 5I2KB 3FXRA 4R9GA 1FQFA 1B7UA 4PETA 5A5XA 1VR5A 3HHGA 1URSA 3DP8A 1M5BA 3VVFA 3PUWE 1B3FA 4G8MA 5HM4B 1B7ZA 3IOVA 3FVNA 3VVDA 4EQ7A 2I49A 4KHZE 3GBBA 5DEXB 3T66A 3RQTA 2UYEA 3E13X 1IXHA 3TDJA 3O6HA 4DCXA 5HBCA 1WVJA 1MY3A 5EHSA 3LC8A 3H7MA 4WEDA 1YPNA 1F9BA 4KQPA 3D4GA 3TYHA 4LQ5A 3FVGA 4R72A 3GLBA 3ONMA 1LBBA 3MW0A 4OESA 5DYHA 4F18A 3H6TA 2I3WA 1MXYA 4BDLA 3MPLA 1QULA 3EHSA 4H8IA 1RYOA 1B3GA 2V3UA 3UP9A 2Q2AA 2Q9TA 4LVQA 2F34A 1GR2A 1EU8A 1ZJLA 4FATA 1I69A 2DE4A 4GL0A 3V8XB 2G29A 1D3KA 3B6WA 1US5A 4KYDA 2A5SA 2B65A 1GVCA 1P1NA 3KSXA 1FW0A 3E3KA 5I2NB 3OO8A 4LQ2A 1OIBA 1TFAA 1A7LA 1B40A 1Y1MA 3C4MA 4JSDA 2I3VA 3HPIA 1H3DA 3PU5A 2DQVA 2XXYA 5H8QA 1SD3A 3FXQA 2YJPA 2HZKA 1AMFA 1UQWA 1NMUA 2UXAA 1YAEA 1JVXA 1SDXA 3I3VA 4K3FA 3FIRA 3VFJA 1B2HA 1JVYA 2XD2A 5EHMA 4U1OA 1B5HA 3OOAA 2F97A 1O7TA 4PE5B 2X26A 5IKBA 3EQ1A 2I48A 3S9NC 1UTBA 3LBSA 4P11A 1P99A 2D3IA 1OVTA 3MC2A 2F7AA 4U23A 4LA9A 4LONB 2VP1A 5L9SA 3IB2A 5AA2D 1DSNA 4PFTA 1I6AA 1NNTA 4H0WA 4G4PA 4KYEA 4G68C 4DCYA 3SEVA 1UTHB 5BUUA 3SERA 2QPQA 4ISUA 3MJNA 4UACA 1NL5A 4QF9A 1EZ9A 3KJ7A 4OETA 3OENA 4QSDA 1URDA 1B7HA 1CE2A 4M1VA 1CB6A 3SESA 3M8UA 4U4SA 3PPOA 1ZKBA 5KCJB 3ODBA 4GXAA 3KBRA 3DP6A 5KDTB 5I58B 2H25A 2Q89A 3A3UA 2A5TB 1JW5A 4KR5A 4RY1A 4JDFA 5DT6A 3HHFA 3IR1A 3H4ZA 3O97A 4ONYA 3LUYA 4JXIA 1QKBA 1NNPA 1TWYA 3CR9A 4XKNA 1B3LA 2HFBA 3K6WA 1NNKA 2ZYKA 3TZAA 4OQOA 5H8NA 2NWJA 5B7DA 4QHQA 2Y7KA 3TUSA 3SEWA 1H43A 3Q28A 3OEKA 3MVYA 4XTCQ 5JEIA 4FE8A 5DVJA 3TCFA 2UVHA 4ELQA 1ZU0A 1RKMA 2QL3A 3KN3A 1N7WA 5AA1A 1SW5A 3QK6A 4GRKA 5K2YA 1B52A 3TTNA 1ANFA 3S2VA 1ZBMA 4O3AA 1DPPA 4JSOA 2XXVA 3K6XA 3FUZA 4OYVA 3PD8A 5CM6A 2DXYA 1FQDA 1SVXB 2RC7A 2V3TA 4FAJA 3IB0A 4H6DA 2O69A 3QSLA 3RGYA 1YTVA 4R9FA 2RF1A 4HCWA 3UGWA 3RN8A 3UIFA 3H06B 4PQJA 4H67A 1H76A 4OERA 4R73A 2Y7RA 5L9OA 3BBRA 3N26A 2ZYOA 2HAVA 3FV2A 4YMAA 1BKAA 1DMBA 2DS9A 3T9VA 4DDDA 5AA2B 4F1VA 4HW8A 2OZZA 2O51A 2FA7A 5TP9B 1PEBA 2RKMA 3LSLA 2G93A 4MFIA 4P0GA 1MXUA 3E4RA 5CI5A 4RYAA 1VFDA 3MBPA 2QSXA 2ZNUA 3LR1A 4Q30B 3O6IA 3KSJA 4GF8A 1B1XA 1QKAA 1MXZA 2QS3A 1O63A 1XVXA 5ISUA 1Y3NA 3V89B 1PBPA 1S9TA 4RPOA 5FHNA 4QRZA 2R6GE 1MRPA 4QSCA 4EXKA 2OWTA 2V93A 4G68A 1MG1A 1B05A 1MY0A 3KOTA 4QFNA 4JWXA 1S50A 5JTYB 5K2XA 4F29A 4LZ7A 1FTMA 3G3FA 3T22A 1AL3A 2XXUA 4ZE8A 4F1UA 4KD5A 4TLMB 3IL1B 3PUXE 1IXCA 3OO6A 1A40A 4EXLA 3RY3A 3CFLA 2XXWA 3C34A 4AB5A 5H8SA 3R26A 4DIGA 2ZNSA 2HAUA 1MDQA 4YKIA 3EHTA 4NF6A 3M3LA 3R6UA 4F19A 4F2OA 2I0CA 4ZZEA 1NH8A 1QUJA 3Q27A 3LSXA 5M2VA 3OELA 1LSTA 1J1NA 3FATA 1Q35A 3DELB 5AA4B 2IEEA 3PUYE 3N94A 4E0WA 2UYFA 2Y7PA 2P0SA 5FTIA 4ZDMA 3FXUA 2VGQA 3B6QA 3DLNA 2O6AA 1UIVA 3PD9A 3VXCA 4N13A 3T9HB 3RNNA 4KPTA 4HCYA 2O84X 2I58A 4EQBA 2O7UA 1YCJA 2F35A 1OLCA 4RJZA 4YMBA 1FTLA 3H03A 1A99A 4I9DA 4KCCA 2V25A 4MBPA 4POXA 3L6GA 1IIWA 4FEBA 1Y3QA 3VLWA 1P1OA 4NWDA 3EPEA 1BLFA 2F6PA 1PBQA 2AYSA 3PPRA 2Z8DA 2I0BA 1D4NA 5TPAA 1DPEA 3K00A 4NF5A 3O9PA 1SQYA 1XC1A 3EN3A 4U1ZA 4X9TA 3ILUB 1IZ1A 3RLFE 1GGGA 1M5CA 3L6HA 5FHOA 4F22A 1EH3A 4DZ1A 5A5XB 2DXRA 4LZ5A 3EHUA 3W15C 2H5YA 2ALUA 3C9HA 3CI8A 2UVIA 4GXSB 5H8FA 4GIZA 1ZIUA 2OWSA 5CMMA 3TTMA 1WODA 2E0SA 4Z7EA 1H44A 1SYHA 5DVFA 2DSFA 2VHAA 3I6VA 1B5JA 1Y4TA 4G77A 4ELOA 4TOZA 4I1DA 4R6KA 3CFXA 4RA1A 3BFUA 1B1HA 3PMWA 1AH5A 3MAMA 4G2ZA 4AB6A 1B6HA 1A8FA 3MZBA 3G3GA 1LGBC 4U2RA 3ZSFA 1MH3A 3LSFB 1UTHA 1PB7A 5CMCA 3TTRA 3EF7A 2QJEA 2FNCA 4R2BA 3IOTA 1LB8A 1OLAA 3OSQA 3VVEA 1B0LA 3TTKA 4TQUQ 2XXRA 2RC8A 3OMBA 4BLAA 3MPKA 4G8NA 4O3CA 3JYRA 3U93A 1MPDA 1BIYA 4LZ8A 2ZNTA 1MY4A 1L5TA 1JNFA 2Y84A 4YU0A 5CMBA 2DWHA 4DXCA 4MLVA 3MUQA 1B5IA 3O28A 1N7XA 3MVWA 2D21A 1LBCA 4L17A 4YB6A 2XXXA 5I57A 4ECFA 5H8QB 4QFPA 3KN7A 3U72A 4C1TA 2B3FA 2P2AA 1IUDA 3C32A 2ONSA 4RK2A 4ESWA 4MF3A 4EUOA 4H8JA 2DVZA 1M5EA 3TTLA 4R74A 4PFWA 2NXOA 4YAHX 1AIVA 1NKXA 1ELJA 2PT1A 1LCTA 3VXBA 3IJXB 2THIA 2O1MA 3FV1A 4DXUA 3S9MC 4GLIA 3TQWA 1IEJA 4NE4A 2XXHA 4EF2A 2I4CA 3MP6A 2DP8A 5ITOA 3V5AA 4NTLA 1ATGA 3TCGA 4Z0IA 1LAFE 3A09A 3IB1A 3B6TA 1N76A 3PMVA 3CSGA 2Z22A 1P1WA 1I6BA 3U8QA 4TLLB 4RPNA 5CMKA 3IX1A 3QAXA 1SW2A 2GHAA 4MH5A 1Y4CA 3IO4A 2RC9A 4NF8A 3TFLA 3ILTB 1Y3PA 3CIJA 4GFRA 4F3BA 3BFTA 3CRBA 4QSEA 2REJA 1FQCA 5I59A 1TXFA 2P1SA 2KLFA 4I62A 3IAZA 2DYXA 3G3KA 4OFJA 4P0IA 3RUMA 1RYXA 3TELA 5FTHA 1MS7A 3SETA 4ZEIA 5H8NB 2QS4A 1MPBA 1B3EA 2F7CA 4OEUA 1BTJA 4ZEBA 1R9LA 2QMXA 4OEVA 3KOSA 2DE3A 2HEUA 3P7IA 4KI0E 4GL8A 3RT8A 2RCBA 3W9VA 2HZLA 1MXXA 2ESNA 3MVXA 2Z23A 4LP2B 4C0RA 4ZZAA 3GZGA 1GTKA 1B9JA 4F31B 1A55A 1FTKA 1TFDA 2XHDA 4BDNA 2Y7WA 1LCFA 1BP5A 4ND9A 3D4CA 2DE2A 4PFUA 2OCUA 4XXUA 3GBAA 3O29A 2RCAA 3UK4A 3Q26A 4QFLA 4Q8RA 3CFZA 1Z7NE 1LAHE 5TU0A 4IO3A 1D9YA 3IK6B 3H6WA 2R9JA 4IB2A 2RINA 4XKRA 4NF4A 3MP8A 3KFMA 3UORA 2OK2A 1B3HA 2H99A 3PMXA 2F36A 2ONKE 4OZ9A 5CRYA 1QW0A 1MQJA 4H5FA 5AA4A 3MQ9A 4OVJA 4BDMA 3S4UA 2F8DA 1QUKA 4KYSA 2WKYA 3KN8A 3H3GA 3G3JA 4F39A 3OO9A 4R6HA 3QUFA 4IO6A 4OXVA 1T0KA 2QS1A 3ZKKA 4AQ4A 1D9VA 4OFLA 2DWIA 2V84A 2AL4A 1Z7ME 5I2KA 3TEPA 1DOTA 1HSEA 2F5XA 2GRVA 4RXLA 5EYFA 1MXVA 1H45A 3A3CA 3IJOB 4ZE9A 4YKPA 5JK4A 2AL5A 3OD7A 4F2QA 4G68B 3SEYA 3HSTA 3FJ7A 4I8CA 3UA8A 4U21A 3S9LC 3TODA 2BJJX 3OEMA 5DEXA 3FVKA 1VSOA 5IAIA 3MZ1A 2OJTA 1SBPA 3CG1A 5L9MA 4IGRA 4LUBA 2I4BA 2GFEA 2YPNA 2ABHA 2H4IA 3QIMA 1QVSA 2NOOA 4F3GA 1XT8A 3TAJA 2OLBA 3K2DA 3S9EA 1MY1A 1II5A 1USYE 5F7VA 2XXIA 2ZYNA 1LFGA 3R7XA 2YLNA 3CSBA 4NF6B 3FJGA 5H8HB 5I56B 5KZTA 2Q88A 4G8HA 1JEUA 3O6GA 3MVZA 1UIUA 1MQGA 2O7IA 1PB9A 3OO7A 4OENA 2PBWA 1FTOA 3PUVE 3VDFA 4GQOA 4R75A 2X7PA 3TCHA 2UVGA 5I2NA 2CZLA 2XXTA 1R1NA 3PPPA 4EQ9A 3KGCA 5I84A 3H6VA 3USDA 2PYYA 1USYH 1B58A 3IOWA 1ZLQA 5CBSA 4Q0CA 5DVIA 4DE8A 1SW1A 4YB5A 2VD3A 2F6GA 2PMSA 4DXBA 2D5WA 4POWA 3VLUA 1MH4A 3C31A 2XD3A 1DTZA 3RT6B 2ONRA 1MY2A 4XKPA 3DM0A 1M5DA 4GVOA 2O1LA 3THIA 4UA8A 4THIA 4Q5TA 3N6UA 4H1XA 4IO2A 1LFIA 2NUVA 2E1SA 5AE4A 3N5LA 3V83A 4IO4A 1P1UA 3FVOA
chains in the Genus database with same CATH superfamily
1FBEA 3BKIB 4PP0A 3PPQA 3G7WA 3E9XA 1IQ7A 1FCKA 1OQHA 3U94A 3K02A 5HPQA 2LAOA 4GWOA 4NGUA 2I6EA 3PTYA 1JEVA 4MNIA 2GH9A 5TPAB 4HTGA 3VV5A 1HSJA 2FYIA 2X7QA 4FIMA 4NF5B 4ZEFA 4JBZA 3PPNA 2Z8EA 3O66A 3ECRA 5ELVA 3B7DA 3IFCA 5CC2A 3TQLA 3VLVA 2Q8JA 2XXPA 4F3SA 2XXQA 4YICA 3RTWB 3JV9A 2R71A 3BIGA 4FORA 1FQAA 1N3WA 5AA3A 3T93B 2F78A 4DLDA 5KCJA 4PDDA 2PVUA 5KDTA 1FQBA 5H8FB 1NNFA 5I58A 2VOZA 4O94A 4N17A 4IY6A 4C1UA 3MP1A 5DTBA 2A5TA 3ZKLA 1B32A 3RPLB 5ET8A 1MM6A 2M8CA 2P3VA 1N0TA 4WXJA 1PB8A 2CMOA 1MXWA 1Y20A 2NVUB 1LBXA 1IMBA 1Y9UA 1NFTA 2DWAA 1JETA 3WAFA 3M3FA 3MSTA 1SI1A 2GHBA 3G3IA 1VE4A 2PX1A 1LB9A 3SDFA 3IOUA 1LAGE 3SEXA 4U22A 4XIGQ 4NWCA 1FQEA 4LN5A 3G3HA 4LATA 4OHNA 1MQDA 3T1BA 1O64A 2PCRA 3TKDA 1DTGA 4QFOA 1VFEA 4GBWA 3IORA 3HN0A 5J1DA 4ZEDA 3HV1A 4JWOA 5F1QA 1IITA 3PGFA 2IA4A 1EZPA 1UTBB 4P8BA 4BDQA 3HO7A 2ANJA 1B4HA 2XX8A 4YZZA 4XKQA 1JW4A 1INPA 1POTA 2CEXA 2HQ0A 4P56A 3PUZE 1GV8A 3RTFB 4IGTA 4GBVA 4F1YA 4QFKA 1OVBA 5I57B 4P9KA 2HCAA 3TMGA 1XHYA 4GOTA 1R9QA 2F7BA 1P1QA 1Q9DA 2ZMBA 3K6UA 4FECA 5ICQA 1QUIA 1A8EA 3C36A 2Y5LA 3K0VA 4ZS9A 1NH7A 3W9WA 4ELRA 1LLSA 1MDP1 4FJPA 2XX7A 1NV3A 5ET6A 3U65A 2H9BA 2DOJA 3F11A 4JWYA 1MPCA 4PFRA 3B50A 3K01A 5AA2A 2W7YA 1PDAA 4HS7A 3U1OA 4NN3A 5TP9A 3K4UA 3E79A 1FTJA 4OFOA 4PAFA 3CG3A 5ET7A 3U92A 1POY1 3C35A 4OTEA 1SI0A 3K6VA 4N6PA 4H5GA 3K1PA 5LOMA 2B3BA 3QYTA 1ZMGA 2KQZA 4GWUA 4P3LA 2HXWA 3FJMA 3JZJA 4X1BA 4IO5A 3FASA 1S7YA 4U4XA 2XX9A 3B8BA 3FGSA 5B70A 5JTYA 4NF8B 1XOCA 1SYIA 2ZXTA 3FZVA 3KZGA 2Y7IA 1LFHA 4N91A 1XVYA 5I59B 2DVCA 4YKJA 3T9UA 1MM7A 4GD5A 3WAEA 5ITPA 1YYZA 2O68A 5FHMA 1SW4A 2VD2A 4IY5A 4WEPA 4P1LA 1US4A 4XEQA 4OWDA 4WKMA 1TT1A 4KCDA 5BWJA 2H98A 4N07A 2QRYA 4DI3D 3GXAA 1PC3A 4R2FA 1FJ9A 3K1NA 5CBRA 3K1MA 3T96B 2OBGA 5ET5A 3TPAA 1WDNA 2DWJA 4X48A 4ESXA 1B4ZA 4F3PA 3LSWA 1B51A 2UVJA 3HCQA 3MWBA 1A54A 4RK9A 4OA4A 1IMCA 1B46A 4OMBA 2QS2A 4PBQA 4E0XA 1HSLA 4BDRA 2REGA 1JQFA 4FEDA 4YB7A 1N04A 3C33A 1R6ZA 3T9XB 1ZTYA 4NHBA 1I6QA 2QMWA 3KG2A 3UN6A 4EDPA 1M5FA 2Q2CA 1MQIA 3SEUA 4PFYA 2V3QA 1IXIA 3M3KA 4PGPA 1AOVA 4NMYA 1OQGA 4ELPA 3OSRA 1XS5A 1LAXA 1MQHA 3QXMA 4KXPA 1JP4A 3VE1B 2PT2A 2L5VA 3SKPA 4O7MA 4JB7A 1QJMA 4H65A 4ZECA 3DP4A 3Q29A 4NEDA 2ZYMA 2AIXA 3I5OA 5LTCA 4ZEKA 5H8HA 5I56A 4O3BA 1YXIA 3AXFA 4NG7A 3Q25A 1NV5A 4NF4B 1URGA 1KA0A 2QVUA 5J16A 2XWOA 4N6DA 4KFQA 3PV0E 3FD3A 5L8DA 4IO7A 4M4GA 3CHGA 4N6KA 2FIXA 4YKKA 3N6TA 1Y1ZA 3ZS6A 1EZOA 1B0HA 1N84A 4BDOA 1IXGA 5ICTA 2WBBA 1KWHA 3CVGA 4EF1A 3IO6A 4X1DA 1OMPA 4MLQA 4R6YA 4RNSA 3RPWA 4MAGA 1JW1A 3MZ9A 3KJTA 3KEIA 3OXNA 5EQ7A 3H6UA 2Z8FA 3QUJA 5EYGA 1Q1KA 1N3XA 3O2AA 5I2KB 3FXRA 4R9GA 1FQFA 1B7UA 4PETA 3E78A 5A5XA 1VR5A 3HHGA 4X04A 4PAIA 1URSA 3DP8A 1M5BA 3VVFA 3PUWE 1B3FA 4G8MA 4GX3A 5HM4B 1B7ZA 3IOVA 3FVNA 4XF5A 5IZ3A 1IMDA 3VVDA 3LV0A 4EQ7A 2I49A 4KHZE 1LEVA 3GBBA 5DEXB 1G0IA 3T66A 4JVIA 3RQTA 2UYEA 3E13X 1IXHA 3TDJA 3O6HA 4DCXA 4P47A 4PGNA 5HBCA 1WVJA 4PDHA 5F24A 1MY3A 2GQ1A 2VT5A 5EHSA 3LC8A 4NF0A 1G0HA 3H7MA 4WEDA 5DW8A 1DCUA 1YPNA 1F9BA 3KC0A 4KQPA 3D4GA 3TYHA 4LQ5A 4PC9A 4I3YA 3FVGA 5T3JA 4R72A 3GLBA 3ONMA 1LBBA 3MW0A 4OESA 5DYHA 4F18A 3H6TA 2I3WA 1MXYA 4BDLA 3MPLA 1QULA 3EHSA 4H8IA 1RYOA 1B3GA 2V3UA 3UP9A 2Q2AA 2Q9TA 4LVQA 2F34A 1GR2A 1EU8A 1NUZA 1ZJLA 4FATA 1I69A 2DE4A 4GL0A 3V8XB 1FJ6A 2G29A 1D3KA 1FBCA 3B6WA 1US5A 4KYDA 2A5SA 3LUZA 4HE0A 2B65A 1GVCA 1P1NA 3KSXA 1FW0A 3E3KA 5I2NB 3OO8A 4LQ2A 1OIBA 1TFAA 1A7LA 1B40A 1Y1MA 3C4MA 4JSDA 2I3VA 1RDZA 3HPIA 1H3DA 3PU5A 2DQVA 2XXYA 5H8QA 1SD3A 3FXQA 2YJPA 2HZKA 1AMFA 1UQWA 1NMUA 2UXAA 1YAEA 1JVXA 1XI6A 1FPGA 1SDXA 3I3VA 4K3FA 1IMEA 3FIRA 3VFJA 1B2HA 4HE1A 4PFIA 1JVYA 2XD2A 5EHMA 2Q8MA 4U1OA 1B5HA 3OOAA 2F97A 1O7TA 4PE5B 2X26A 5IKBA 3EQ1A 2I48A 3S9NC 5I3SA 1UTBA 3LBSA 4P11A 1P99A 2D3IA 1OVTA 3MC2A 2F7AA 4U23A 4LA9A 4LONB 2VP1A 4H45A 5L9SA 3IB2A 5AA2D 1DSNA 4PFTA 1I6AA 1NNTA 4H0WA 1FPFA 4G4PA 4PBHA 2WYPA 4I40A 2QVVA 4KYEA 4G68C 4DCYA 3SEVA 1UTHB 5BUUA 3SERA 2QPQA 4ISUA 3MJNA 4UACA 1NL5A 4QF9A 1EZ9A 3KJ7A 4OETA 4PAKA 3OENA 4QSDA 1URDA 1B7HA 1CE2A 4M1VA 1CB6A 3SESA 3M8UA 1NV7A 4U4SA 3PPOA 1ZKBA 4GWSA 1KA1A 5KCJB 3ODBA 4GXAA 3KBRA 3DP6A 5KDTB 5I58B 2H25A 2Q89A 3A3UA 2A5TB 1JW5A 4KR5A 1AWBA 4RY1A 4JDFA 5DT6A 2BJIA 4HXVA 1FTAA 3HHFA 3IR1A 3H4ZA 3O97A 2QVRA 4ONYA 3LUYA 1RDXA 4JXIA 1QKBA 1NNPA 1TWYA 2VPNA 3CR9A 4XKNA 1B3LA 2HFBA 3K6WA 1NNKA 2ZYKA 3TZAA 4OQOA 5H8NA 2NWJA 5B7DA 4QHQA 2Y7KA 3TUSA 3SEWA 1H43A 3Q28A 1IMAA 3OEKA 3MVYA 4XTCQ 5JEIA 4FE8A 5DVJA 3TCFA 2UVHA 4UABA 4ELQA 3NOHA 1ZU0A 1RKMA 2QL3A 3KN3A 1N7WA 5AA1A 1SW5A 3QK6A 4GRKA 4H46A 5K2YA 1B52A 3TTNA 1NV0A 1ANFA 2XWIA 3S2VA 1ZBMA 4O3AA 4OVTA 4HE2A 2WX9A 1DPPA 4JSOA 4OVQA 2XXVA 3K6XA 4GWZA 3FUZA 4PCDA 4OYVA 3PD8A 1FBHA 5CM6A 2DXYA 1FQDA 1SVXB 2RC7A 2V3TA 4FAJA 3IB0A 4H6DA 2B4LA 4NAPA 2O69A 3QSLA 1NV4A 3RGYA 1YTVA 4R9FA 2RF1A 4HCWA 3UGWA 3RN8A 3UIFA 3H06B 4PQJA 4H67A 1H76A 4OERA 4R73A 2Y7RA 5L9OA 3BBRA 3GYYA 3N26A 2ZYOA 2HAVA 3FV2A 4N4UA 4YMAA 1BKAA 1DMBA 2DS9A 3T9VA 4DDDA 5AA2B 4F1VA 4HW8A 2OZZA 2O51A 3EKIA 2FA7A 5TP9B 1PEBA 4PF8A 2RKMA 1DBZA 5LDZA 3LSLA 2G93A 4MFIA 4P0GA 4OVPA 1MXUA 1FPJA 4GWYA 3E4RA 5CI5A 4RYAA 1VFDA 4FBPA 3MBPA 2QSXA 2ZNUA 5EQ8A 4OVRA 3LR1A 4Q30B 3O6IA 3KSJA 4GF8A 1B1XA 1QKAA 1MXZA 2KR0A 2QS3A 1O63A 1XVXA 5ISUA 1Y3NA 3V89B 1PBPA 1S9TA 4RPOA 5FHNA 4QRZA 2R6GE 1MRPA 3MYUA 4QSCA 4EXKA 2OWTA 2V93A 4G68A 1MG1A 1B05A 1MY0A 3KOTA 4QFNA 4JWXA 2F3DA 1S50A 5JTYB 5K2XA 4F29A 4XFEA 4LZ7A 1FTMA 3G3FA 3T22A 1AL3A 2XXUA 4ZE8A 4F1UA 1LBZA 4KD5A 4TLMB 3IL1B 3PUXE 1IXCA 3OO6A 1A40A 4EXLA 3RY3A 3CFLA 2XXWA 3C34A 4AB5A 4PE3A 5H8SA 3R26A 4DIGA 2ZNSA 2HAUA 4MCOA 1MDQA 4YKIA 4AS4A 4JVCA 3EHTA 4NF6A 3M3LA 1FPIA 3R6UA 4F19A 4F2OA 2I0CA 4ZZEA 1NH8A 2FVZA 1QUJA 3Q27A 3SZPA 3LSXA 5M2VA 3OELA 1LSTA 3BIHA 1J1NA 3FATA 1Q35A 4PFBA 1FPLA 3DELB 5AA4B 2IEEA 3PUYE 3N94A 4E0WA 2UYFA 2Y7PA 2P0SA 5FTIA 1FPDA 4ZDMA 1FBPA 3FXUA 2VGQA 3B6QA 3DLNA 2O6AA 2ZZVA 1UIVA 3PD9A 3VXCA 4N15A 4N13A 3T9HB 3RNNA 4KPTA 4HCYA 2O84X 3A29A 2I58A 4EQBA 2O7UA 1YCJA 2F35A 2OWZA 4GWWA 1OLCA 4RJZA 4YMBA 1FTLA 3H03A 1A99A 4I9DA 1FPBA 2V25A 4KCCA 4MBPA 4POXA 5EQAA 3L6GA 1IIWA 4FEBA 1Y3QA 3VLWA 1P1OA 4NWDA 4PF6A 3EPEA 1BLFA 2F6PA 1DK4A 4NQ8A 1PBQA 2AYSA 3PPRA 2XA5A 2Z8DA 2I0BA 2R8TA 1VDWA 1D4NA 4N8GA 5TPAA 1DPEA 1D9QA 3ROJA 2HHMA 3K00A 4NF5A 3O9PA 1SQYA 1XC1A 3EN3A 4U1ZA 4X9TA 3ILUB 4N8YA 1IZ1A 3RLFE 1GGGA 1M5CA 3L6HA 5FHOA 4F22A 2ZZWA 4G61A 1EH3A 4DZ1A 5A5XB 2DXRA 4LZ5A 1FPKA 3EHUA 3W15C 2H5YA 2ALUA 3C9HA 3CI8A 2UVIA 4GXSB 5H8FA 5IGAA 4GIZA 1ZIUA 2OWSA 4O8MA 5CMMA 3TTMA 2PFZA 1EYKA 4MX6A 1WODA 2E0SA 4Z7EA 1H44A 1SYHA 1NUYA 3RPLA 5DVFA 4MJOA 2DSFA 2VHAA 2FBPA 3I6VA 1B5JA 4MNPA 1Y4TA 4G77A 4ELOA 4TOZA 2VPOA 4I1DA 4R6KA 3CFXA 4RA1A 3BFUA 1SPIA 1B1HA 5IZ1A 2FHYA 3PMWA 5IZZA 1AH5A 3MAMA 1FBFA 5ESYA 4G2ZA 4AB6A 1B6HA 1A8FA 2V4CA 3MZBA 3G3GA 1LGBC 4MIJA 4U2RA 3ZSFA 1MH3A 1FSAA 3LSFB 1UTHA 1EYIA 1PB7A 5CMCA 3TTRA 3EF7A 2QJEA 4P1EA 2FNCA 4R2BA 3IOTA 1LB8A 1OLAA 3OSQA 3VVEA 1B0LA 3TTKA 4TQUQ 2XXRA 2RC8A 3OMBA 4BLAA 3MPKA 4G8NA 4O3CA 3JYRA 3U93A 2Q74A 2WEFA 1MPDA 1NV6A 4IR8A 1BIYA 4LZ8A 2ZNTA 1MY4A 1L5TA 1JNFA 2Y84A 4YU0A 5CMBA 2DWHA 4DXCA 4MLVA 3MUQA 1B5IA 3O28A 4OVSA 1N7XA 3MVWA 2D21A 5I7IA 1LBCA 4L17A 2WYKA 4NX1A 4YB6A 5EQ9A 2XXXA 5I57A 4ECFA 5H8QB 4QFPA 3KN7A 3U72A 4C1TA 2B3FA 2P2AA 1IUDA 1FRPA 3C32A 2ONSA 4RK2A 4ESWA 4MF3A 4EUOA 4H8JA 2DVZA 1M5EA 5IM2A 3TTLA 4R74A 4PFWA 3KBZA 2CZIA 2NXOA 4OANA 4YAHX 1AIVA 1NKXA 1ELJA 2PT1A 1LCTA 3VXBA 1NV2A 3IJXB 2THIA 2O1MA 3FV1A 4GWXA 2CEYA 4DXUA 3S9MC 4GLIA 3TQWA 1IEJA 4NE4A 2XXHA 2CZKA 4JVDA 4EF2A 2FIEA 2I4CA 3MP6A 2DP8A 5ITOA 3V5AA 4NTLA 1ATGA 3TCGA 4Z0IA 1LAFE 3A09A 1IMFA 3FXBA 3IB1A 3B6TA 2XXKA 1N76A 3PMVA 3CSGA 1KZ8A 5EYHA 3D1RA 1NV1A 2Z22A 1P1WA 1I6BA 3U8QA 4TLLB 4RPNA 5CMKA 3IX1A 3QAXA 1SW2A 2GHAA 4MH5A 1Y4CA 3RYDA 3IO4A 2RC9A 1K9YA 4NF8A 3TFLA 3ILTB 1Y3PA 3CIJA 4GFRA 4F3BA 3BFTA 3CRBA 4QSEA 1FBDA 2REJA 1FQCA 5I59A 1TXFA 2P1SA 2KLFA 4I62A 3IAZA 2DYXA 3G3KA 4MNCA 1QGXA 4OFJA 4P0IA 3RUMA 1RYXA 3TELA 5FTHA 1NUXA 4GX6A 3HFUA 1MS7A 2HPGA 3SETA 4ZEIA 5H8NB 2QS4A 5A5LA 5FBPA 1MPBA 1BK4A 2Y5KA 1B3EA 1LBYA 4MHFA 2F7CA 4OEUA 1BTJA 4ZEBA 1R9LA 2QMXA 4PTKA 1FBGA 4QXDA 4OEVA 3KOSA 2DE3A 2HEUA 3P7IA 2WBDA 4KI0E 4GL8A 3RT8A 2RCBA 1CNQA 3W9VA 2HZLA 1MXXA 2ESNA 3MVXA 2XWVA 2Z23A 4LP2B 4C0RA 1YZ0A 4ZZAA 3GZGA 1GTKA 1B9JA 4F31B 1A55A 1FTKA 1TFDA 2XHDA 4BDNA 2Y7WA 3FBPA 1EYJA 1LCFA 1BP5A 4ND9A 3D4CA 2DE2A 3ISPA 4PFUA 2OCUA 4XXUA 3GBAA 2JJKA 3O29A 2RCAA 3UK4A 3Q26A 2P3NA 4QFLA 4Q8RA 3CFZA 1Z7NE 3QMFA 1LAHE 5TU0A 4IO3A 4I3EA 1D9YA 2F3BA 3IK6B 3H6WA 2R9JA 4IB2A 2RINA 2CZHA 4XKRA 4NF4A 3MP8A 3KFMA 2OK2A 3UORA 1B3HA 2H99A 3PMXA 2F36A 2ONKE 4OZ9A 5CRYA 1QW0A 4GX4A 1MQJA 4H5FA 5AA4A 4MEVA 3MQ9A 4OVJA 4BDMA 2ZZXA 2B4MA 3KC1A 3S4UA 2F8DA 1QUKA 4KYSA 2WKYA 3KN8A 3H3GA 3G3JA 4F39A 3OO9A 4R6HA 3QUFA 4IO6A 4OXVA 1T0KA 2QS1A 3ZKKA 4X8RA 4AQ4A 1D9VA 4OFLA 2DWIA 1LBWA 2V84A 2AL4A 1Z7ME 5I2KA 3TEPA 1DOTA 1HSEA 2F5XA 2GRVA 4RXLA 5EYFA 1MXVA 4MMPA 1H45A 3A3CA 3IJOB 4ZE9A 4YKPA 2OX3A 5JK4A 1FPEA 2AL5A 3OD7A 4F2QA 4G68B 3SEYA 3HSTA 3FJ7A 4I8CA 3UA8A 4U21A 3S9LC 3TODA 2BJJX 3OEMA 5DEXA 3FVKA 1VSOA 2PFYA 5IAIA 3MZ1A 2OJTA 4N81A 1SBPA 2XWKA 3CG1A 5L9MA 4IGRA 4LUBA 2I4BA 2GFEA 2YPNA 2ABHA 2H4IA 3T0JA 3QIMA 1QVSA 2NOOA 5I5PA 3IFAA 4F3GA 4O7IA 1XT8A 3TAJA 2OLBA 3K2DA 1K9ZA 3S9EA 1MY1A 1II5A 1USYE 5F7VA 2QFLA 2XXIA 2ZYNA 1LFGA 3R7XA 2YLNA 1NUWA 4DI4B 3CSBA 4NF6B 3FJGA 5H8HB 5I56B 5KZTA 2Q88A 4G8HA 1JEUA 3O6GA 3MVZA 1UIUA 1MQGA 2O7IA 4AS5A 1PB9A 3OO7A 4OENA 2PBWA 2DDKA 1FTOA 3PUVE 3VDFA 4GQOA 4R75A 2X7PA 3TCHA 2UVGA 5I2NA 4QBAA 2CZLA 2XXTA 1R1NA 3PPPA 4EQ9A 3KGCA 5I84A 3H6VA 3USDA 2PYYA 1USYH 1B58A 3IOWA 1ZLQA 5CBSA 4Q0CA 5DVIA 4DE8A 1SW1A 4YB5A 2VD3A 2F6GA 2PMSA 4DXBA 2D5WA 4POWA 2MKZA 3VLUA 1MH4A 3C31A 2XD3A 1DTZA 3RT6B 1RDYA 2ONRA 1MY2A 4XKPA 3DM0A 1M5DA 4GVOA 2O1LA 3THIA 1LBVA 4UA8A 4THIA 4Q5TA 3N6UA 4H1XA 2HXRA 5IZ3B 4IO2A 1LFIA 2NUVA 2E1SA 5AE4A 3N5LA 3V83A 4IO4A 1NI9A 1P1UA 3FVOA
chains in the Genus database with same CATH topology
3BKIB 4PP0A 3PPQA 3G7WA 3E9XA 1IQ7A 1FCKA 1OQHA 3U94A 3K02A 5HPQA 2LAOA 4GWOA 2I6EA 1JEVA 2GH9A 5TPAB 4HTGA 3VV5A 1HSJA 2FYIA 2X7QA 4FIMA 4NF5B 4ZEFA 4JBZA 3PPNA 2Z8EA 3O66A 3ECRA 5ELVA 3B7DA 5CC2A 3TQLA 3VLVA 2Q8JA 2XXPA 4F3SA 2XXQA 4YICA 3RTWB 3JV9A 2R71A 4FORA 1FQAA 1N3WA 5AA3A 3T93B 2F78A 4DLDA 5KCJA 2PVUA 5KDTA 1FQBA 5H8FB 1NNFA 5I58A 2VOZA 4IY6A 4C1UA 3MP1A 5DTBA 2A5TA 3ZKLA 1B32A 1MM6A 2M8CA 1N0TA 4WXJA 1PB8A 2CMOA 1MXWA 1Y20A 2NVUB 1Y9UA 1NFTA 2DWAA 1JETA 3WAFA 3M3FA 1SI1A 2GHBA 3G3IA 1VE4A 2PX1A 1LB9A 3SDFA 3IOUA 1LAGE 3SEXA 4U22A 4XIGQ 4NWCA 1FQEA 3G3HA 4LATA 4OHNA 1MQDA 1O64A 3TKDA 1DTGA 4QFOA 1VFEA 3IORA 3HN0A 5J1DA 4ZEDA 3HV1A 4JWOA 5F1QA 1IITA 3PGFA 2IA4A 1EZPA 1UTBB 4BDQA 3HO7A 2ANJA 1B4HA 2XX8A 4YZZA 4XKQA 1JW4A 1POTA 2HQ0A 3PUZE 1GV8A 3RTFB 4IGTA 4F1YA 4QFKA 1OVBA 5I57B 2HCAA 3TMGA 1XHYA 4GOTA 1R9QA 2F7BA 1P1QA 2ZMBA 3K6UA 4FECA 5ICQA 1QUIA 1A8EA 3C36A 3K0VA 4ZS9A 1NH7A 3W9WA 4ELRA 1LLSA 1MDP1 4FJPA 2XX7A 2H9BA 2DOJA 3F11A 4JWYA 1MPCA 3K01A 5AA2A 2W7YA 1PDAA 4HS7A 3U1OA 5TP9A 3K4UA 1FTJA 4OFOA 3CG3A 3U92A 1POY1 3C35A 4OTEA 1SI0A 3K6VA 4N6PA 4H5GA 3K1PA 5LOMA 2B3BA 3QYTA 1ZMGA 2HXWA 3FJMA 3JZJA 4X1BA 4IO5A 3FASA 1S7YA 4U4XA 2XX9A 3FGSA 5B70A 5JTYA 4NF8B 1XOCA 1SYIA 2ZXTA 3FZVA 3KZGA 2Y7IA 1LFHA 1XVYA 5I59B 2DVCA 4YKJA 3T9UA 1MM7A 4GD5A 3WAEA 5ITPA 2O68A 5FHMA 1SW4A 2VD2A 4IY5A 4WEPA 1US4A 4OWDA 4WKMA 1TT1A 4KCDA 5BWJA 2H98A 4N07A 2QRYA 3GXAA 1PC3A 4R2FA 3K1NA 5CBRA 3K1MA 3T96B 2OBGA 3TPAA 1WDNA 2DWJA 4X48A 4ESXA 1B4ZA 4F3PA 3LSWA 1B51A 2UVJA 3HCQA 3MWBA 1A54A 4RK9A 1B46A 4OMBA 2QS2A 4E0XA 1HSLA 4BDRA 2REGA 1JQFA 4FEDA 4YB7A 1N04A 3C33A 1R6ZA 3T9XB 1ZTYA 1I6QA 2QMWA 3KG2A 3UN6A 4EDPA 1M5FA 2Q2CA 1MQIA 3SEUA 4PFYA 2V3QA 1IXIA 3M3KA 1AOVA 4NMYA 1OQGA 4ELPA 3OSRA 1XS5A 1LAXA 1MQHA 3QXMA 3VE1B 2PT2A 3SKPA 4JB7A 1QJMA 4H65A 4ZECA 3DP4A 3Q29A 4NEDA 2ZYMA 2AIXA 3I5OA 4ZEKA 5H8HA 5I56A 4O3BA 3AXFA 3Q25A 4NF4B 1URGA 4KFQA 3PV0E 3FD3A 5L8DA 4IO7A 4M4GA 4YKKA 3N6TA 1Y1ZA 3ZS6A 1EZOA 1B0HA 1N84A 4BDOA 1IXGA 5ICTA 1KWHA 3CVGA 4EF1A 3IO6A 4X1DA 1OMPA 4MLQA 4R6YA 4RNSA 3RPWA 1JW1A 3MZ9A 3KJTA 3KEIA 3OXNA 3H6UA 2Z8FA 3QUJA 1Q1KA 1N3XA 3O2AA 5I2KB 3FXRA 4R9GA 1FQFA 1B7UA 4PETA 5A5XA 1VR5A 3HHGA 1URSA 3DP8A 1M5BA 3VVFA 3PUWE 1B3FA 4G8MA 5HM4B 1B7ZA 3IOVA 3FVNA 3VVDA 4EQ7A 2I49A 4KHZE 3GBBA 5DEXB 3T66A 3RQTA 2UYEA 3E13X 1IXHA 3TDJA 3O6HA 4DCXA 5HBCA 1WVJA 1MY3A 5EHSA 3LC8A 3H7MA 4WEDA 1YPNA 1F9BA 4KQPA 3D4GA 3TYHA 4LQ5A 3FVGA 4R72A 3GLBA 3ONMA 1LBBA 3MW0A 4OESA 5DYHA 4F18A 3H6TA 2I3WA 1MXYA 4BDLA 3MPLA 1QULA 3EHSA 4H8IA 1RYOA 1B3GA 2V3UA 3UP9A 2Q2AA 2Q9TA 4LVQA 2F34A 1GR2A 1EU8A 1ZJLA 4FATA 1I69A 2DE4A 4GL0A 3V8XB 2G29A 1D3KA 3B6WA 1US5A 4KYDA 2A5SA 2B65A 1GVCA 1P1NA 3KSXA 1FW0A 3E3KA 5I2NB 3OO8A 4LQ2A 1OIBA 1TFAA 1A7LA 1B40A 1Y1MA 3C4MA 4JSDA 2I3VA 3HPIA 1H3DA 3PU5A 2DQVA 2XXYA 5H8QA 1SD3A 3FXQA 2YJPA 2HZKA 1AMFA 1UQWA 1NMUA 2UXAA 1YAEA 1JVXA 1SDXA 3I3VA 4K3FA 3FIRA 3VFJA 1B2HA 1JVYA 2XD2A 5EHMA 4U1OA 1B5HA 3OOAA 2F97A 1O7TA 4PE5B 2X26A 5IKBA 3EQ1A 2I48A 3S9NC 1UTBA 3LBSA 4P11A 1P99A 2D3IA 1OVTA 3MC2A 2F7AA 4U23A 4LA9A 4LONB 2VP1A 5L9SA 3IB2A 5AA2D 1DSNA 4PFTA 1I6AA 1NNTA 4H0WA 4G4PA 4KYEA 4G68C 4DCYA 3SEVA 1UTHB 5BUUA 3SERA 2QPQA 4ISUA 3MJNA 4UACA 1NL5A 4QF9A 1EZ9A 3KJ7A 4OETA 3OENA 4QSDA 1URDA 1B7HA 1CE2A 4M1VA 1CB6A 3SESA 3M8UA 4U4SA 3PPOA 1ZKBA 5KCJB 3ODBA 4GXAA 3KBRA 3DP6A 5KDTB 5I58B 2H25A 2Q89A 3A3UA 2A5TB 1JW5A 4KR5A 4RY1A 4JDFA 5DT6A 3HHFA 3IR1A 3H4ZA 3O97A 4ONYA 3LUYA 4JXIA 1QKBA 1NNPA 1TWYA 3CR9A 4XKNA 1B3LA 2HFBA 3K6WA 1NNKA 2ZYKA 3TZAA 4OQOA 5H8NA 2NWJA 5B7DA 4QHQA 2Y7KA 3TUSA 3SEWA 1H43A 3Q28A 3OEKA 3MVYA 4XTCQ 5JEIA 4FE8A 5DVJA 3TCFA 2UVHA 4ELQA 1ZU0A 1RKMA 2QL3A 3KN3A 1N7WA 5AA1A 1SW5A 3QK6A 4GRKA 5K2YA 1B52A 3TTNA 1ANFA 3S2VA 1ZBMA 4O3AA 1DPPA 4JSOA 2XXVA 3K6XA 3FUZA 4OYVA 3PD8A 5CM6A 2DXYA 1FQDA 1SVXB 2RC7A 2V3TA 4FAJA 3IB0A 4H6DA 2O69A 3QSLA 3RGYA 1YTVA 4R9FA 2RF1A 4HCWA 3UGWA 3RN8A 3UIFA 3H06B 4PQJA 4H67A 1H76A 4OERA 4R73A 2Y7RA 5L9OA 3BBRA 3N26A 2ZYOA 2HAVA 3FV2A 4YMAA 1BKAA 1DMBA 2DS9A 3T9VA 4DDDA 5AA2B 4F1VA 4HW8A 2OZZA 2O51A 2FA7A 5TP9B 1PEBA 2RKMA 3LSLA 2G93A 4MFIA 4P0GA 1MXUA 3E4RA 5CI5A 4RYAA 1VFDA 3MBPA 2QSXA 2ZNUA 3LR1A 4Q30B 3O6IA 3KSJA 4GF8A 1B1XA 1QKAA 1MXZA 2QS3A 1O63A 1XVXA 5ISUA 1Y3NA 3V89B 1PBPA 1S9TA 4RPOA 5FHNA 4QRZA 2R6GE 1MRPA 4QSCA 4EXKA 2OWTA 2V93A 4G68A 1MG1A 1B05A 1MY0A 3KOTA 4QFNA 4JWXA 1S50A 5JTYB 5K2XA 4F29A 4LZ7A 1FTMA 3G3FA 3T22A 1AL3A 2XXUA 4ZE8A 4F1UA 4KD5A 4TLMB 3IL1B 3PUXE 1IXCA 3OO6A 1A40A 4EXLA 3RY3A 3CFLA 2XXWA 3C34A 4AB5A 5H8SA 3R26A 4DIGA 2ZNSA 2HAUA 1MDQA 4YKIA 3EHTA 4NF6A 3M3LA 3R6UA 4F19A 4F2OA 2I0CA 4ZZEA 1NH8A 1QUJA 3Q27A 3LSXA 5M2VA 3OELA 1LSTA 1J1NA 3FATA 1Q35A 3DELB 5AA4B 2IEEA 3PUYE 3N94A 4E0WA 2UYFA 2Y7PA 2P0SA 5FTIA 4ZDMA 3FXUA 2VGQA 3B6QA 3DLNA 2O6AA 1UIVA 3PD9A 3VXCA 4N13A 3T9HB 3RNNA 4KPTA 4HCYA 2O84X 2I58A 4EQBA 2O7UA 1YCJA 2F35A 1OLCA 4RJZA 4YMBA 1FTLA 3H03A 1A99A 4I9DA 4KCCA 2V25A 4MBPA 4POXA 3L6GA 1IIWA 4FEBA 1Y3QA 3VLWA 1P1OA 4NWDA 3EPEA 1BLFA 2F6PA 1PBQA 2AYSA 3PPRA 2Z8DA 2I0BA 1D4NA 5TPAA 1DPEA 3K00A 4NF5A 3O9PA 1SQYA 1XC1A 3EN3A 4U1ZA 4X9TA 3ILUB 1IZ1A 3RLFE 1GGGA 1M5CA 3L6HA 5FHOA 4F22A 1EH3A 4DZ1A 5A5XB 2DXRA 4LZ5A 3EHUA 3W15C 2H5YA 2ALUA 3C9HA 3CI8A 2UVIA 4GXSB 5H8FA 4GIZA 1ZIUA 2OWSA 5CMMA 3TTMA 1WODA 2E0SA 4Z7EA 1H44A 1SYHA 5DVFA 2DSFA 2VHAA 3I6VA 1B5JA 1Y4TA 4G77A 4ELOA 4TOZA 4I1DA 4R6KA 3CFXA 4RA1A 3BFUA 1B1HA 3PMWA 1AH5A 3MAMA 4G2ZA 4AB6A 1B6HA 1A8FA 3MZBA 3G3GA 1LGBC 4U2RA 3ZSFA 1MH3A 3LSFB 1UTHA 1PB7A 5CMCA 3TTRA 3EF7A 2QJEA 2FNCA 4R2BA 3IOTA 1LB8A 1OLAA 3OSQA 3VVEA 1B0LA 3TTKA 4TQUQ 2XXRA 2RC8A 3OMBA 4BLAA 3MPKA 4G8NA 4O3CA 3JYRA 3U93A 1MPDA 1BIYA 4LZ8A 2ZNTA 1MY4A 1L5TA 1JNFA 2Y84A 4YU0A 5CMBA 2DWHA 4DXCA 4MLVA 3MUQA 1B5IA 3O28A 1N7XA 3MVWA 2D21A 1LBCA 4L17A 4YB6A 2XXXA 5I57A 4ECFA 5H8QB 4QFPA 3KN7A 3U72A 4C1TA 2B3FA 2P2AA 1IUDA 3C32A 2ONSA 4RK2A 4ESWA 4MF3A 4EUOA 4H8JA 2DVZA 1M5EA 3TTLA 4R74A 4PFWA 2NXOA 4YAHX 1AIVA 1NKXA 1ELJA 2PT1A 1LCTA 3VXBA 3IJXB 2THIA 2O1MA 3FV1A 4DXUA 3S9MC 4GLIA 3TQWA 1IEJA 4NE4A 2XXHA 4EF2A 2I4CA 3MP6A 2DP8A 5ITOA 3V5AA 4NTLA 1ATGA 3TCGA 4Z0IA 1LAFE 3A09A 3IB1A 3B6TA 1N76A 3PMVA 3CSGA 2Z22A 1P1WA 1I6BA 3U8QA 4TLLB 4RPNA 5CMKA 3IX1A 3QAXA 1SW2A 2GHAA 4MH5A 1Y4CA 3IO4A 2RC9A 4NF8A 3TFLA 3ILTB 1Y3PA 3CIJA 4GFRA 4F3BA 3BFTA 3CRBA 4QSEA 2REJA 1FQCA 5I59A 1TXFA 2P1SA 2KLFA 4I62A 3IAZA 2DYXA 3G3KA 4OFJA 4P0IA 3RUMA 1RYXA 3TELA 5FTHA 1MS7A 3SETA 4ZEIA 5H8NB 2QS4A 1MPBA 1B3EA 2F7CA 4OEUA 1BTJA 4ZEBA 1R9LA 2QMXA 4OEVA 3KOSA 2DE3A 2HEUA 3P7IA 4KI0E 4GL8A 3RT8A 2RCBA 3W9VA 2HZLA 1MXXA 2ESNA 3MVXA 2Z23A 4LP2B 4C0RA 4ZZAA 3GZGA 1GTKA 1B9JA 4F31B 1A55A 1FTKA 1TFDA 2XHDA 4BDNA 2Y7WA 1LCFA 1BP5A 4ND9A 3D4CA 2DE2A 4PFUA 2OCUA 4XXUA 3GBAA 3O29A 2RCAA 3UK4A 3Q26A 4QFLA 4Q8RA 3CFZA 1Z7NE 1LAHE 5TU0A 4IO3A 1D9YA 3IK6B 3H6WA 2R9JA 4IB2A 2RINA 4XKRA 4NF4A 3MP8A 3KFMA 3UORA 2OK2A 1B3HA 2H99A 3PMXA 2F36A 2ONKE 4OZ9A 5CRYA 1QW0A 1MQJA 4H5FA 5AA4A 3MQ9A 4OVJA 4BDMA 3S4UA 2F8DA 1QUKA 4KYSA 2WKYA 3KN8A 3H3GA 3G3JA 4F39A 3OO9A 4R6HA 3QUFA 4IO6A 4OXVA 1T0KA 2QS1A 3ZKKA 4AQ4A 1D9VA 4OFLA 2DWIA 2V84A 2AL4A 1Z7ME 5I2KA 3TEPA 1DOTA 1HSEA 2F5XA 2GRVA 4RXLA 5EYFA 1MXVA 1H45A 3A3CA 3IJOB 4ZE9A 4YKPA 5JK4A 2AL5A 3OD7A 4F2QA 4G68B 3SEYA 3HSTA 3FJ7A 4I8CA 3UA8A 4U21A 3S9LC 3TODA 2BJJX 3OEMA 5DEXA 3FVKA 1VSOA 5IAIA 3MZ1A 2OJTA 1SBPA 3CG1A 5L9MA 4IGRA 4LUBA 2I4BA 2GFEA 2YPNA 2ABHA 2H4IA 3QIMA 1QVSA 2NOOA 4F3GA 1XT8A 3TAJA 2OLBA 3K2DA 3S9EA 1MY1A 1II5A 1USYE 5F7VA 2XXIA 2ZYNA 1LFGA 3R7XA 2YLNA 3CSBA 4NF6B 3FJGA 5H8HB 5I56B 5KZTA 2Q88A 4G8HA 1JEUA 3O6GA 3MVZA 1UIUA 1MQGA 2O7IA 1PB9A 3OO7A 4OENA 2PBWA 1FTOA 3PUVE 3VDFA 4GQOA 4R75A 2X7PA 3TCHA 2UVGA 5I2NA 2CZLA 2XXTA 1R1NA 3PPPA 4EQ9A 3KGCA 5I84A 3H6VA 3USDA 2PYYA 1USYH 1B58A 3IOWA 1ZLQA 5CBSA 4Q0CA 5DVIA 4DE8A 1SW1A 4YB5A 2VD3A 2F6GA 2PMSA 4DXBA 2D5WA 4POWA 3VLUA 1MH4A 3C31A 2XD3A 1DTZA 3RT6B 2ONRA 1MY2A 4XKPA 3DM0A 1M5DA 4GVOA 2O1LA 3THIA 4UA8A 4THIA 4Q5TA 3N6UA 4H1XA 4IO2A 1LFIA 2NUVA 2E1SA 5AE4A 3N5LA 3V83A 4IO4A 1P1UA 3FVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BKI B;  4PP0 A;  3PPQ A;  3G7W A;  3E9X A;  1IQ7 A;  1FCK A;  1OQH A;  3U94 A;  3K02 A;  5HPQ A;  2LAO A;  4GWO A;  2I6E A;  1JEV A;  2GH9 A;  5TPA B;  4HTG A;  3VV5 A;  1HSJ A;  2FYI A;  2X7Q A;  4FIM A;  4NF5 B;  4ZEF A;  4JBZ A;  3PPN A;  2Z8E A;  3O66 A;  3ECR A;  5ELV A;  3B7D A;  5CC2 A;  3TQL A;  3VLV A;  2Q8J A;  2XXP A;  4F3S A;  2XXQ A;  4YIC A;  3RTW B;  3JV9 A;  2R71 A;  4FOR A;  1FQA A;  1N3W A;  5AA3 A;  3T93 B;  2F78 A;  4DLD A;  5KCJ A;  2PVU A;  5KDT A;  1FQB A;  5H8F B;  1NNF A;  5I58 A;  2VOZ A;  4IY6 A;  4C1U A;  3MP1 A;  5DTB A;  2A5T A;  3ZKL A;  1B32 A;  1MM6 A;  2M8C A;  1N0T A;  4WXJ A;  1PB8 A;  2CMO A;  1MXW A;  1Y20 A;  2NVU B;  1Y9U A;  1NFT A;  2DWA A;  1JET A;  3WAF A;  3M3F A;  1SI1 A;  2GHB A;  3G3I A;  1VE4 A;  2PX1 A;  1LB9 A;  3SDF A;  3IOU A;  1LAG E;  3SEX A;  4U22 A;  4XIG Q;  4NWC A;  1FQE A;  3G3H A;  4LAT A;  4OHN A;  1MQD A;  1O64 A;  3TKD A;  1DTG A;  4QFO A;  1VFE A;  3IOR A;  3HN0 A;  5J1D A;  4ZED A;  3HV1 A;  4JWO A;  5F1Q A;  1IIT A;  3PGF A;  2IA4 A;  1EZP A;  1UTB B;  4BDQ A;  3HO7 A;  2ANJ A;  1B4H A;  2XX8 A;  4YZZ A;  4XKQ A;  1JW4 A;  1POT A;  2HQ0 A;  3PUZ E;  1GV8 A;  3RTF B;  4IGT A;  4F1Y A;  4QFK A;  1OVB A;  5I57 B;  2HCA A;  3TMG A;  1XHY A;  4GOT A;  1R9Q A;  2F7B A;  1P1Q A;  2ZMB A;  3K6U A;  4FEC A;  5ICQ A;  1QUI A;  1A8E A;  3C36 A;  3K0V A;  4ZS9 A;  1NH7 A;  3W9W A;  4ELR A;  1LLS A;  1MDP 1;  4FJP A;  2XX7 A;  2H9B A;  2DOJ A;  3F11 A;  4JWY A;  1MPC A;  3K01 A;  5AA2 A;  2W7Y A;  1PDA A;  4HS7 A;  3U1O A;  5TP9 A;  3K4U A;  1FTJ A;  4OFO A;  3CG3 A;  3U92 A;  1POY 1;  3C35 A;  4OTE A;  1SI0 A;  3K6V A;  4N6P A;  4H5G A;  3K1P A;  5LOM A;  2B3B A;  3QYT A;  1ZMG A;  2HXW A;  3FJM A;  3JZJ A;  4X1B A;  4IO5 A;  3FAS A;  1S7Y A;  4U4X A;  2XX9 A;  3FGS A;  5B70 A;  5JTY A;  4NF8 B;  1XOC A;  1SYI A;  2ZXT A;  3FZV A;  3KZG A;  2Y7I A;  1LFH A;  1XVY A;  5I59 B;  2DVC A;  4YKJ A;  3T9U A;  1MM7 A;  4GD5 A;  3WAE A;  5ITP A;  2O68 A;  5FHM A;  1SW4 A;  2VD2 A;  4IY5 A;  4WEP A;  1US4 A;  4OWD A;  4WKM A;  1TT1 A;  4KCD A;  5BWJ A;  2H98 A;  4N07 A;  2QRY A;  3GXA A;  1PC3 A;  4R2F A;  3K1N A;  5CBR A;  3K1M A;  3T96 B;  2OBG A;  3TPA A;  1WDN A;  2DWJ A;  4X48 A;  4ESX A;  1B4Z A;  4F3P A;  3LSW A;  1B51 A;  2UVJ A;  3HCQ A;  3MWB A;  1A54 A;  4RK9 A;  1B46 A;  4OMB A;  2QS2 A;  4E0X A;  1HSL A;  4BDR A;  2REG A;  1JQF A;  4FED A;  4YB7 A;  1N04 A;  3C33 A;  1R6Z A;  3T9X B;  1ZTY A;  1I6Q A;  2QMW A;  3KG2 A;  3UN6 A;  4EDP A;  1M5F A;  2Q2C A;  1MQI A;  3SEU A;  4PFY A;  2V3Q A;  1IXI A;  3M3K A;  1AOV A;  4NMY A;  1OQG A;  4ELP A;  3OSR A;  1XS5 A;  1LAX A;  1MQH A;  3QXM A;  3VE1 B;  2PT2 A;  3SKP A;  4JB7 A;  1QJM A;  4H65 A;  4ZEC A;  3DP4 A;  3Q29 A;  4NED A;  2ZYM A;  2AIX A;  3I5O A;  4ZEK A;  5H8H A;  5I56 A;  4O3B A;  3AXF A;  3Q25 A;  4NF4 B;  1URG A;  4KFQ A;  3PV0 E;  3FD3 A;  5L8D A;  4IO7 A;  4M4G A;  4YKK A;  3N6T A;  1Y1Z A;  3ZS6 A;  1EZO A;  1B0H A;  1N84 A;  4BDO A;  1IXG A;  5ICT A;  1KWH A;  3CVG A;  4EF1 A;  3IO6 A;  4X1D A;  1OMP A;  4MLQ A;  4R6Y A;  4RNS A;  3RPW A;  1JW1 A;  3MZ9 A;  3KJT A;  3KEI A;  3OXN A;  3H6U A;  2Z8F A;  3QUJ A;  1Q1K A;  1N3X A;  3O2A A;  5I2K B;  3FXR A;  4R9G A;  1FQF A;  1B7U A;  4PET A;  5A5X A;  1VR5 A;  3HHG A;  1URS A;  3DP8 A;  1M5B A;  3VVF A;  3PUW E;  1B3F A;  4G8M A;  5HM4 B;  1B7Z A;  3IOV A;  3FVN A;  3VVD A;  4EQ7 A;  2I49 A;  4KHZ E;  3GBB A;  5DEX B;  3T66 A;  3RQT A;  2UYE A;  3E13 X;  1IXH A;  3TDJ A;  3O6H A;  4DCX A;  5HBC A;  1WVJ A;  1MY3 A;  5EHS A;  3LC8 A;  3H7M A;  4WED A;  1YPN A;  1F9B A;  4KQP A;  3D4G A;  3TYH A;  4LQ5 A;  3FVG A;  4R72 A;  3GLB A;  3ONM A;  1LBB A;  3MW0 A;  4OES A;  5DYH A;  4F18 A;  3H6T A;  2I3W A;  1MXY A;  4BDL A;  3MPL A;  1QUL A;  3EHS A;  4H8I A;  1RYO A;  1B3G A;  2V3U A;  3UP9 A;  2Q2A A;  2Q9T A;  4LVQ A;  2F34 A;  1GR2 A;  1EU8 A;  1ZJL A;  4FAT A;  1I69 A;  2DE4 A;  4GL0 A;  3V8X B;  2G29 A;  1D3K A;  3B6W A;  1US5 A;  4KYD A;  2A5S A;  2B65 A;  1GVC A;  1P1N A;  3KSX A;  1FW0 A;  3E3K A;  5I2N B;  3OO8 A;  4LQ2 A;  1OIB A;  1TFA A;  1A7L A;  1B40 A;  1Y1M A;  3C4M A;  4JSD A;  2I3V A;  3HPI A;  1H3D A;  3PU5 A;  2DQV A;  2XXY A;  5H8Q A;  1SD3 A;  3FXQ A;  2YJP A;  2HZK A;  1AMF A;  1UQW A;  1NMU A;  2UXA A;  1YAE A;  1JVX A;  1SDX A;  3I3V A;  4K3F A;  3FIR A;  3VFJ A;  1B2H A;  1JVY A;  2XD2 A;  5EHM A;  4U1O A;  1B5H A;  3OOA A;  2F97 A;  1O7T A;  4PE5 B;  2X26 A;  5IKB A;  3EQ1 A;  2I48 A;  3S9N C;  1UTB A;  3LBS A;  4P11 A;  1P99 A;  2D3I A;  1OVT A;  3MC2 A;  2F7A A;  4U23 A;  4LA9 A;  4LON B;  2VP1 A;  5L9S A;  3IB2 A;  5AA2 D;  1DSN A;  4PFT A;  1I6A A;  1NNT A;  4H0W A;  4G4P A;  4KYE A;  4G68 C;  4DCY A;  3SEV A;  1UTH B;  5BUU A;  3SER A;  2QPQ A;  4ISU A;  3MJN A;  4UAC A;  1NL5 A;  4QF9 A;  1EZ9 A;  3KJ7 A;  4OET A;  3OEN A;  4QSD A;  1URD A;  1B7H A;  1CE2 A;  4M1V A;  1CB6 A;  3SES A;  3M8U A;  4U4S A;  3PPO A;  1ZKB A;  5KCJ B;  3ODB A;  4GXA A;  3KBR A;  3DP6 A;  5KDT B;  5I58 B;  2H25 A;  2Q89 A;  3A3U A;  2A5T B;  1JW5 A;  4KR5 A;  4RY1 A;  4JDF A;  5DT6 A;  3HHF A;  3IR1 A;  3H4Z A;  3O97 A;  4ONY A;  3LUY A;  4JXI A;  1QKB A;  1NNP A;  1TWY A;  3CR9 A;  4XKN A;  1B3L A;  2HFB A;  3K6W A;  1NNK A;  2ZYK A;  3TZA A;  4OQO A;  5H8N A;  2NWJ A;  5B7D A;  4QHQ A;  2Y7K A;  3TUS A;  3SEW A;  1H43 A;  3Q28 A;  3OEK A;  3MVY A;  4XTC Q;  5JEI A;  4FE8 A;  5DVJ A;  3TCF A;  2UVH A;  4ELQ A;  1ZU0 A;  1RKM A;  2QL3 A;  3KN3 A;  1N7W A;  5AA1 A;  1SW5 A;  3QK6 A;  4GRK A;  5K2Y A;  1B52 A;  3TTN A;  1ANF A;  3S2V A;  1ZBM A;  4O3A A;  1DPP A;  4JSO A;  2XXV A;  3K6X A;  3FUZ A;  4OYV A;  3PD8 A;  5CM6 A;  2DXY A;  1FQD A;  1SVX B;  2RC7 A;  2V3T A;  4FAJ A;  3IB0 A;  4H6D A;  2O69 A;  3QSL A;  3RGY A;  1YTV A;  4R9F A;  2RF1 A;  4HCW A;  3UGW A;  3RN8 A;  3UIF A;  3H06 B;  4PQJ A;  4H67 A;  1H76 A;  4OER A;  4R73 A;  2Y7R A;  5L9O A;  3BBR A;  3N26 A;  2ZYO A;  2HAV A;  3FV2 A;  4YMA A;  1BKA A;  1DMB A;  2DS9 A;  3T9V A;  4DDD A;  5AA2 B;  4F1V A;  4HW8 A;  2OZZ A;  2O51 A;  2FA7 A;  5TP9 B;  1PEB A;  2RKM A;  3LSL A;  2G93 A;  4MFI A;  4P0G A;  1MXU A;  3E4R A;  5CI5 A;  4RYA A;  1VFD A;  3MBP A;  2QSX A;  2ZNU A;  3LR1 A;  4Q30 B;  3O6I A;  3KSJ A;  4GF8 A;  1B1X A;  1QKA A;  1MXZ A;  2QS3 A;  1O63 A;  1XVX A;  5ISU A;  1Y3N A;  3V89 B;  1PBP A;  1S9T A;  4RPO A;  5FHN A;  4QRZ A;  2R6G E;  1MRP A;  4QSC A;  4EXK A;  2OWT A;  2V93 A;  4G68 A;  1MG1 A;  1B05 A;  1MY0 A;  3KOT A;  4QFN A;  4JWX A;  1S50 A;  5JTY B;  5K2X A;  4F29 A;  4LZ7 A;  1FTM A;  3G3F A;  3T22 A;  1AL3 A;  2XXU A;  4ZE8 A;  4F1U A;  4KD5 A;  4TLM B;  3IL1 B;  3PUX E;  1IXC A;  3OO6 A;  1A40 A;  4EXL A;  3RY3 A;  3CFL A;  2XXW A;  3C34 A;  4AB5 A;  5H8S A;  3R26 A;  4DIG A;  2ZNS A;  2HAU A;  1MDQ A;  4YKI A;  3EHT A;  4NF6 A;  3M3L A;  3R6U A;  4F19 A;  4F2O A;  2I0C A;  4ZZE A;  1NH8 A;  1QUJ A;  3Q27 A;  3LSX A;  5M2V A;  3OEL A;  1LST A;  1J1N A;  3FAT A;  1Q35 A;  3DEL B;  5AA4 B;  2IEE A;  3PUY E;  3N94 A;  4E0W A;  2UYF A;  2Y7P A;  2P0S A;  5FTI A;  4ZDM A;  3FXU A;  2VGQ A;  3B6Q A;  3DLN A;  2O6A A;  1UIV A;  3PD9 A;  3VXC A;  4N13 A;  3T9H B;  3RNN A;  4KPT A;  4HCY A;  2O84 X;  2I58 A;  4EQB A;  2O7U A;  1YCJ A;  2F35 A;  1OLC A;  4RJZ A;  4YMB A;  1FTL A;  3H03 A;  1A99 A;  4I9D A;  4KCC A;  2V25 A;  4MBP A;  4POX A;  3L6G A;  1IIW A;  4FEB A;  1Y3Q A;  3VLW A;  1P1O A;  4NWD A;  3EPE A;  1BLF A;  2F6P A;  1PBQ A;  2AYS A;  3PPR A;  2Z8D A;  2I0B A;  1D4N A;  5TPA A;  1DPE A;  3K00 A;  4NF5 A;  3O9P A;  1SQY A;  1XC1 A;  3EN3 A;  4U1Z A;  4X9T A;  3ILU B;  1IZ1 A;  3RLF E;  1GGG A;  1M5C A;  3L6H A;  5FHO A;  4F22 A;  1EH3 A;  4DZ1 A;  5A5X B;  2DXR A;  4LZ5 A;  3EHU A;  3W15 C;  2H5Y A;  2ALU A;  3C9H A;  3CI8 A;  2UVI A;  4GXS B;  5H8F A;  4GIZ A;  1ZIU A;  2OWS A;  5CMM A;  3TTM A;  1WOD A;  2E0S A;  4Z7E A;  1H44 A;  1SYH A;  5DVF A;  2DSF A;  2VHA A;  3I6V A;  1B5J A;  1Y4T A;  4G77 A;  4ELO A;  4TOZ A;  4I1D A;  4R6K A;  3CFX A;  4RA1 A;  3BFU A;  1B1H A;  3PMW A;  1AH5 A;  3MAM A;  4G2Z A;  4AB6 A;  1B6H A;  1A8F A;  3MZB A;  3G3G A;  1LGB C;  4U2R A;  3ZSF A;  1MH3 A;  3LSF B;  1UTH A;  1PB7 A;  5CMC A;  3TTR A;  3EF7 A;  2QJE A;  2FNC A;  4R2B A;  3IOT A;  1LB8 A;  1OLA A;  3OSQ A;  3VVE A;  1B0L A;  3TTK A;  4TQU Q;  2XXR A;  2RC8 A;  3OMB A;  4BLA A;  3MPK A;  4G8N A;  4O3C A;  3JYR A;  3U93 A;  1MPD A;  1BIY A;  4LZ8 A;  2ZNT A;  1MY4 A;  1L5T A;  1JNF A;  2Y84 A;  4YU0 A;  5CMB A;  2DWH A;  4DXC A;  4MLV A;  3MUQ A;  1B5I A;  3O28 A;  1N7X A;  3MVW A;  2D21 A;  1LBC A;  4L17 A;  4YB6 A;  2XXX A;  5I57 A;  4ECF A;  5H8Q B;  4QFP A;  3KN7 A;  3U72 A;  4C1T A;  2B3F A;  2P2A A;  1IUD A;  3C32 A;  2ONS A;  4RK2 A;  4ESW A;  4MF3 A;  4EUO A;  4H8J A;  2DVZ A;  1M5E A;  3TTL A;  4R74 A;  4PFW A;  2NXO A;  4YAH X;  1AIV A;  1NKX A;  1ELJ A;  2PT1 A;  1LCT A;  3VXB A;  3IJX B;  2THI A;  2O1M A;  3FV1 A;  4DXU A;  3S9M C;  4GLI A;  3TQW A;  1IEJ A;  4NE4 A;  2XXH A;  4EF2 A;  2I4C A;  3MP6 A;  2DP8 A;  5ITO A;  3V5A A;  4NTL A;  1ATG A;  3TCG A;  4Z0I A;  1LAF E;  3A09 A;  3IB1 A;  3B6T A;  1N76 A;  3PMV A;  3CSG A;  2Z22 A;  1P1W A;  1I6B A;  3U8Q A;  4TLL B;  4RPN A;  5CMK A;  3IX1 A;  3QAX A;  1SW2 A;  2GHA A;  4MH5 A;  1Y4C A;  3IO4 A;  2RC9 A;  4NF8 A;  3TFL A;  3ILT B;  1Y3P A;  3CIJ A;  4GFR A;  4F3B A;  3BFT A;  3CRB A;  4QSE A;  2REJ A;  1FQC A;  5I59 A;  1TXF A;  2P1S A;  2KLF A;  4I62 A;  3IAZ A;  2DYX A;  3G3K A;  4OFJ A;  4P0I A;  3RUM A;  1RYX A;  3TEL A;  5FTH A;  1MS7 A;  3SET A;  4ZEI A;  5H8N B;  2QS4 A;  1MPB A;  1B3E A;  2F7C A;  4OEU A;  1BTJ A;  4ZEB A;  1R9L A;  2QMX A;  4OEV A;  3KOS A;  2DE3 A;  2HEU A;  3P7I A;  4KI0 E;  4GL8 A;  3RT8 A;  2RCB A;  3W9V A;  2HZL A;  1MXX A;  2ESN A;  3MVX A;  2Z23 A;  4LP2 B;  4C0R A;  4ZZA A;  3GZG A;  1GTK A;  1B9J A;  4F31 B;  1A55 A;  1FTK A;  1TFD A;  2XHD A;  4BDN A;  2Y7W A;  1LCF A;  1BP5 A;  4ND9 A;  3D4C A;  2DE2 A;  4PFU A;  2OCU A;  4XXU A;  3GBA A;  3O29 A;  2RCA A;  3UK4 A;  3Q26 A;  4QFL A;  4Q8R A;  3CFZ A;  1Z7N E;  1LAH E;  5TU0 A;  4IO3 A;  1D9Y A;  3IK6 B;  3H6W A;  2R9J A;  4IB2 A;  2RIN A;  4XKR A;  4NF4 A;  3MP8 A;  3KFM A;  3UOR A;  2OK2 A;  1B3H A;  2H99 A;  3PMX A;  2F36 A;  2ONK E;  4OZ9 A;  5CRY A;  1QW0 A;  1MQJ A;  4H5F A;  5AA4 A;  3MQ9 A;  4OVJ A;  4BDM A;  3S4U A;  2F8D A;  1QUK A;  4KYS A;  2WKY A;  3KN8 A;  3H3G A;  3G3J A;  4F39 A;  3OO9 A;  4R6H A;  3QUF A;  4IO6 A;  4OXV A;  1T0K A;  2QS1 A;  3ZKK A;  4AQ4 A;  1D9V A;  4OFL A;  2DWI A;  2V84 A;  2AL4 A;  1Z7M E;  5I2K A;  3TEP A;  1DOT A;  1HSE A;  2F5X A;  2GRV A;  4RXL A;  5EYF A;  1MXV A;  1H45 A;  3A3C A;  3IJO B;  4ZE9 A;  4YKP A;  5JK4 A;  2AL5 A;  3OD7 A;  4F2Q A;  4G68 B;  3SEY A;  3HST A;  3FJ7 A;  4I8C A;  3UA8 A;  4U21 A;  3S9L C;  3TOD A;  2BJJ X;  3OEM A;  5DEX A;  3FVK A;  1VSO A;  5IAI A;  3MZ1 A;  2OJT A;  1SBP A;  3CG1 A;  5L9M A;  4IGR A;  4LUB A;  2I4B A;  2GFE A;  2YPN A;  2ABH A;  2H4I A;  3QIM A;  1QVS A;  2NOO A;  4F3G A;  1XT8 A;  3TAJ A;  2OLB A;  3K2D A;  3S9E A;  1MY1 A;  1II5 A;  1USY E;  5F7V A;  2XXI A;  2ZYN A;  1LFG A;  3R7X A;  2YLN A;  3CSB A;  4NF6 B;  3FJG A;  5H8H B;  5I56 B;  5KZT A;  2Q88 A;  4G8H A;  1JEU A;  3O6G A;  3MVZ A;  1UIU A;  1MQG A;  2O7I A;  1PB9 A;  3OO7 A;  4OEN A;  2PBW A;  1FTO A;  3PUV E;  3VDF A;  4GQO A;  4R75 A;  2X7P A;  3TCH A;  2UVG A;  5I2N A;  2CZL A;  2XXT A;  1R1N A;  3PPP A;  4EQ9 A;  3KGC A;  5I84 A;  3H6V A;  3USD A;  2PYY A;  1USY H;  1B58 A;  3IOW A;  1ZLQ A;  5CBS A;  4Q0C A;  5DVI A;  4DE8 A;  1SW1 A;  4YB5 A;  2VD3 A;  2F6G A;  2PMS A;  4DXB A;  2D5W A;  4POW A;  3VLU A;  1MH4 A;  3C31 A;  2XD3 A;  1DTZ A;  3RT6 B;  2ONR A;  1MY2 A;  4XKP A;  3DM0 A;  1M5D A;  4GVO A;  2O1L A;  3THI A;  4UA8 A;  4THI A;  4Q5T A;  3N6U A;  4H1X A;  4IO2 A;  1LFI A;  2NUV A;  2E1S A;  5AE4 A;  3N5L A;  3V83 A;  4IO4 A;  1P1U A;  3FVO A; 
#chains in the Genus database with same CATH topology
 1FBE A;  3BKI B;  4PP0 A;  3PPQ A;  3G7W A;  3E9X A;  1IQ7 A;  1FCK A;  1OQH A;  3U94 A;  3K02 A;  5HPQ A;  2LAO A;  4GWO A;  4NGU A;  2I6E A;  3PTY A;  1JEV A;  4MNI A;  2GH9 A;  5TPA B;  4HTG A;  3VV5 A;  1HSJ A;  2FYI A;  2X7Q A;  4FIM A;  4NF5 B;  4ZEF A;  4JBZ A;  3PPN A;  2Z8E A;  3O66 A;  3ECR A;  5ELV A;  3B7D A;  3IFC A;  5CC2 A;  3TQL A;  3VLV A;  2Q8J A;  2XXP A;  4F3S A;  2XXQ A;  4YIC A;  3RTW B;  3JV9 A;  2R71 A;  3BIG A;  4FOR A;  1FQA A;  1N3W A;  5AA3 A;  3T93 B;  2F78 A;  4DLD A;  5KCJ A;  4PDD A;  2PVU A;  5KDT A;  1FQB A;  5H8F B;  1NNF A;  5I58 A;  2VOZ A;  4O94 A;  4N17 A;  4IY6 A;  4C1U A;  3MP1 A;  5DTB A;  2A5T A;  3ZKL A;  1B32 A;  3RPL B;  5ET8 A;  1MM6 A;  2M8C A;  2P3V A;  1N0T A;  4WXJ A;  1PB8 A;  2CMO A;  1MXW A;  1Y20 A;  2NVU B;  1LBX A;  1IMB A;  1Y9U A;  1NFT A;  2DWA A;  1JET A;  3WAF A;  3M3F A;  3MST A;  1SI1 A;  2GHB A;  3G3I A;  1VE4 A;  2PX1 A;  1LB9 A;  3SDF A;  3IOU A;  1LAG E;  3SEX A;  4U22 A;  4XIG Q;  4NWC A;  1FQE A;  4LN5 A;  3G3H A;  4LAT A;  4OHN A;  1MQD A;  3T1B A;  1O64 A;  2PCR A;  3TKD A;  1DTG A;  4QFO A;  1VFE A;  4GBW A;  3IOR A;  3HN0 A;  5J1D A;  4ZED A;  3HV1 A;  4JWO A;  5F1Q A;  1IIT A;  3PGF A;  2IA4 A;  1EZP A;  1UTB B;  4P8B A;  4BDQ A;  3HO7 A;  2ANJ A;  1B4H A;  2XX8 A;  4YZZ A;  4XKQ A;  1JW4 A;  1INP A;  1POT A;  2CEX A;  2HQ0 A;  4P56 A;  3PUZ E;  1GV8 A;  3RTF B;  4IGT A;  4GBV A;  4F1Y A;  4QFK A;  1OVB A;  5I57 B;  4P9K A;  2HCA A;  3TMG A;  1XHY A;  4GOT A;  1R9Q A;  2F7B A;  1P1Q A;  1Q9D A;  2ZMB A;  3K6U A;  4FEC A;  5ICQ A;  1QUI A;  1A8E A;  3C36 A;  2Y5L A;  3K0V A;  4ZS9 A;  1NH7 A;  3W9W A;  4ELR A;  1LLS A;  1MDP 1;  4FJP A;  2XX7 A;  1NV3 A;  5ET6 A;  3U65 A;  2H9B A;  2DOJ A;  3F11 A;  4JWY A;  1MPC A;  4PFR A;  3B50 A;  3K01 A;  5AA2 A;  2W7Y A;  1PDA A;  4HS7 A;  3U1O A;  4NN3 A;  5TP9 A;  3K4U A;  3E79 A;  1FTJ A;  4OFO A;  4PAF A;  3CG3 A;  5ET7 A;  3U92 A;  1POY 1;  3C35 A;  4OTE A;  1SI0 A;  3K6V A;  4N6P A;  4H5G A;  3K1P A;  5LOM A;  2B3B A;  3QYT A;  1ZMG A;  2KQZ A;  4GWU A;  4P3L A;  2HXW A;  3FJM A;  3JZJ A;  4X1B A;  4IO5 A;  3FAS A;  1S7Y A;  4U4X A;  2XX9 A;  3B8B A;  3FGS A;  5B70 A;  5JTY A;  4NF8 B;  1XOC A;  1SYI A;  2ZXT A;  3FZV A;  3KZG A;  2Y7I A;  1LFH A;  4N91 A;  1XVY A;  5I59 B;  2DVC A;  4YKJ A;  3T9U A;  1MM7 A;  4GD5 A;  3WAE A;  5ITP A;  1YYZ A;  2O68 A;  5FHM A;  1SW4 A;  2VD2 A;  4IY5 A;  4WEP A;  4P1L A;  1US4 A;  4XEQ A;  4OWD A;  4WKM A;  1TT1 A;  4KCD A;  5BWJ A;  2H98 A;  4N07 A;  2QRY A;  4DI3 D;  3GXA A;  1PC3 A;  4R2F A;  1FJ9 A;  3K1N A;  5CBR A;  3K1M A;  3T96 B;  2OBG A;  5ET5 A;  3TPA A;  1WDN A;  2DWJ A;  4X48 A;  4ESX A;  1B4Z A;  4F3P A;  3LSW A;  1B51 A;  2UVJ A;  3HCQ A;  3MWB A;  1A54 A;  4RK9 A;  4OA4 A;  1IMC A;  1B46 A;  4OMB A;  2QS2 A;  4PBQ A;  4E0X A;  1HSL A;  4BDR A;  2REG A;  1JQF A;  4FED A;  4YB7 A;  1N04 A;  3C33 A;  1R6Z A;  3T9X B;  1ZTY A;  4NHB A;  1I6Q A;  2QMW A;  3KG2 A;  3UN6 A;  4EDP A;  1M5F A;  2Q2C A;  1MQI A;  3SEU A;  4PFY A;  2V3Q A;  1IXI A;  3M3K A;  4PGP A;  1AOV A;  4NMY A;  1OQG A;  4ELP A;  3OSR A;  1XS5 A;  1LAX A;  1MQH A;  3QXM A;  4KXP A;  1JP4 A;  3VE1 B;  2PT2 A;  2L5V A;  3SKP A;  4O7M A;  4JB7 A;  1QJM A;  4H65 A;  4ZEC A;  3DP4 A;  3Q29 A;  4NED A;  2ZYM A;  2AIX A;  3I5O A;  5LTC A;  4ZEK A;  5H8H A;  5I56 A;  4O3B A;  1YXI A;  3AXF A;  4NG7 A;  3Q25 A;  1NV5 A;  4NF4 B;  1URG A;  1KA0 A;  2QVU A;  5J16 A;  2XWO A;  4N6D A;  4KFQ A;  3PV0 E;  3FD3 A;  5L8D A;  4IO7 A;  4M4G A;  3CHG A;  4N6K A;  2FIX A;  4YKK A;  3N6T A;  1Y1Z A;  3ZS6 A;  1EZO A;  1B0H A;  1N84 A;  4BDO A;  1IXG A;  5ICT A;  2WBB A;  1KWH A;  3CVG A;  4EF1 A;  3IO6 A;  4X1D A;  1OMP A;  4MLQ A;  4R6Y A;  4RNS A;  3RPW A;  4MAG A;  1JW1 A;  3MZ9 A;  3KJT A;  3KEI A;  3OXN A;  5EQ7 A;  3H6U A;  2Z8F A;  3QUJ A;  5EYG A;  1Q1K A;  1N3X A;  3O2A A;  5I2K B;  3FXR A;  4R9G A;  1FQF A;  1B7U A;  4PET A;  3E78 A;  5A5X A;  1VR5 A;  3HHG A;  4X04 A;  4PAI A;  1URS A;  3DP8 A;  1M5B A;  3VVF A;  3PUW E;  1B3F A;  4G8M A;  4GX3 A;  5HM4 B;  1B7Z A;  3IOV A;  3FVN A;  4XF5 A;  5IZ3 A;  1IMD A;  3VVD A;  3LV0 A;  4EQ7 A;  2I49 A;  4KHZ E;  1LEV A;  3GBB A;  5DEX B;  1G0I A;  3T66 A;  4JVI A;  3RQT A;  2UYE A;  3E13 X;  1IXH A;  3TDJ A;  3O6H A;  4DCX A;  4P47 A;  4PGN A;  5HBC A;  1WVJ A;  4PDH A;  5F24 A;  1MY3 A;  2GQ1 A;  2VT5 A;  5EHS A;  3LC8 A;  4NF0 A;  1G0H A;  3H7M A;  4WED A;  5DW8 A;  1DCU A;  1YPN A;  1F9B A;  3KC0 A;  4KQP A;  3D4G A;  3TYH A;  4LQ5 A;  4PC9 A;  4I3Y A;  3FVG A;  5T3J A;  4R72 A;  3GLB A;  3ONM A;  1LBB A;  3MW0 A;  4OES A;  5DYH A;  4F18 A;  3H6T A;  2I3W A;  1MXY A;  4BDL A;  3MPL A;  1QUL A;  3EHS A;  4H8I A;  1RYO A;  1B3G A;  2V3U A;  3UP9 A;  2Q2A A;  2Q9T A;  4LVQ A;  2F34 A;  1GR2 A;  1EU8 A;  1NUZ A;  1ZJL A;  4FAT A;  1I69 A;  2DE4 A;  4GL0 A;  3V8X B;  1FJ6 A;  2G29 A;  1D3K A;  1FBC A;  3B6W A;  1US5 A;  4KYD A;  2A5S A;  3LUZ A;  4HE0 A;  2B65 A;  1GVC A;  1P1N A;  3KSX A;  1FW0 A;  3E3K A;  5I2N B;  3OO8 A;  4LQ2 A;  1OIB A;  1TFA A;  1A7L A;  1B40 A;  1Y1M A;  3C4M A;  4JSD A;  2I3V A;  1RDZ A;  3HPI A;  1H3D A;  3PU5 A;  2DQV A;  2XXY A;  5H8Q A;  1SD3 A;  3FXQ A;  2YJP A;  2HZK A;  1AMF A;  1UQW A;  1NMU A;  2UXA A;  1YAE A;  1JVX A;  1XI6 A;  1FPG A;  1SDX A;  3I3V A;  4K3F A;  1IME A;  3FIR A;  3VFJ A;  1B2H A;  4HE1 A;  4PFI A;  1JVY A;  2XD2 A;  5EHM A;  2Q8M A;  4U1O A;  1B5H A;  3OOA A;  2F97 A;  1O7T A;  4PE5 B;  2X26 A;  5IKB A;  3EQ1 A;  2I48 A;  3S9N C;  5I3S A;  1UTB A;  3LBS A;  4P11 A;  1P99 A;  2D3I A;  1OVT A;  3MC2 A;  2F7A A;  4U23 A;  4LA9 A;  4LON B;  2VP1 A;  4H45 A;  5L9S A;  3IB2 A;  5AA2 D;  1DSN A;  4PFT A;  1I6A A;  1NNT A;  4H0W A;  1FPF A;  4G4P A;  4PBH A;  2WYP A;  4I40 A;  2QVV A;  4KYE A;  4G68 C;  4DCY A;  3SEV A;  1UTH B;  5BUU A;  3SER A;  2QPQ A;  4ISU A;  3MJN A;  4UAC A;  1NL5 A;  4QF9 A;  1EZ9 A;  3KJ7 A;  4OET A;  4PAK A;  3OEN A;  4QSD A;  1URD A;  1B7H A;  1CE2 A;  4M1V A;  1CB6 A;  3SES A;  3M8U A;  1NV7 A;  4U4S A;  3PPO A;  1ZKB A;  4GWS A;  1KA1 A;  5KCJ B;  3ODB A;  4GXA A;  3KBR A;  3DP6 A;  5KDT B;  5I58 B;  2H25 A;  2Q89 A;  3A3U A;  2A5T B;  1JW5 A;  4KR5 A;  1AWB A;  4RY1 A;  4JDF A;  5DT6 A;  2BJI A;  4HXV A;  1FTA A;  3HHF A;  3IR1 A;  3H4Z A;  3O97 A;  2QVR A;  4ONY A;  3LUY A;  1RDX A;  4JXI A;  1QKB A;  1NNP A;  1TWY A;  2VPN A;  3CR9 A;  4XKN A;  1B3L A;  2HFB A;  3K6W A;  1NNK A;  2ZYK A;  3TZA A;  4OQO A;  5H8N A;  2NWJ A;  5B7D A;  4QHQ A;  2Y7K A;  3TUS A;  3SEW A;  1H43 A;  3Q28 A;  1IMA A;  3OEK A;  3MVY A;  4XTC Q;  5JEI A;  4FE8 A;  5DVJ A;  3TCF A;  2UVH A;  4UAB A;  4ELQ A;  3NOH A;  1ZU0 A;  1RKM A;  2QL3 A;  3KN3 A;  1N7W A;  5AA1 A;  1SW5 A;  3QK6 A;  4GRK A;  4H46 A;  5K2Y A;  1B52 A;  3TTN A;  1NV0 A;  1ANF A;  2XWI A;  3S2V A;  1ZBM A;  4O3A A;  4OVT A;  4HE2 A;  2WX9 A;  1DPP A;  4JSO A;  4OVQ A;  2XXV A;  3K6X A;  4GWZ A;  3FUZ A;  4PCD A;  4OYV A;  3PD8 A;  1FBH A;  5CM6 A;  2DXY A;  1FQD A;  1SVX B;  2RC7 A;  2V3T A;  4FAJ A;  3IB0 A;  4H6D A;  2B4L A;  4NAP A;  2O69 A;  3QSL A;  1NV4 A;  3RGY A;  1YTV A;  4R9F A;  2RF1 A;  4HCW A;  3UGW A;  3RN8 A;  3UIF A;  3H06 B;  4PQJ A;  4H67 A;  1H76 A;  4OER A;  4R73 A;  2Y7R A;  5L9O A;  3BBR A;  3GYY A;  3N26 A;  2ZYO A;  2HAV A;  3FV2 A;  4N4U A;  4YMA A;  1BKA A;  1DMB A;  2DS9 A;  3T9V A;  4DDD A;  5AA2 B;  4F1V A;  4HW8 A;  2OZZ A;  2O51 A;  3EKI A;  2FA7 A;  5TP9 B;  1PEB A;  4PF8 A;  2RKM A;  1DBZ A;  5LDZ A;  3LSL A;  2G93 A;  4MFI A;  4P0G A;  4OVP A;  1MXU A;  1FPJ A;  4GWY A;  3E4R A;  5CI5 A;  4RYA A;  1VFD A;  4FBP A;  3MBP A;  2QSX A;  2ZNU A;  5EQ8 A;  4OVR A;  3LR1 A;  4Q30 B;  3O6I A;  3KSJ A;  4GF8 A;  1B1X A;  1QKA A;  1MXZ A;  2KR0 A;  2QS3 A;  1O63 A;  1XVX A;  5ISU A;  1Y3N A;  3V89 B;  1PBP A;  1S9T A;  4RPO A;  5FHN A;  4QRZ A;  2R6G E;  1MRP A;  3MYU A;  4QSC A;  4EXK A;  2OWT A;  2V93 A;  4G68 A;  1MG1 A;  1B05 A;  1MY0 A;  3KOT A;  4QFN A;  4JWX A;  2F3D A;  1S50 A;  5JTY B;  5K2X A;  4F29 A;  4XFE A;  4LZ7 A;  1FTM A;  3G3F A;  3T22 A;  1AL3 A;  2XXU A;  4ZE8 A;  4F1U A;  1LBZ A;  4KD5 A;  4TLM B;  3IL1 B;  3PUX E;  1IXC A;  3OO6 A;  1A40 A;  4EXL A;  3RY3 A;  3CFL A;  2XXW A;  3C34 A;  4AB5 A;  4PE3 A;  5H8S A;  3R26 A;  4DIG A;  2ZNS A;  2HAU A;  4MCO A;  1MDQ A;  4YKI A;  4AS4 A;  4JVC A;  3EHT A;  4NF6 A;  3M3L A;  1FPI A;  3R6U A;  4F19 A;  4F2O A;  2I0C A;  4ZZE A;  1NH8 A;  2FVZ A;  1QUJ A;  3Q27 A;  3SZP A;  3LSX A;  5M2V A;  3OEL A;  1LST A;  3BIH A;  1J1N A;  3FAT A;  1Q35 A;  4PFB A;  1FPL A;  3DEL B;  5AA4 B;  2IEE A;  3PUY E;  3N94 A;  4E0W A;  2UYF A;  2Y7P A;  2P0S A;  5FTI A;  1FPD A;  4ZDM A;  1FBP A;  3FXU A;  2VGQ A;  3B6Q A;  3DLN A;  2O6A A;  2ZZV A;  1UIV A;  3PD9 A;  3VXC A;  4N15 A;  4N13 A;  3T9H B;  3RNN A;  4KPT A;  4HCY A;  2O84 X;  3A29 A;  2I58 A;  4EQB A;  2O7U A;  1YCJ A;  2F35 A;  2OWZ A;  4GWW A;  1OLC A;  4RJZ A;  4YMB A;  1FTL A;  3H03 A;  1A99 A;  4I9D A;  1FPB A;  2V25 A;  4KCC A;  4MBP A;  4POX A;  5EQA A;  3L6G A;  1IIW A;  4FEB A;  1Y3Q A;  3VLW A;  1P1O A;  4NWD A;  4PF6 A;  3EPE A;  1BLF A;  2F6P A;  1DK4 A;  4NQ8 A;  1PBQ A;  2AYS A;  3PPR A;  2XA5 A;  2Z8D A;  2I0B A;  2R8T A;  1VDW A;  1D4N A;  4N8G A;  5TPA A;  1DPE A;  1D9Q A;  3ROJ A;  2HHM A;  3K00 A;  4NF5 A;  3O9P A;  1SQY A;  1XC1 A;  3EN3 A;  4U1Z A;  4X9T A;  3ILU B;  4N8Y A;  1IZ1 A;  3RLF E;  1GGG A;  1M5C A;  3L6H A;  5FHO A;  4F22 A;  2ZZW A;  4G61 A;  1EH3 A;  4DZ1 A;  5A5X B;  2DXR A;  4LZ5 A;  1FPK A;  3EHU A;  3W15 C;  2H5Y A;  2ALU A;  3C9H A;  3CI8 A;  2UVI A;  4GXS B;  5H8F A;  5IGA A;  4GIZ A;  1ZIU A;  2OWS A;  4O8M A;  5CMM A;  3TTM A;  2PFZ A;  1EYK A;  4MX6 A;  1WOD A;  2E0S A;  4Z7E A;  1H44 A;  1SYH A;  1NUY A;  3RPL A;  5DVF A;  4MJO A;  2DSF A;  2VHA A;  2FBP A;  3I6V A;  1B5J A;  4MNP A;  1Y4T A;  4G77 A;  4ELO A;  4TOZ A;  2VPO A;  4I1D A;  4R6K A;  3CFX A;  4RA1 A;  3BFU A;  1SPI A;  1B1H A;  5IZ1 A;  2FHY A;  3PMW A;  5IZZ A;  1AH5 A;  3MAM A;  1FBF A;  5ESY A;  4G2Z A;  4AB6 A;  1B6H A;  1A8F A;  2V4C A;  3MZB A;  3G3G A;  1LGB C;  4MIJ A;  4U2R A;  3ZSF A;  1MH3 A;  1FSA A;  3LSF B;  1UTH A;  1EYI A;  1PB7 A;  5CMC A;  3TTR A;  3EF7 A;  2QJE A;  4P1E A;  2FNC A;  4R2B A;  3IOT A;  1LB8 A;  1OLA A;  3OSQ A;  3VVE A;  1B0L A;  3TTK A;  4TQU Q;  2XXR A;  2RC8 A;  3OMB A;  4BLA A;  3MPK A;  4G8N A;  4O3C A;  3JYR A;  3U93 A;  2Q74 A;  2WEF A;  1MPD A;  1NV6 A;  4IR8 A;  1BIY A;  4LZ8 A;  2ZNT A;  1MY4 A;  1L5T A;  1JNF A;  2Y84 A;  4YU0 A;  5CMB A;  2DWH A;  4DXC A;  4MLV A;  3MUQ A;  1B5I A;  3O28 A;  4OVS A;  1N7X A;  3MVW A;  2D21 A;  5I7I A;  1LBC A;  4L17 A;  2WYK A;  4NX1 A;  4YB6 A;  5EQ9 A;  2XXX A;  5I57 A;  4ECF A;  5H8Q B;  4QFP A;  3KN7 A;  3U72 A;  4C1T A;  2B3F A;  2P2A A;  1IUD A;  1FRP A;  3C32 A;  2ONS A;  4RK2 A;  4ESW A;  4MF3 A;  4EUO A;  4H8J A;  2DVZ A;  1M5E A;  5IM2 A;  3TTL A;  4R74 A;  4PFW A;  3KBZ A;  2CZI A;  2NXO A;  4OAN A;  4YAH X;  1AIV A;  1NKX A;  1ELJ A;  2PT1 A;  1LCT A;  3VXB A;  1NV2 A;  3IJX B;  2THI A;  2O1M A;  3FV1 A;  4GWX A;  2CEY A;  4DXU A;  3S9M C;  4GLI A;  3TQW A;  1IEJ A;  4NE4 A;  2XXH A;  2CZK A;  4JVD A;  4EF2 A;  2FIE A;  2I4C A;  3MP6 A;  2DP8 A;  5ITO A;  3V5A A;  4NTL A;  1ATG A;  3TCG A;  4Z0I A;  1LAF E;  3A09 A;  1IMF A;  3FXB A;  3IB1 A;  3B6T A;  2XXK A;  1N76 A;  3PMV A;  3CSG A;  1KZ8 A;  5EYH A;  3D1R A;  1NV1 A;  2Z22 A;  1P1W A;  1I6B A;  3U8Q A;  4TLL B;  4RPN A;  5CMK A;  3IX1 A;  3QAX A;  1SW2 A;  2GHA A;  4MH5 A;  1Y4C A;  3RYD A;  3IO4 A;  2RC9 A;  1K9Y A;  4NF8 A;  3TFL A;  3ILT B;  1Y3P A;  3CIJ A;  4GFR A;  4F3B A;  3BFT A;  3CRB A;  4QSE A;  1FBD A;  2REJ A;  1FQC A;  5I59 A;  1TXF A;  2P1S A;  2KLF A;  4I62 A;  3IAZ A;  2DYX A;  3G3K A;  4MNC A;  1QGX A;  4OFJ A;  4P0I A;  3RUM A;  1RYX A;  3TEL A;  5FTH A;  1NUX A;  4GX6 A;  3HFU A;  1MS7 A;  2HPG A;  3SET A;  4ZEI A;  5H8N B;  2QS4 A;  5A5L A;  5FBP A;  1MPB A;  1BK4 A;  2Y5K A;  1B3E A;  1LBY A;  4MHF A;  2F7C A;  4OEU A;  1BTJ A;  4ZEB A;  1R9L A;  2QMX A;  4PTK A;  1FBG A;  4QXD A;  4OEV A;  3KOS A;  2DE3 A;  2HEU A;  3P7I A;  2WBD A;  4KI0 E;  4GL8 A;  3RT8 A;  2RCB A;  1CNQ A;  3W9V A;  2HZL A;  1MXX A;  2ESN A;  3MVX A;  2XWV A;  2Z23 A;  4LP2 B;  4C0R A;  1YZ0 A;  4ZZA A;  3GZG A;  1GTK A;  1B9J A;  4F31 B;  1A55 A;  1FTK A;  1TFD A;  2XHD A;  4BDN A;  2Y7W A;  3FBP A;  1EYJ A;  1LCF A;  1BP5 A;  4ND9 A;  3D4C A;  2DE2 A;  3ISP A;  4PFU A;  2OCU A;  4XXU A;  3GBA A;  2JJK A;  3O29 A;  2RCA A;  3UK4 A;  3Q26 A;  2P3N A;  4QFL A;  4Q8R A;  3CFZ A;  1Z7N E;  3QMF A;  1LAH E;  5TU0 A;  4IO3 A;  4I3E A;  1D9Y A;  2F3B A;  3IK6 B;  3H6W A;  2R9J A;  4IB2 A;  2RIN A;  2CZH A;  4XKR A;  4NF4 A;  3MP8 A;  3KFM A;  2OK2 A;  3UOR A;  1B3H A;  2H99 A;  3PMX A;  2F36 A;  2ONK E;  4OZ9 A;  5CRY A;  1QW0 A;  4GX4 A;  1MQJ A;  4H5F A;  5AA4 A;  4MEV A;  3MQ9 A;  4OVJ A;  4BDM A;  2ZZX A;  2B4M A;  3KC1 A;  3S4U A;  2F8D A;  1QUK A;  4KYS A;  2WKY A;  3KN8 A;  3H3G A;  3G3J A;  4F39 A;  3OO9 A;  4R6H A;  3QUF A;  4IO6 A;  4OXV A;  1T0K A;  2QS1 A;  3ZKK A;  4X8R A;  4AQ4 A;  1D9V A;  4OFL A;  2DWI A;  1LBW A;  2V84 A;  2AL4 A;  1Z7M E;  5I2K A;  3TEP A;  1DOT A;  1HSE A;  2F5X A;  2GRV A;  4RXL A;  5EYF A;  1MXV A;  4MMP A;  1H45 A;  3A3C A;  3IJO B;  4ZE9 A;  4YKP A;  2OX3 A;  5JK4 A;  1FPE A;  2AL5 A;  3OD7 A;  4F2Q A;  4G68 B;  3SEY A;  3HST A;  3FJ7 A;  4I8C A;  3UA8 A;  4U21 A;  3S9L C;  3TOD A;  2BJJ X;  3OEM A;  5DEX A;  3FVK A;  1VSO A;  2PFY A;  5IAI A;  3MZ1 A;  2OJT A;  4N81 A;  1SBP A;  2XWK A;  3CG1 A;  5L9M A;  4IGR A;  4LUB A;  2I4B A;  2GFE A;  2YPN A;  2ABH A;  2H4I A;  3T0J A;  3QIM A;  1QVS A;  2NOO A;  5I5P A;  3IFA A;  4F3G A;  4O7I A;  1XT8 A;  3TAJ A;  2OLB A;  3K2D A;  1K9Z A;  3S9E A;  1MY1 A;  1II5 A;  1USY E;  5F7V A;  2QFL A;  2XXI A;  2ZYN A;  1LFG A;  3R7X A;  2YLN A;  1NUW A;  4DI4 B;  3CSB A;  4NF6 B;  3FJG A;  5H8H B;  5I56 B;  5KZT A;  2Q88 A;  4G8H A;  1JEU A;  3O6G A;  3MVZ A;  1UIU A;  1MQG A;  2O7I A;  4AS5 A;  1PB9 A;  3OO7 A;  4OEN A;  2PBW A;  2DDK A;  1FTO A;  3PUV E;  3VDF A;  4GQO A;  4R75 A;  2X7P A;  3TCH A;  2UVG A;  5I2N A;  4QBA A;  2CZL A;  2XXT A;  1R1N A;  3PPP A;  4EQ9 A;  3KGC A;  5I84 A;  3H6V A;  3USD A;  2PYY A;  1USY H;  1B58 A;  3IOW A;  1ZLQ A;  5CBS A;  4Q0C A;  5DVI A;  4DE8 A;  1SW1 A;  4YB5 A;  2VD3 A;  2F6G A;  2PMS A;  4DXB A;  2D5W A;  4POW A;  2MKZ A;  3VLU A;  1MH4 A;  3C31 A;  2XD3 A;  1DTZ A;  3RT6 B;  1RDY A;  2ONR A;  1MY2 A;  4XKP A;  3DM0 A;  1M5D A;  4GVO A;  2O1L A;  3THI A;  1LBV A;  4UA8 A;  4THI A;  4Q5T A;  3N6U A;  4H1X A;  2HXR A;  5IZ3 B;  4IO2 A;  1LFI A;  2NUV A;  2E1S A;  5AE4 A;  3N5L A;  3V83 A;  4IO4 A;  1NI9 A;  1P1U A;  3FVO A; 
#chains in the Genus database with same CATH homology
 3BKI B;  4PP0 A;  3PPQ A;  3G7W A;  3E9X A;  1IQ7 A;  1FCK A;  1OQH A;  3U94 A;  3K02 A;  5HPQ A;  2LAO A;  4GWO A;  2I6E A;  1JEV A;  2GH9 A;  5TPA B;  4HTG A;  3VV5 A;  1HSJ A;  2FYI A;  2X7Q A;  4FIM A;  4NF5 B;  4ZEF A;  4JBZ A;  3PPN A;  2Z8E A;  3O66 A;  3ECR A;  5ELV A;  3B7D A;  5CC2 A;  3TQL A;  3VLV A;  2Q8J A;  2XXP A;  4F3S A;  2XXQ A;  4YIC A;  3RTW B;  3JV9 A;  2R71 A;  4FOR A;  1FQA A;  1N3W A;  5AA3 A;  3T93 B;  2F78 A;  4DLD A;  5KCJ A;  2PVU A;  5KDT A;  1FQB A;  5H8F B;  1NNF A;  5I58 A;  2VOZ A;  4IY6 A;  4C1U A;  3MP1 A;  5DTB A;  2A5T A;  3ZKL A;  1B32 A;  1MM6 A;  2M8C A;  1N0T A;  4WXJ A;  1PB8 A;  2CMO A;  1MXW A;  1Y20 A;  2NVU B;  1Y9U A;  1NFT A;  2DWA A;  1JET A;  3WAF A;  3M3F A;  1SI1 A;  2GHB A;  3G3I A;  1VE4 A;  2PX1 A;  1LB9 A;  3SDF A;  3IOU A;  1LAG E;  3SEX A;  4U22 A;  4XIG Q;  4NWC A;  1FQE A;  3G3H A;  4LAT A;  4OHN A;  1MQD A;  1O64 A;  3TKD A;  1DTG A;  4QFO A;  1VFE A;  3IOR A;  3HN0 A;  5J1D A;  4ZED A;  3HV1 A;  4JWO A;  5F1Q A;  1IIT A;  3PGF A;  2IA4 A;  1EZP A;  1UTB B;  4BDQ A;  3HO7 A;  2ANJ A;  1B4H A;  2XX8 A;  4YZZ A;  4XKQ A;  1JW4 A;  1POT A;  2HQ0 A;  3PUZ E;  1GV8 A;  3RTF B;  4IGT A;  4F1Y A;  4QFK A;  1OVB A;  5I57 B;  2HCA A;  3TMG A;  1XHY A;  4GOT A;  1R9Q A;  2F7B A;  1P1Q A;  2ZMB A;  3K6U A;  4FEC A;  5ICQ A;  1QUI A;  1A8E A;  3C36 A;  3K0V A;  4ZS9 A;  1NH7 A;  3W9W A;  4ELR A;  1LLS A;  1MDP 1;  4FJP A;  2XX7 A;  2H9B A;  2DOJ A;  3F11 A;  4JWY A;  1MPC A;  3K01 A;  5AA2 A;  2W7Y A;  1PDA A;  4HS7 A;  3U1O A;  5TP9 A;  3K4U A;  1FTJ A;  4OFO A;  3CG3 A;  3U92 A;  1POY 1;  3C35 A;  4OTE A;  1SI0 A;  3K6V A;  4N6P A;  4H5G A;  3K1P A;  5LOM A;  2B3B A;  3QYT A;  1ZMG A;  2HXW A;  3FJM A;  3JZJ A;  4X1B A;  4IO5 A;  3FAS A;  1S7Y A;  4U4X A;  2XX9 A;  3FGS A;  5B70 A;  5JTY A;  4NF8 B;  1XOC A;  1SYI A;  2ZXT A;  3FZV A;  3KZG A;  2Y7I A;  1LFH A;  1XVY A;  5I59 B;  2DVC A;  4YKJ A;  3T9U A;  1MM7 A;  4GD5 A;  3WAE A;  5ITP A;  2O68 A;  5FHM A;  1SW4 A;  2VD2 A;  4IY5 A;  4WEP A;  1US4 A;  4OWD A;  4WKM A;  1TT1 A;  4KCD A;  5BWJ A;  2H98 A;  4N07 A;  2QRY A;  3GXA A;  1PC3 A;  4R2F A;  3K1N A;  5CBR A;  3K1M A;  3T96 B;  2OBG A;  3TPA A;  1WDN A;  2DWJ A;  4X48 A;  4ESX A;  1B4Z A;  4F3P A;  3LSW A;  1B51 A;  2UVJ A;  3HCQ A;  3MWB A;  1A54 A;  4RK9 A;  1B46 A;  4OMB A;  2QS2 A;  4E0X A;  1HSL A;  4BDR A;  2REG A;  1JQF A;  4FED A;  4YB7 A;  1N04 A;  3C33 A;  1R6Z A;  3T9X B;  1ZTY A;  1I6Q A;  2QMW A;  3KG2 A;  3UN6 A;  4EDP A;  1M5F A;  2Q2C A;  1MQI A;  3SEU A;  4PFY A;  2V3Q A;  1IXI A;  3M3K A;  1AOV A;  4NMY A;  1OQG A;  4ELP A;  3OSR A;  1XS5 A;  1LAX A;  1MQH A;  3QXM A;  3VE1 B;  2PT2 A;  3SKP A;  4JB7 A;  1QJM A;  4H65 A;  4ZEC A;  3DP4 A;  3Q29 A;  4NED A;  2ZYM A;  2AIX A;  3I5O A;  4ZEK A;  5H8H A;  5I56 A;  4O3B A;  3AXF A;  3Q25 A;  4NF4 B;  1URG A;  4KFQ A;  3PV0 E;  3FD3 A;  5L8D A;  4IO7 A;  4M4G A;  4YKK A;  3N6T A;  1Y1Z A;  3ZS6 A;  1EZO A;  1B0H A;  1N84 A;  4BDO A;  1IXG A;  5ICT A;  1KWH A;  3CVG A;  4EF1 A;  3IO6 A;  4X1D A;  1OMP A;  4MLQ A;  4R6Y A;  4RNS A;  3RPW A;  1JW1 A;  3MZ9 A;  3KJT A;  3KEI A;  3OXN A;  3H6U A;  2Z8F A;  3QUJ A;  1Q1K A;  1N3X A;  3O2A A;  5I2K B;  3FXR A;  4R9G A;  1FQF A;  1B7U A;  4PET A;  5A5X A;  1VR5 A;  3HHG A;  1URS A;  3DP8 A;  1M5B A;  3VVF A;  3PUW E;  1B3F A;  4G8M A;  5HM4 B;  1B7Z A;  3IOV A;  3FVN A;  3VVD A;  4EQ7 A;  2I49 A;  4KHZ E;  3GBB A;  5DEX B;  3T66 A;  3RQT A;  2UYE A;  3E13 X;  1IXH A;  3TDJ A;  3O6H A;  4DCX A;  5HBC A;  1WVJ A;  1MY3 A;  5EHS A;  3LC8 A;  3H7M A;  4WED A;  1YPN A;  1F9B A;  4KQP A;  3D4G A;  3TYH A;  4LQ5 A;  3FVG A;  4R72 A;  3GLB A;  3ONM A;  1LBB A;  3MW0 A;  4OES A;  5DYH A;  4F18 A;  3H6T A;  2I3W A;  1MXY A;  4BDL A;  3MPL A;  1QUL A;  3EHS A;  4H8I A;  1RYO A;  1B3G A;  2V3U A;  3UP9 A;  2Q2A A;  2Q9T A;  4LVQ A;  2F34 A;  1GR2 A;  1EU8 A;  1ZJL A;  4FAT A;  1I69 A;  2DE4 A;  4GL0 A;  3V8X B;  2G29 A;  1D3K A;  3B6W A;  1US5 A;  4KYD A;  2A5S A;  2B65 A;  1GVC A;  1P1N A;  3KSX A;  1FW0 A;  3E3K A;  5I2N B;  3OO8 A;  4LQ2 A;  1OIB A;  1TFA A;  1A7L A;  1B40 A;  1Y1M A;  3C4M A;  4JSD A;  2I3V A;  3HPI A;  1H3D A;  3PU5 A;  2DQV A;  2XXY A;  5H8Q A;  1SD3 A;  3FXQ A;  2YJP A;  2HZK A;  1AMF A;  1UQW A;  1NMU A;  2UXA A;  1YAE A;  1JVX A;  1SDX A;  3I3V A;  4K3F A;  3FIR A;  3VFJ A;  1B2H A;  1JVY A;  2XD2 A;  5EHM A;  4U1O A;  1B5H A;  3OOA A;  2F97 A;  1O7T A;  4PE5 B;  2X26 A;  5IKB A;  3EQ1 A;  2I48 A;  3S9N C;  1UTB A;  3LBS A;  4P11 A;  1P99 A;  2D3I A;  1OVT A;  3MC2 A;  2F7A A;  4U23 A;  4LA9 A;  4LON B;  2VP1 A;  5L9S A;  3IB2 A;  5AA2 D;  1DSN A;  4PFT A;  1I6A A;  1NNT A;  4H0W A;  4G4P A;  4KYE A;  4G68 C;  4DCY A;  3SEV A;  1UTH B;  5BUU A;  3SER A;  2QPQ A;  4ISU A;  3MJN A;  4UAC A;  1NL5 A;  4QF9 A;  1EZ9 A;  3KJ7 A;  4OET A;  3OEN A;  4QSD A;  1URD A;  1B7H A;  1CE2 A;  4M1V A;  1CB6 A;  3SES A;  3M8U A;  4U4S A;  3PPO A;  1ZKB A;  5KCJ B;  3ODB A;  4GXA A;  3KBR A;  3DP6 A;  5KDT B;  5I58 B;  2H25 A;  2Q89 A;  3A3U A;  2A5T B;  1JW5 A;  4KR5 A;  4RY1 A;  4JDF A;  5DT6 A;  3HHF A;  3IR1 A;  3H4Z A;  3O97 A;  4ONY A;  3LUY A;  4JXI A;  1QKB A;  1NNP A;  1TWY A;  3CR9 A;  4XKN A;  1B3L A;  2HFB A;  3K6W A;  1NNK A;  2ZYK A;  3TZA A;  4OQO A;  5H8N A;  2NWJ A;  5B7D A;  4QHQ A;  2Y7K A;  3TUS A;  3SEW A;  1H43 A;  3Q28 A;  3OEK A;  3MVY A;  4XTC Q;  5JEI A;  4FE8 A;  5DVJ A;  3TCF A;  2UVH A;  4ELQ A;  1ZU0 A;  1RKM A;  2QL3 A;  3KN3 A;  1N7W A;  5AA1 A;  1SW5 A;  3QK6 A;  4GRK A;  5K2Y A;  1B52 A;  3TTN A;  1ANF A;  3S2V A;  1ZBM A;  4O3A A;  1DPP A;  4JSO A;  2XXV A;  3K6X A;  3FUZ A;  4OYV A;  3PD8 A;  5CM6 A;  2DXY A;  1FQD A;  1SVX B;  2RC7 A;  2V3T A;  4FAJ A;  3IB0 A;  4H6D A;  2O69 A;  3QSL A;  3RGY A;  1YTV A;  4R9F A;  2RF1 A;  4HCW A;  3UGW A;  3RN8 A;  3UIF A;  3H06 B;  4PQJ A;  4H67 A;  1H76 A;  4OER A;  4R73 A;  2Y7R A;  5L9O A;  3BBR A;  3N26 A;  2ZYO A;  2HAV A;  3FV2 A;  4YMA A;  1BKA A;  1DMB A;  2DS9 A;  3T9V A;  4DDD A;  5AA2 B;  4F1V A;  4HW8 A;  2OZZ A;  2O51 A;  2FA7 A;  5TP9 B;  1PEB A;  2RKM A;  3LSL A;  2G93 A;  4MFI A;  4P0G A;  1MXU A;  3E4R A;  5CI5 A;  4RYA A;  1VFD A;  3MBP A;  2QSX A;  2ZNU A;  3LR1 A;  4Q30 B;  3O6I A;  3KSJ A;  4GF8 A;  1B1X A;  1QKA A;  1MXZ A;  2QS3 A;  1O63 A;  1XVX A;  5ISU A;  1Y3N A;  3V89 B;  1PBP A;  1S9T A;  4RPO A;  5FHN A;  4QRZ A;  2R6G E;  1MRP A;  4QSC A;  4EXK A;  2OWT A;  2V93 A;  4G68 A;  1MG1 A;  1B05 A;  1MY0 A;  3KOT A;  4QFN A;  4JWX A;  1S50 A;  5JTY B;  5K2X A;  4F29 A;  4LZ7 A;  1FTM A;  3G3F A;  3T22 A;  1AL3 A;  2XXU A;  4ZE8 A;  4F1U A;  4KD5 A;  4TLM B;  3IL1 B;  3PUX E;  1IXC A;  3OO6 A;  1A40 A;  4EXL A;  3RY3 A;  3CFL A;  2XXW A;  3C34 A;  4AB5 A;  5H8S A;  3R26 A;  4DIG A;  2ZNS A;  2HAU A;  1MDQ A;  4YKI A;  3EHT A;  4NF6 A;  3M3L A;  3R6U A;  4F19 A;  4F2O A;  2I0C A;  4ZZE A;  1NH8 A;  1QUJ A;  3Q27 A;  3LSX A;  5M2V A;  3OEL A;  1LST A;  1J1N A;  3FAT A;  1Q35 A;  3DEL B;  5AA4 B;  2IEE A;  3PUY E;  3N94 A;  4E0W A;  2UYF A;  2Y7P A;  2P0S A;  5FTI A;  4ZDM A;  3FXU A;  2VGQ A;  3B6Q A;  3DLN A;  2O6A A;  1UIV A;  3PD9 A;  3VXC A;  4N13 A;  3T9H B;  3RNN A;  4KPT A;  4HCY A;  2O84 X;  2I58 A;  4EQB A;  2O7U A;  1YCJ A;  2F35 A;  1OLC A;  4RJZ A;  4YMB A;  1FTL A;  3H03 A;  1A99 A;  4I9D A;  4KCC A;  2V25 A;  4MBP A;  4POX A;  3L6G A;  1IIW A;  4FEB A;  1Y3Q A;  3VLW A;  1P1O A;  4NWD A;  3EPE A;  1BLF A;  2F6P A;  1PBQ A;  2AYS A;  3PPR A;  2Z8D A;  2I0B A;  1D4N A;  5TPA A;  1DPE A;  3K00 A;  4NF5 A;  3O9P A;  1SQY A;  1XC1 A;  3EN3 A;  4U1Z A;  4X9T A;  3ILU B;  1IZ1 A;  3RLF E;  1GGG A;  1M5C A;  3L6H A;  5FHO A;  4F22 A;  1EH3 A;  4DZ1 A;  5A5X B;  2DXR A;  4LZ5 A;  3EHU A;  3W15 C;  2H5Y A;  2ALU A;  3C9H A;  3CI8 A;  2UVI A;  4GXS B;  5H8F A;  4GIZ A;  1ZIU A;  2OWS A;  5CMM A;  3TTM A;  1WOD A;  2E0S A;  4Z7E A;  1H44 A;  1SYH A;  5DVF A;  2DSF A;  2VHA A;  3I6V A;  1B5J A;  1Y4T A;  4G77 A;  4ELO A;  4TOZ A;  4I1D A;  4R6K A;  3CFX A;  4RA1 A;  3BFU A;  1B1H A;  3PMW A;  1AH5 A;  3MAM A;  4G2Z A;  4AB6 A;  1B6H A;  1A8F A;  3MZB A;  3G3G A;  1LGB C;  4U2R A;  3ZSF A;  1MH3 A;  3LSF B;  1UTH A;  1PB7 A;  5CMC A;  3TTR A;  3EF7 A;  2QJE A;  2FNC A;  4R2B A;  3IOT A;  1LB8 A;  1OLA A;  3OSQ A;  3VVE A;  1B0L A;  3TTK A;  4TQU Q;  2XXR A;  2RC8 A;  3OMB A;  4BLA A;  3MPK A;  4G8N A;  4O3C A;  3JYR A;  3U93 A;  1MPD A;  1BIY A;  4LZ8 A;  2ZNT A;  1MY4 A;  1L5T A;  1JNF A;  2Y84 A;  4YU0 A;  5CMB A;  2DWH A;  4DXC A;  4MLV A;  3MUQ A;  1B5I A;  3O28 A;  1N7X A;  3MVW A;  2D21 A;  1LBC A;  4L17 A;  4YB6 A;  2XXX A;  5I57 A;  4ECF A;  5H8Q B;  4QFP A;  3KN7 A;  3U72 A;  4C1T A;  2B3F A;  2P2A A;  1IUD A;  3C32 A;  2ONS A;  4RK2 A;  4ESW A;  4MF3 A;  4EUO A;  4H8J A;  2DVZ A;  1M5E A;  3TTL A;  4R74 A;  4PFW A;  2NXO A;  4YAH X;  1AIV A;  1NKX A;  1ELJ A;  2PT1 A;  1LCT A;  3VXB A;  3IJX B;  2THI A;  2O1M A;  3FV1 A;  4DXU A;  3S9M C;  4GLI A;  3TQW A;  1IEJ A;  4NE4 A;  2XXH A;  4EF2 A;  2I4C A;  3MP6 A;  2DP8 A;  5ITO A;  3V5A A;  4NTL A;  1ATG A;  3TCG A;  4Z0I A;  1LAF E;  3A09 A;  3IB1 A;  3B6T A;  1N76 A;  3PMV A;  3CSG A;  2Z22 A;  1P1W A;  1I6B A;  3U8Q A;  4TLL B;  4RPN A;  5CMK A;  3IX1 A;  3QAX A;  1SW2 A;  2GHA A;  4MH5 A;  1Y4C A;  3IO4 A;  2RC9 A;  4NF8 A;  3TFL A;  3ILT B;  1Y3P A;  3CIJ A;  4GFR A;  4F3B A;  3BFT A;  3CRB A;  4QSE A;  2REJ A;  1FQC A;  5I59 A;  1TXF A;  2P1S A;  2KLF A;  4I62 A;  3IAZ A;  2DYX A;  3G3K A;  4OFJ A;  4P0I A;  3RUM A;  1RYX A;  3TEL A;  5FTH A;  1MS7 A;  3SET A;  4ZEI A;  5H8N B;  2QS4 A;  1MPB A;  1B3E A;  2F7C A;  4OEU A;  1BTJ A;  4ZEB A;  1R9L A;  2QMX A;  4OEV A;  3KOS A;  2DE3 A;  2HEU A;  3P7I A;  4KI0 E;  4GL8 A;  3RT8 A;  2RCB A;  3W9V A;  2HZL A;  1MXX A;  2ESN A;  3MVX A;  2Z23 A;  4LP2 B;  4C0R A;  4ZZA A;  3GZG A;  1GTK A;  1B9J A;  4F31 B;  1A55 A;  1FTK A;  1TFD A;  2XHD A;  4BDN A;  2Y7W A;  1LCF A;  1BP5 A;  4ND9 A;  3D4C A;  2DE2 A;  4PFU A;  2OCU A;  4XXU A;  3GBA A;  3O29 A;  2RCA A;  3UK4 A;  3Q26 A;  4QFL A;  4Q8R A;  3CFZ A;  1Z7N E;  1LAH E;  5TU0 A;  4IO3 A;  1D9Y A;  3IK6 B;  3H6W A;  2R9J A;  4IB2 A;  2RIN A;  4XKR A;  4NF4 A;  3MP8 A;  3KFM A;  3UOR A;  2OK2 A;  1B3H A;  2H99 A;  3PMX A;  2F36 A;  2ONK E;  4OZ9 A;  5CRY A;  1QW0 A;  1MQJ A;  4H5F A;  5AA4 A;  3MQ9 A;  4OVJ A;  4BDM A;  3S4U A;  2F8D A;  1QUK A;  4KYS A;  2WKY A;  3KN8 A;  3H3G A;  3G3J A;  4F39 A;  3OO9 A;  4R6H A;  3QUF A;  4IO6 A;  4OXV A;  1T0K A;  2QS1 A;  3ZKK A;  4AQ4 A;  1D9V A;  4OFL A;  2DWI A;  2V84 A;  2AL4 A;  1Z7M E;  5I2K A;  3TEP A;  1DOT A;  1HSE A;  2F5X A;  2GRV A;  4RXL A;  5EYF A;  1MXV A;  1H45 A;  3A3C A;  3IJO B;  4ZE9 A;  4YKP A;  5JK4 A;  2AL5 A;  3OD7 A;  4F2Q A;  4G68 B;  3SEY A;  3HST A;  3FJ7 A;  4I8C A;  3UA8 A;  4U21 A;  3S9L C;  3TOD A;  2BJJ X;  3OEM A;  5DEX A;  3FVK A;  1VSO A;  5IAI A;  3MZ1 A;  2OJT A;  1SBP A;  3CG1 A;  5L9M A;  4IGR A;  4LUB A;  2I4B A;  2GFE A;  2YPN A;  2ABH A;  2H4I A;  3QIM A;  1QVS A;  2NOO A;  4F3G A;  1XT8 A;  3TAJ A;  2OLB A;  3K2D A;  3S9E A;  1MY1 A;  1II5 A;  1USY E;  5F7V A;  2XXI A;  2ZYN A;  1LFG A;  3R7X A;  2YLN A;  3CSB A;  4NF6 B;  3FJG A;  5H8H B;  5I56 B;  5KZT A;  2Q88 A;  4G8H A;  1JEU A;  3O6G A;  3MVZ A;  1UIU A;  1MQG A;  2O7I A;  1PB9 A;  3OO7 A;  4OEN A;  2PBW A;  1FTO A;  3PUV E;  3VDF A;  4GQO A;  4R75 A;  2X7P A;  3TCH A;  2UVG A;  5I2N A;  2CZL A;  2XXT A;  1R1N A;  3PPP A;  4EQ9 A;  3KGC A;  5I84 A;  3H6V A;  3USD A;  2PYY A;  1USY H;  1B58 A;  3IOW A;  1ZLQ A;  5CBS A;  4Q0C A;  5DVI A;  4DE8 A;  1SW1 A;  4YB5 A;  2VD3 A;  2F6G A;  2PMS A;  4DXB A;  2D5W A;  4POW A;  3VLU A;  1MH4 A;  3C31 A;  2XD3 A;  1DTZ A;  3RT6 B;  2ONR A;  1MY2 A;  4XKP A;  3DM0 A;  1M5D A;  4GVO A;  2O1L A;  3THI A;  4UA8 A;  4THI A;  4Q5T A;  3N6U A;  4H1X A;  4IO2 A;  1LFI A;  2NUV A;  2E1S A;  5AE4 A;  3N5L A;  3V83 A;  4IO4 A;  1P1U A;  3FVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...