2A5ZA

Crystal structure of protein of unknown function so2946 from shewanella oneidensis mr-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
TTPGLMSPSEKLKLSTLTTSIATSDFYASYDFMMHSIGLTSANNISLLSTGNISLQNILSEGNHFGVQPIVSSTTANASFLAGMLMAIFPKESELEVTVYFKTPSAFNPAQLTVIGSTSIGLGISDRSGLIIENGNAFGGIVKASAATETGSTYALSTSTWYICKFKMLTDDRFKVTLYSDSGTQLYSYTSTAAMFRADNATAHIGFKTQCKTATAGISLISIDLIEFKAKVSATRAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SO2946
publication title Structure of SO2946 orphan from Shewanella oneidensis shows "jelly-roll" fold with carbohydrate-binding module.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 54
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2a5zA00
1TEIA 2A71A 1V6LA 1D0HA 1G9DA 2ZGOA 3OY8B 1B09A 1DLLA 1BKZA 4U36A 1W6NB 1YXWA 5E88A 1CJPA 1GZCA 4DFSA 1Q8QA 4Q1RA 1LCLA 4XE9A 2ARXA 2A6ZA 2ZGLA 2JE9A 1KDKA 5LK5A 2JDZA 3UJOA 3AP6A 1W0OA 2DVGA 2UU8A 1IS4A 2DVFA 3AYCA 1R1ZA 4YG3A 2ZBJA 1AX2A 1VIWB 3PJQA 2JECA 3AJYA 4K1ZA 3ZSMA 1CESA 3AP5A 1MS9A 1N1VA 4LBLA 4FPCA 4CZSA 1Q56A 4FP3A 4DRVA 1G9AA 4XYXA 1G86A 2VU9A 2CY6A 1G9FA 2A75A 2ZGNA 1KJRA 1LOBA 2UWBA 3AP4A 3ILFA 4M01A 3T1LA 3W59A 3WCRA 1LGCA 4R9CA 2PHFA 2ZGRA 1CQ9A 1HKDA 2ZACA 4AVSA 1DHKB 1CPNA 2A3WA 2E7TA 2OVUA 2WJSA 1WLCA 3ZXEA 2DYCA 3KQRA 2VXRA 3POWA 1W6OA 1DQ5A 1RIRA 2WQZC 5GLWA 1Z78A 4XBNA 1VLNA 3ZXFA 1LHUA 5H9PA 1LOGA 2D44A 2LALA 3O12A 4ZKTB 2WSVA 3SLIA 1KQRA 5DZGA 2ES3A 1V6JA 2VUAA 1IKQA 1OQ1A 4XJWA 1CPMA 4AGVA 5F9TA 2D6PA 2GN3A 4UW4A 1S1AA 4YW3A 1WBFA 4L8QA 4PF5A 4Q8KA 3V0AA 4IQPA 4YGBA 1AJOA 2P2KA 2ZHNA 3ZSKA 3O0WA 2D6OX 1UN1A 3USUA 1GNHA 1PZ8A 1ULFA 3WHTA 3A4UA 4LBKA 5JOWA 4FPGA 4BM8A 3PMEA 3WDTA 1FV3A 4DPNA 1W6MA 2XB6C 1DQ1A 1N1TA 4Y24A 4XHBA 5DUUA 1UL9A 3OPZA 4AVVA 1S0CA 3AFKA 2D6KA 2VW0A 2NMOA 5JMCA 3VKLA 4RL7A 2P3JA 1MZ6A 3BTAA 1S0DA 2DUPA 2VH9A 5GZDA 2NP0A 1N47A 5T5JA 4DS0A 2YMZA 2ZGSA 3D6EA 4Y1ZA 3AXDA 2EALA 4FOQA 1F5FA 1DYKA 2YV8A 2A6VA 1IS6A 2E6VA 1YI7A 4AVTA 3PVOA 4Y20A 4MYEA 1AXYA 3AZWA 1UMZA 1V6KA 3GNEA 4TYSA 1LHOA 1GLHA 2R1BA 3NV1A 3NV3A 5EWSA 1S0EA 2DURA 3V65A 1ZA4A 3ZXLA 2GALA 4YW5A 2D3SA 1MVEA 1DQ4A 1FNZA 2ZMLA 3WNXA 4KBBA 3WDYA 4Y22A 5GLVA 2R16A 1X50A 3HR9A 4LBOA 3R4UA 1AXZA 4YM1A 1WW6A 4XJZA 2WLQA 3FFZA 1GYKA 5JOYA 3L2YA 4XIKA 2EAKA 5FREA 1IOAA 1SLCA 1BQPA 3A0NA 3BIWE 1W6OB 3BOPA 4XILA 3VV1A 2DUOA 1FYUA 5IK7A 4BMEA 4FPHA 4Q2FA 1QNYA 1MZ5A 4FP2A 1LGBA 4DQAA 1G9CA 1MS1A 1QF3A 2P37A 4ITCA 3ILNA 1CONA 1SLAA 5T5PA 3ZSJA 5H9SA 5DUVA 1AF9A 3POYA 3B00A 5IK4A 3V0AB 4JRAA 2DU1A 2AUYA 2YY1A 3AZVA 5T5LA 1LECA 4YW4A 2DU0A 3TAYA 1W6QA 4XJAA 1QU0A 2ZHMA 5L73A 2PELA 2VW2A 2DVAA 1WLWA 2A7AA 3MW3A 3ZPYA 4CRQA 5IT6A 3VKNA 2CYFA 1QOSA 1DYPA 2E53A 1GSLA 1LHWA 1SBEA 1VAMA 1Z0HA 2AREA 3FBYA 4Y1YA 1QOTA 1LJ7A 4Q8LA 5JLVA 3FLPA 1LENA 4UW3A 1A78A 1ENQA 1SLTA 1H9WA 4K20A 5DZEA 5KXDA 2OUJA 1LOAA 1SCSA 1LGNA 1S0FA 4ISQA 4YZ5A 2D43A 4I30A 4FPKA 1AX0A 3WV6A 1LOEA 3AYEA 1Q8OA 1F31A 2AGSA 1Q8PA 3M3OA 5E89A 1G8WA 2LTNA 3DUIA 2ZGTA 2E51A 2ZHKA 4HANA 1DQ2A 1QNWA 2W08A 5EYYA 2GNTA 3WG2A 1NLSA 3AP7A 1W6PB 1SBFA 2P34A 1WLDA 2PHXA 3B9CA 1ULCA 4YGEA 1ENSA 5AVAA 1N1SA 3WDWA 1V6IA 4K1YA 4Y1VA 3C2UA 3AJZA 4GXLA 1MS3A 2YXSA 5E8AA 3WG4A 1JYCA 4BPZA 4XZPA 1QDOA 1CN1A 1QDCA 2PHWA 2ZABA 1JYIA 3D5OA 5CNAA 4GA9A 4XIOA 1LOFA 1LHVA 2D7FA 2DTYA 2UURA 4PQ9A 3I8TA 1WW4A 3WZ1A 3N7JA 3WCSA 3U4XA 1V6MA 4Y22B 5JOZA 2ZMKA 5JDBA 5KXBA 1C1FA 1C4RA 1AJKA 5HCFA 4XXPA 2P3KA 4PCRA 4BQ1A 4FOWA 3H0OA 1SBDA 4NOTA 2SBAA 1PZ9A 1RITA 4FQ4A 1FATA 3OYWA 5H9RA 5H9QA 1LHNA 1KJLA 3VKOA 4UW6A 1S0JA 2A6WA 3INAA 3ILRA 2VW1A 3OJBA 3QLQA 3V0BB 3POSA 3D4KA 4FOYA 4YLZA 1HLCA 2GMEA 5GZCA 2BQPA 1MS8A 2NM1A 2WT1A 3RQ0A 1KITA 2Z42A 1AX1A 1GKBA 1S0GA 3MPPG 1N3QA 4FVVA 3SH3A 3N3HA 5IK8A 2D3RA 1CIWA 4YFWA 3B69A 3OY8A 3AYDA 3NV4A 2SLIA 1FV2A 3IPVA 2ZGUA 1ULGA 4LBMA 3ZVXA 4GWNA 3JU9A 4LBQD 5CB7A 5DXDA 4XBLA 5JOXA 1MR5A 4M00A 2JE7A 1O4ZA 1YRZA 2DVBA 3O5SA 3TB0A 1QOOA 1MS0A 1Y7BA 3LCPA 5KXEA 2FMDA 4FPYA 4Y26A 3OGGA 1D2SA 3R05A 4P9XA 4AGRA 4C1WA 5HCAA 2DTWA 1MS4A 2DVDA 3AP9A 4M3CF 2W39A 2XG3A 1SFYA 2ZGKA 1DIWA 4LBJA 4LBNA 4P9WA 3RMYA 2W52A 5GLTA 1HDKA 4XJUA 1SLIA 1W0PA 2WT0A 4GALA 1YYNA 5GZFA 1DQ6A 2PHRA 4P14A 4K21A 4D69A 2NMNA 3ZYPA 1UX6A 1H9PA 1WW7A 1PZ7A 2R0FA 4FQZA 1LU1A 4LBQA 1QGLA 1LEMA 2OUHA 3PVEA 2EXIA 3KM5A 1GNZA 1U0AA 3RG0A 3MW4A 2AH2A 1G7YA 3NV2A 3IN9A 1BJQA 3UJQA 2NN8A 2D6LX 4BOWA 1QKQA 2CWSA 2JKBA 5GM0A 3M3CA 3R4SA 3SISA 4AGGA 1WCSA 1Q8VA 4YM3A 5FRAA 2FHRA 4Q1PA 1WD3A 4XMIA 1S0IA 5IUQA 3QCWA 5EYXA 5CBLA 3WHUA 3SNMA 3WUDA 1GANA 3VKMA 4YM0A 2ZGMA 1UPSA 1I1EA 3ATGA 1S0BA 3OYWB 1FX5A 1FNYA 2GNDA 4XTMA 3USUB 2VY0A 2I2SA 4ASMB 1AXKA 3W58A 3ZYRA 4YZ2A 2AENA 1DZQA 3SITA 3ASIA 2ZAAA 2R49A 5IK5A 1W6MB 3NWKA 3WDVA 2GDFA 4W65A 4JCKA 1XQNA 3Q9OA 3UL2A 1V00A 4WVWA 2H0BA 3FLRA 1Q8SA 5GALA 3GALA 1NXD1 2CWMA 1GBGA 4Y1XA 3O0VA 2ZMNA 3AZYA 4YFZA 1BXHA 2NYYA 2WT2A 5DZFA 4PBPA 1DBNA 3IPVB 4M3CE 2EXHA 4FPJA 3UK9A 4SLIA 4XMAA 4FPLA 5SV8A 3VKFC 5GZEA 5CAZA 1IS5A 4YGCA 4AWDA 3ENRA 2GNBA 3ZXJA 1KDMA 1G9BA 1VAVA 1JN2P 4H55A 4ZXKA 1LODA 1MACA 4Y20B 4M3CA 1JUIA 1N1YA 1SLLA 2AR6A 2D6NA 3M1HA 3WLUA 4YZ4A 3A0KA 2A3XA 4BLIA 3N7MA 4YW1A 4GWMA 4XTPA 1ULEA 3I4IA 1UAIA 4XJ9A 1LOFC 3HMYA 5T54A 1FAYA 2ZGQA 4ATEA 2C9AA 1HQWA 2GMPA 2D3PA 1MVQA 1CR7A 1YIFA 2HYKA 3AX4A 3FLTA 2R1DA 4BMBA 1LULA 1KRIA 4NO4A 2DUQA 4LBQB 1LOCA 5GJ6A 3ZSLA 4Y1UA 5JVVA 2A70A 4C1XA 4F83A 5GZGA 4RA0A 3SH4A 4AYUA 1APNA 2R0HA 2CNAA 2ENRA 1LESA 1GICA 1UZYA 4ATFA 4OZXA 1DFQA 2ZHLA 1GZWA 2YROA 4DRRA 4WV8A 5T50A 1SACA 1UKGA 3N7KA 4CTEA 1V6NA 3N7LA 4XDQA 5GLZA 2W68A 1H30A 2EIGA 2CL2A 1RINA 3WDUA 4ISRA 1F9KA 1UZZA 3WG1A 1LEDA 4YG6A 1W6QB 3B3QE 1WD4A 3OBTA 1GV9A 3WOGA 5BYNA 2KM2A 4U2AA 1BZWA 3RMXA 1EPWA 2EXJA 2V73A 4WVVA 1N3OA 2JJ6A 2WSUA 3OBRA 4XOGA 1ULDA 4YZ1A 1W6NA 1IKPA 2EXKA 1OFSA 4YW2A 3MEPA 1VALA 2A5ZA 2CTVA 1A8DA 3LSDA 1SCRA 3IM0A 2PHUA 4FPOB 1GZ9A 5CA6A 5DG1A 3BODA 2JD4A 3N36A 3WDXA 2ZZJA 3WG3A 5GLUA 1MS5A 3FUOA 4R9AA 2ERFA 3JUUA 4FPEA 5F5QA 1DGLA 1QMJA 2WNEA 2ZA9A 2YZ4A 3IKWA 1CVNA 2B7YA 2GN7A 1WW5A 2UWAA 4JC1A 3T2TA 4XBQA 3AYAA 2DV9A 1J1TA 2P3IA 4P9YA 2A6XA 5EXOA 1ONAA 2WKKA 4GKXA 4R9DA 1C57A 3V64A 2GMMA 3LSEA 4UW5A 4WZFA 3RS6A 4TZDA 1JOJA 1A3KA 1C1LA 2TEPA 1JBCA 3PVNA 4M3CB 1V6OA 1DQ0A 1JW6A 4YGDA 2ZKNA 4YZ3A 1W6PA 5HCBA 1O4YA 3HN1A 3M3EA 1AZDA 4YG0A 4XJ8A 2UWCA 3AZZA 1YO8A 1OKQA 4HL0A 3RSJA 2ARBA 3APBA 4FOVA 2PHTA 2C5DA 2D6MA 1SLBA 3B01A 4XXAA 4YM2A 3SH5A 1LU2A 3T1MA 5KXCA 4XHXA 3RRDA 4Q26A 1URXA 4PBOA 5DUXA 4R9BA 5T5OA 2ZGPA 1WUVA 4FPFA 3IMNA 3ZXKA 3WUCA 3WVJA 1AVBA 2OW4A 5DUWA 3AK0A 1GZWB 3FUQA 3M3QA 3N35A 2RHPA 4Q27A 1JXNA 1JHNA 2EF6A 1BYHA 1N3PA 3AZXA 3O0XA 1HQLA 2A3YA 1ZM1A 2Q5TA 2NZ9A 5DG2A 2DWRA 5T55A 2AYHA 2GNMA 3CNAA 1IS3A 1LTEA 2A6YA 2V5YA 3MW2A 3AXEA 5T52A 3DGTA 2E7QA 3M2MA 4BLJA 3V0BA 1WBLA 2G4IA 1ENRA 4GKYA 3VUOA 4Z8BA 1I3HA
chains in the Genus database with same CATH superfamily
1TEIA 1O8PA 1R1A2 4DO0A 5KHIA 4E4ZA 5J96B 4WM8B 2BGOA 1B09A 4I3GA 2JICA 2W3JA 4JRLA 3ABZA 1W2OA 1OH4A 2BGCA 2AACA 1F8VA 2ARXA 2XONA 2A6ZA 2BWAA 3JD71 2PAKA 1OF3A 2JDZA 3UJOA 1FMD2 2VZ1A 3CLPA 3NNMA 1DGWX 1IS4A 3J7MA 1R081 4YPJA 4ASLA 4BH9A 1W90A 2GP3A 4YG3A 5LEJA 4QQ2A 4RR3C 1C5IA 3L9JT 3PJQA 5FPBA 2E32A 4LBLA 1IHMA 2OKXA 4BXFA 1PNFA 1G9AA 4RFRB 2C24A 5BNNA 4B1MA 5LZ6A 3WP5A 2Q8EA 3CBNA 4LR4A 4NRPA 4DMIA 2UWBA 4NIAA 4N9HA 1KGYA 3OSDA 5A32B 5F39A 3KLSA 2RG4A 1NCQC 3DN7A 1OA2A 4AQSA 4Q4V1 3NNLA 5I93A 3JXSA 4AVSA 4O9GA 1DHKB 2A3WA 5IAVA 4K7JA 3T0BA 3GF6A 1OQDA 3ZXEA 2YGMA 3POWA 3PIGA 3H8OA 2WQZC 1ZREA 3ZX7A 1Z78A 5FYTA 3ZN5A 2ADDA 3H7JA 1AR71 2LALA 1CAWB 1A8MA 2D44A 2IXLA 3LPFA 4IERA 4QQPA 2F6BA 4I02A 2VUAA 1PK6A 5BNOC 1IKQA 5FMOL 3DPRB 1CPMA 5FP4A 4AGVA 5F9TA 2D6PA 5T3NA 3VBRC 1RUI3 5FZOB 1WBFA 4L8QA 4KMQA 1VBA3 1HV1A 1OC1A 2HWD1 2E9QA 4A3XA 3RZHA 4PLNA 2WAOA 2VUCA 2ZHNA 3LA3A 3ZSKA 4CXXA 4META 1MQTB 1UN1A 2DBNA 3USUA 5ABJA 1PZ8A 2WAAA 2XVLA 3A4UA 4PDWB 3S0MA 3DEMA 5LBCA 5FZ0A 3TWIA 5JOWA 4FPGA 4DZGA 5L9RA 1X33A 1DGRA 2RMU1 1PO13 1VBB3 1FV3A 3WDTA 4DPNA 2F4PA 2XB6C 5FYIA 3ZYIB 1SDWA 5FZGA 4QX2A 5C3QA 2J1UA 1VBD1 1AR63 5KHHA 3PURA 5HI0A 1DG6A 4CDUC 1JYVA 3I3EA 2VW0A 3PL0A 5JMCA 4N43C 5LA2A 1W99A 1S0DA 4DS0A 3PTYA 4MGSA 4I0BA 3UNPA 1AL21 4RQPB 2IVIB 1W2NA 3KT7A 3PVBB 2XVKA 4FOQA 4QPGA 3VL9A 1X36A 2A6VA 3E5QA 4LIVA 2GAUA 2WZPP 1XNKA 1YI7A 2PHLA 1OI6A 2OT7A 2PAEA 3F95A 4XFGA 3PVOA 1RUE1 4GB32 4Y20A 4X8NA 5D8AB 4OI4A 1NE6A 2GC0A 5BNNB 4TYSA 3CIHA 3KCXA 3DKQA 2D97A 5EWSA 2HWB2 5A3MA 2DURA 2RS13 3ZXLA 1MVEA 1DQ4A 4XC9A 2VCBA 3ME2A 4KBBA 4M4PA 1HX6A 4HN1A 2R16A 4MGZE 2AEZA 4D7TA 2ZCWA 1RMU2 4QX7A 4CDQC 3CU7A 3H7YA 1PNGA 2XBO1 4UWDA 5F5AA 5BNPA 1SLCA 1RVF3 4FI9A 3BOPA 5FYUA 1QJX1 4D7YA 3WF2A 3MIDA 1XRUA 4FPHA 4Q2FA 1EPZA 1MZ5A 1RUH2 2RS32 1BHGA 1LGBA 2G19A 1PK6B 1G9CA 1MS1A 1JZ7A 3C3VA 1QF3A 2VMCA 3THTA 1IQDC 4YYOA 2GC1A 2HWC2 4UF0A 5T5PA 5EV7A 1GOGA 1OA3A 1UO9A 1XYPA 4JRAA 2AUYA 2ZX0A 2VTXA 4Q4X1 5FP8A 5FFOC 4AEDC 4AI8A 5JXGA 4AAPA 1POV1 1PGL2 2ZHMA 2IFWA 5B4NA 2VZSA 2DVAA 2A7AA 3MW3A 5ABJB 3ZIWA 2HBTA 4BHPA 5CFDB 1JYWA 3TOJA 2R041 5FPLA 1RUC1 1IG3A 1K5MC 3AL5A 3WW3A 4Z82A 5A7WB 1YUDA 4B4RA 5JLVA 4CU6A 4R4XA 3CHXA 1WMDA 5DZEA 2OUJA 1LOAA 1ST8A 1SCSA 1LGNA 1BEV2 2D43A 2FDKA 4FPKA 2H6CA 2VECA 4Q4W1 2VM9A 4YVSC 1UWWA 5FYSA 2VL4A 5I8TA 1EV12 1G8WA 3LIGA 4G3YC 4QPGB 2ZHKA 5A3NA 1X8EA 1DQ2A 5EYYA 3H8XA 1AYM3 1NLSA 4V1PA 5F5IA 2ZTNA 5FLHA 4JKLA 1UD1A 3OGVA 2XPJA 1GWMA 1ND2A 1ULCA 3B9CA 4IGQA 5AFBA 1U12A 2IXJA 2VNGA 5E8AA 2JG9A 1ZRDA 4WM7A 4DOUA 2XL7A 1QDCA 1OHFA 1TNRA 2D40A 2WNUC 4GA9A 3GXUA 2NQYA 4XIOA 1LOFA 1AR81 1LHVA 2EICA 4PQ9A 3SKJE 3NAPA 4BQ3A 5CADA 3RZGA 4MG2A 1YIPA 3WQ7A 3JB8A 3Q8BA 3N4MA 1TMF2 2IXCA 3G7DA 3J9SA 1V6MA 1JUHA 4WBBA 3VBOA 2V4VA 5JDBA 3PU3A 4NHYA 2PAMA 3N9MA 5HCFA 1WLTA 1Z7S3 5BNPB 1QWRA 2BVBA 5FMBA 4XVHA 1E5IA 1W2TA 2YU2A 4H7MA 1UQXA 1PZ9A 3F2ZA 2QBXA 1FATA 2BV4A 4GH4C 1OT5A 1UW8A 1PO21 1HRI2 2X8KA 5H9RA 4L9BA 5JI7A 3VKOA 4C0HA 1TQ5A 2WO3A 3WW2A 2A6WA 5FYBA 1W9SA 5A7OA 3O1MA 3ILRA 4NIGA 3E6DA 3OJBA 2XKPA 4UF0B 1D4M3 2CU5A 3WXPA 4ZPIA 5GZCA 3ZKUA 1HRV3 1RHI1 5JZGC 2NM1A 2WT1A 2KXLA 2Z42A 5FUNA 1S0GA 4GZ9A 3MPPG 3VZKA 4XZUG 5L9BA 2VZVA 4PHZA 5JSPA 1KFUL 2D3RA 2QQLA 2YBSA 5IK8A 3LOBA 2P1BA 1ASJ3 3IPVA 5FUPA 1V0AA 2ZGUA 3NMBA 1ULGA 1COV3 4MO3M 4AI9A 4DUXA 1XYNA 2FDJA 4AHYA 3RYKA 2ZOEB 1H8TA 5DPNA 4LKFA 3WX5A 4YARA 2Q4SA 1YRZA 5KR7A 5CFCC 5KXEA 3HNBM 4Q0VA 3P6BA 2GC3A 4MUVA 3ZSLA 2JEMA 1X82A 4FPYA 5FY7A 3OGGA 4FO9A 5HCAA 4COYA 4LLFA 2Q8DA 5L73A 3VHRA 2W39A 2XG3A 1SFYA 2ZGKA 3HWJA 4IEOA 3VBFC 1HXS1 3V56A 1HDKA 1QJY1 4YNIA 1E5SA 1SLIA 2WT0A 2WQ8A 4QPWA 1YYNA 2PHRA 1UY4A 4P14A 3LDRA 1ND2B 3ZYGA 4XFHA 1H1IA 1H9PA 1WW7A 5C8CC 1UY0A 1LU1A 1XYOA 1QGLA 4LBQA 4QQLA 4WM7B 1FI2A 4IV1A 2EXIA 3MUZ1 4XEZA 3KM5A 4J25A 1GNZA 4OUEA 2CDOA 4YW6A 1RUG2 3ZFEA 5I91A 1QXRA 3NAPB 1BJQA 3UJQA 4BOWA 2D6LX 1QKQA 2CWSA 2JKBA 2XMLA 1J84A 3IWZA 3M3CA 4HSJA 1Q8VA 3VBOB 3OUIA 5FRAA 4YM3A 2VG9A 3PUAA 4D94A 3QOPA 4Q1PA 4XCAA 5EQUA 4OHYA 4ZXEA 4MH0E 3AM2A 2W1UA 4P5YA 5FY9A 2Q30A 3ES1A 4NRQA 4C8DA 3J8F1 4LE4A 4N7IA 2RS51 3T4VA 1S0BA 1R1A3 5J98B 2BBAA 5IFPA 3ZYRA 1W3XA 4MHRA 4CE8A 4CEYC 4PI2A 5IVBA 1ENXA 4EN6B 4W65A 1PM7A 3T3YA 1BBT1 1GP4A 5FR3A 2RE9A 3HBKA 3GALA 4BXSV 4AAXA 4UAPA 4AVCA 3O14A 3AZYA 1MEC1 5FXXA 1BXHA 1UOGA 2VJXA 3OBAA 2OPWA 4GQ7A 1REEA 4FT8A 1DBNA 1UZWA 2DDUA 3IPVB 2WL1A 4PBPA 4SLIA 3UK9A 5CKNA 5SV8A 1F2NA 5CAZA 4Q0QA 1O7FA 1ZBA3 2VNRA 2X5IC 3CJIB 3FWEA 1H8TB 2IXKA 4I01A 3N9NA 1VAVA 4DB5A 4H55A 5AC91 2E26A 1H2KA 4CYDA 3BIEA 1B35A 3IIAA 4OI1A 3WR0A 3P3PA 1K42A 4RFT0 3I97A 1JUIA 2D6NA 2CGPA 5LCWL 1J58A 3SEEA 5ACA2 3RGBA 1GOFA 4MZUA 3WEZA 1PVC2 4GWMA 1UPIA 5F7UA 2IFRA 2HKXA 4JDOA 3I3MA 3MIFA 3I4IA 2VOTA 2BP6A 1PX4A 2J1VA 2VOXA 4LOSA 2C9AA 4I0AA 1WMEA 3VL8A 1QJU1 4P08A 4QT6A 1GFF2 1IZ3A 3AX4A 1CR7A 2FCTA 3HBZA 4Z1VA 5J37A 1VE0A 1LULA 1UZVA 3C7OA 2DUQA 3ZXAC 5D2AA 4LBQB 1LOCA 3Q8FA 1NLRA 4HXCA 4L92A 1YI9A 2A70A 4WVMA 2A1XA 4IV1B 2BJSA 5FXZA 5A3TA 4XPVA 1APNA 5BY5A 4WZCA 1BMV1 4W6WA 2XLFA 1GZWA 4WV8A 5A1FA 5FP7A 3ZFEB 2O14A 1HN1A 2VVEA 4UBGA 3WNPA 3N7LA 3QD6A 3I2FA 3BB6A 5FKBA 1VB4A 5GLZA 1FXZA 5DAQA 2EIGA 1NCRA 1US3A 2UYBA 4CDWC 5GKAC 4ISRA 3CL1A 2VULA 4H3WA 2KR2A 1UZZA 2LS6A 2VBDA 3K75B 4R8HA 3KCCA 4ZU5A 3PHMA 5JOYA 3B3QE 3OBTA 5HBAA 1J83A 1JS9A 1TZOA 3IZOA 1I9RA 1G6NA 1OD3A 2KM2A 3NKTA 4U2AA 1YQ8A 2IXHA 4GJYA 1OLME 4IW3A 4LE3A 1EPWA 4QX3A 2V73A 1OBNA 1N3OA 4ORFA 1VRBA 5IVFA 1IKPA 3ES4A 4QGNA 3VBSA 4YW2A 1ZZBA 4LA3A 1AUYA 1VALA 5FJHA 3O1RA 1VP6A 1A8DA 1JHJA 2CTVA 5A6YA 4A6SA 1RUJ2 4EWDA 4IE6A 2JD4A 3N36A 1LR5A 1BVP1 2ZZJA 1KXGA 1AR62 4A42A 3DXUA 3OUHA 5GLUA 3FUOA 1NY72 2RR12 4C0BA 3WNNA 4ZZ5A 4FPEA 5M0TA 2VQAA 3AVRA 1DGLA 3VZMA 4AQ6A 4BYYA 1QMJA 3AMMA 2LROA 2YZ4A 3HPNA 4GB33 4Y5SA 3TYJA 4CSWA 4FSJA 5JSRA 1EAH1 2LM3A 2WR9A 1H6YA 3LFMA 4CDXB 3NVCA 3IDAA 2DF7A 4N53A 3GDBA 5EXOA 4GKXA 2WKKA 4R9DA 2HWB3 1RUF3 4KG8A 1B35B 1W39A 3LSEA 4I3PA 4QB1A 1JOJA 5E6HA 3PVNA 2ZEYA 4YZ3A 4QXKA 5HCBA 2OYZA 1O4YA 4WVZA 3I2DA 1VBB1 1RMU3 3M3EA 3B7MA 1AZDA 2VPVA 2PTMA 4CA9A 4GMP3 3T09A 4UFKA 3ZFFB 4QB2A 3RSJA 1F35A 5LBBA 4OQ8A 4FOVA 2PHTA 4YM2A 1SLBA 1OA4A 3LA2A 4GIQA 2RM21 2RS33 3FHIB 2MEV2 4Q0PA 2VQUA 2ZGPA 4R9BA 5CKMA 3WF3A 4ONUA 5DDJ1 2HWC3 3WVJA 2ILMA 4NIIA 5DUWA 3AK0A 1DZRA 1GZWB 4ARXA 3KB5A 2EF6A 2F17A 1BYHA 4Q4Y2 4PIYA 5J3UA 1HQLA 5G05L 2FZ2A 1JZ8A 1SFNA 5FY5A 4QMAA 3TEXA 2Q1FA 4CUCA 5K9YA 1AL0G 4D7SA 1OD5A 4HVOA 3B94A 2WZR2 4RSUA 5T55A 3U07A 3CNAA 1DGWA 1IS3A 2A6YA 2V5YA 3MW2A 2WWUA 4LPLA 1C5HA 1NQDA 3I2IA 3N9OA 5FCCA 3JBG2 4GKYA 2JDYA 2XHKA 4W50A 4LHLA 1JOPA 3NNJA 1VRH3 2ZGOA 3OY8B 3CO2A 3POFA 1BEV3 4E8DA 3VBSB 1Q8QA 5FP3A 1LCLA 4YSFA 1RVF1 5IJRA 4XE9A 5FZDA 5C9AA 1EV13 1ZNPA 2NLRA 1KDKA 5LK5A 2W95A 3CJXA 2VMGA 2WYSA 2XKOA 3AP6A 3CKHA 2DVGA 3WF1A 4EROA 4EQVA 1ZA7A 3VDDC 5F3CA 3TNQA 1VIWB 2JECA 2OQ6A 3CDZB 1WGPA 1CESA 5FZMA 4CZSA 3QH7A 2QQMA 4XYXA 3BCWA 3UGHA 5L7OC 2VU9A 2CY6A 3FHQA 3KWVA 4MX3A 2ARCA 4XDOA 2XDVA 4HG6B 3T1LA 3WCRA 3W59A 5JPNB 3KV6A 3TN92 1LGCA 2VCCA 1TMF3 4R9CA 4QQHA 2G9FA 4J1WA 2YPJA 3LF7A 4E2QA 5FK7A 3MUY1 3RI8A 3ST7A 2ZACA 3E6CC 3SC7X 5LRSA 1L7RA 3FFQA 4F8AA 2OVUA 4QKBA 2LRPA 3BU7A 3KQRA 3POBA 4HFSA 3RZKA 2VZOA 5CVRA 1DQ5A 3H8UA 1D7PM 1RIRA 2YC2A 1NKGA 4MXVA 2GZWA 2VMIA 1HRI3 1LHUA 1PIV2 5A3LA 3GM8A 2WNVA 4NR1A 5I0UA 3LOIA 1OLQA 1UYPA 4BK5A 4XCBA 2D5FA 1KQRA 3PJYA 2Y64A 5LK7B 1V6JA 1ACCA 4NIHA 3IB3A 1OQ1A 4URTA 3KVAA 1OOPA 4XJWA 4YVWC 1S1AA 1AYM1 3I2JA 1R64A 2GH2A 4S2GA 4Q8KA 5C4WB 3V0AA 4JDMA 4IQPA 2TNFA 1FT9A 1AJOA 2YGLA 5A7PA 1K5JA 1NT0A 2JE8A 2P2KA 4K40A 4UT5A 5C3RA 3VD4A 3U78A 5B2GB 4WM8C 2D6OX 3ITQA 4KU8A 3FBMA 2QE3A 3VBHB 4PF1A 3MLJA 4LBKA 1OUXA 3A21A 5DAXA 3DYOA 4BM8A 4LMFA 1W6MA 2WABA 3EB7A 2WS93 4LOTA 1N1TA 4Y24A 4L0PA 1CIYA 1ULPA 1C3HA 4XHBA 5JR2A 2B9VA 2QQJA 1UL9A 3M4FA 5IAXA 3MO4A 5D1IA 4OI2A 2DCZA 3Q8EA 3VKLA 3RWKX 3J7NA 1HB4A 1ASJ2 1DCSA 2JG8A 4A6OA 4EWAA 3KF5A 5C9AB 1LAJA 2VQ0A 1UY1A 2ZGSA 3D6EA 2Y6FA 3AXDA 2EALA 5DAWA 1F5FA 5FZ9A 1DYKA 3KHCA 2QQVA 4EWEA 1IS6A 2E6VA 2YBKA 2BNOA 5E16A 4MLOA 1HW5A 4OZOA 3LEGA 4LTAA 3WNLA 1AXYA 3ZFGA 1UMZA 3IDCB 3ZKYA 5ERLA 5FBJA 5SV5A 1ODNA 4NWVA 4E8CA 1GLHA 2R1BA 4AEKA 1W8TA 1GQHA 3NV1A 3TRSB 1J3PA 1LRHA 1RUG3 2WC2A 2Z5WA 4B7EA 3V65A 1ZA4A 2C9KA 3LEMA 4TLFA 4YW5A 5A7QA 2D3SA 2ZMLA 4RQPC 4ES9A 3WNXA 4NROA 4AHXA 3WDYA 2O0OA 3EQEA 1GZTA 3OPTA 2P17A 1AXZA 2ARAA 3Q8AA 3R4UA 3K3NA 4JVAA 2ZX1A 3DPRC 3FFZA 4XJZA 2Q8CA 5KHJA 4DXRA 4JV4A 2EAKA 5L36A 4NIDA 3O1UA 1IOAA 3A0NA 5FWJA 3BIWE 3UESA 3GCWA 1RYYA 1X7NA 1IPJA 3ZMNA 4BQ4A 3MF6A 5IK7A 4BMEA 1TME1 2WNVB 1WCKA 1MQTC 1QNYA 1WCUA 4GULA 1EYBA 1QQP2 3OPWA 2VMFA 2Y26A 4ARYA 4PDWC 4F3JA 3P5BA 4K8FA 2P37A 3O1VA 4JDNA 1AR92 3ILNA 1CONA 2GP5A 3ZSJA 3ZDSA 3B00A 5IK4A 3V0AB 2WINB 1LECA 4W4ZA 3TAYA 2HWF1 1W6QA 4IUGA 2ZEWA 3I3DA 2PELA 3HAGA 3POGA 5CU1A 2VW2A 3USSA 2XWBB 3H8RA 4O9EA 4CCKA 1O3TA 4IV3A 2B45X 2CYFA 3VN4A 3NJZA 3RI9A 4AXOA 1GSLA 1LHWA 5C3PA 4N90A 1Z0HA 4V2VA 2AREA 1WZXA 3FBYA 2R32A 5FKCA 2XJQA 1LJ7A 4Q8LA 3JZVA 2BNMA 2CGNA 1D4VB 1E57A 1LENA 1AHSA 4HT1T 1RB8G 3ACGA 1BCXA 1SLTA 4QX8A 2JDAA 1H1AA 1Y9QA 2ORXA 5FLIA 2JG8B 2AZ5A 3HT2A 4Z92B 1KS4A 5D8AC 1DDLA 1DLCA 1AX0A 5ACA3 3WV6A 3AYEA 3K2OA 2YFZA 1Q8OA 1ZBA2 5BNNC 1T6BX 2AGSA 1PVC3 3M3OA 2Z69A 3AMNA 1UXZA 4OLLA 1UYYA 2LTNA 4Q4V2 3DUIA 5E89A 5BXXA 2XJVA 3POJA 4HANA 2PYTA 4N7UA 3SCGA 4B4PA 2W08A 5C3SA 4RGGA 2GNTA 5DAVA 1SBFA 4K6BA 1WLDA 2JB8A 1BLZA 1ZZCA 1ENSA 1UOJA 2HEVF 2Z2SB 3IAQA 4YGEA 4Y1VA 4LHKA 3C2UA 3VHNA 1JYCA 3VD7A 4XZPA 1FMD1 1AYN1 2QZ2A 1CN1A 3OG2A 2PHWA 3EYPA 2D7FA 1WW4A 4A2UA 4AI0A 4EN7B 1S55A 3N7JA 5EZWA 3WCSA 3WP4A 2HWD2 1XC6A 2ZMKA 3IIIA 4O65A 1NCQA 1QH7A 4XW3A 3ZOIA 5A1AA 1GP6A 4D3WA 2AEYA 2W9XA 4GD4A 1SBDA 3VD9A 1PMHX 1RITA 4SBVA 1M06G 1KD7A 2RMU2 3OYWA 4QDSA 4KI5M 1LHNA 2Y38A 4XQWA 5ABJC 4KWKA 5CFDC 4CCJA 4XURA 3MFCA 4PJYA 3KF3A 3QLQA 3V0BB 2W1WA 2W94A 3POSA 3BI3A 2VMDA 5BNOA 2FD8A 2GMEA 4TSVA 1RUJ3 4DNYA 1GQGA 1UMHA 5I0SA 1KITA 3VBRA 4NN0A 1N3QA 2RR13 3J7LA 3PUQA 4IV3B 3OGJA 3BKZA 1V9U1 4IEZA 1XSRA 1CIWA 1D2QA 2R6QA 1FOD3 3EO6A 4GJZA 4IEQA 5LBEA 2BPA2 1O4TA 1JTZX 1ZBE1 1OVPA 4P9JA 2PLV3 1RUE2 3ACHA 4LO4B 4GWNA 2VUDA 3JU9A 4CU9A 2RDRA 5CB7A 1C8M2 4QU1A 5DXDA 4AHZA 5HPOA 1UYXA 4HZFA 1MR5A 2JE7A 2DVBA 3O5SA 5FYYA 3TB0A 3LCPA 5LY1A 2ZS6B 3U37A 4ZS2A 3R05A 4C1WA 3PIJA 4EYUA 5IWFA 4Z2AA 3C7EA 1W0NA 2DTWA 1MS4A 4XDPA 3AP9A 1XE0A 1IPSA 1RUF2 5F2WA 5GLTA 5A70A 3KS7A 2XBO2 1I5ZA 3D8CA 1SEFA 1XE7A 2RVAA 4B1LA 3RZMA 1UX6A 4NVPA 4FTSA 3I54A 1RUD3 2MEV3 4FQZA 1PZ7A 3N9LA 3ACLA 4HKOA 3T0AA 4AR2A 4DXZA 4AFCA 2Q0AA 5BNPC 3O1SA 1U0AA 3W21A 1UCXA 3C7GA 4H2AA 4Q4Y3 1T6GC 3KQ4B 3T08A 3NV2A 4QX5A 4AQ2A 2E33A 5GM0A 1DU3D 1TE1B 5FMOS 3R4SA 4AGGA 1WCSA 3OGSA 2C0ZA 3ZLIA 5C8WA 1L3JA 2ZX4A 2FHRA 2WZR3 3KGLA 2R061 1NCQB 4LLOA 1WD3A 2VD7A 4XMIA 2DCYA 2HWB1 4JTOA 1W06A 3WUDA 1YHFA 3JBG3 4YM0A 1RUC2 3VKMA 2ZGMA 2O8QA 5C6CA 3OYWB 4FFIA 2XQRA 1FX5A 4XTMA 3ZO0B 1POV0 3USUB 4ASMB 2I2SA 4DUVA 1W28A 3W20A 1NZCA 2G9ZA 3LB9A 4YZ2A 2JXAA 3GHMA 3LQCA 2BW8A 2ZAAA 1W8NA 2QQPA 3P1IA 4GMP1 2R49A 2XHNA 3J26N 3NWKA 4ZS3A 5IK5A 1XQNA 2VR4A 2BRTA 3UL2A 5F1RA 1V00A 2H0BA 2WWSA 3MYXA 4D6RA 3A7QA 4Q4W2 3K3OA 3VBRB 1VRH2 1RUH1 4FCAA 4BQXA 3PUIA 3CF6E 4XAEA 4DINB 4NWWA 2HLEA 4M3CE 3GBWA 4FPJA 5CIRA 1IS5A 4P9IA 4YGCA 3S6PA 5FY8A 4JGZC 5FZ1A 4DXSA 3ZXJA 2QQIA 5JXJA 1O6UA 1G9BA 1JN2P 1W9TA 1R091 3KVBA 3NNGA 3S5QA 4JQRA 3TN93 4ZU7A 4Y20B 3EXUA 3ZIXA 1N1YA 2AR6A 3M1HA 2VMHA 4YZ4A 3A0KA 4COZA 5DQ0A 1F15A 1H2LA 4RHV3 5JAXA 3N7MA 2J22A 4FTBA 1VAKA 1LOFC 3HMYA 4CP9B 1FAYA 2ZGQA 3NAPC 5D21A 4ZZ8A 1PIV3 2GMPA 4XETA 3OEAA 2D3PA 2FZ1A 1MVQA 2HYKA 4FXKB 4KU7A 2MHFA 1XSQA 4IGOA 4A7KA 1OUSA 1UKRA 2V72A 4JQTA 1W05A 3ETQA 1P8JA 4HKWA 1PO22 3K4AA 5FUIA 4XQDA 1YFUA 5JVVA 3ROUA 3SH4A 3J7HA 3BTXA 2DCJA 2F4LA 2R0HA 2Y8KA 2HWE1 5A3OA 4A45A 1UZYA 2WUHA 2XJTA 1LNSA 2YROA 2W1QA 3G6JB 3KD4A 3N7KA 4P9GA 2K2SA 5C70A 4XDQA 2ID4A 3HQUA 3H42B 1TNFA 1RHI2 4TTGA 3AMPA 3PUSA 2CL2A 4IEPA 3WDUA 4XFAA 2W47A 1LEDA 5J7MA 3VD5A 4CEWA 5A6QA 1WD4A 1YFYA 1GV9A 3WOGA 2JDKA 4IE7A 1TMF1 1PGW1 2WWJA 3THDA 2MPFA 1J59A 1JMUB 3E97A 2OQ7A 2WSUA 1XNTA 2XJPA 4IL7A 4XOGA 4DEQA 4L97A 5IVYA 4YZ1A 2YC0A 5FY4A 3MPBA 1OFSA 1Y9GA 1GNYA 1GMMA 2WS92 4XUQA 2A5ZA 1CGPA 3CJIC 4HPKA 4E2GA 1SCRA 4LHNA 4XUTA 3SHRA 2WFPA 1H8TC 4BQ5A 1GZ9A 1OLMA 5CA6A 2HBUA 5A3UA 4AG4A 3E6BA 3WG3A 4COWA 5L9VA 2VBPA 5JZGA 5F5QA 2XJSA 1QJY2 2ZA9A 4LKEA 4JC1A 2QFEA 3T2TA 1WW5A 5AVPA 1CD3G 3AYAA 4QDRA 4P9YA 2BOIA 2A6XA 3PU8A 2WQ4A 4K9SA 3QH6A 1YQ5A 4UW5A 3MICA 2FCVA 4WZFA 2TEPA 3MLKA 1YWKA 3NQHA 4COVA 5AFEA 1ZYBA 2JG9B 4S2FA 5I8SA 2PFWA 1W6PA 2VOKA 3HN1A 5EJ3A 3ZR6A 5JWPA 4IV1C 3CQOA 3THCA 1VMHA 2BVVA 1BVVA 2AC1A 1XJAA 4DY5A 5A80A 2ARBA 3APBA 3VBFA 2I07B 4FAHA 2R071 4NAOA 3ZM8A 4XXAA 3SH5A 1GOHA 3LEIA 1XBFA 5JPMB 1Q43A 1QQP3 4XHXA 5KXCA 4Y5TA 2IVJA 2RS52 3AL6A 4ZHNA 1MZEA 4FPFA 3BN6A 4L11A 1AR93 1WMXA 3WW1A 4AVBA 2XVGA 2KD7A 3VGIA 1QHDA 4Y4RA 3M3QA 4QHBA 2RHPA 1JHNA 2WNOA 3HJRA 2XJUA 1N3PA 1VBC1 3ZXGA 3KT1A 1X9PA 3JD73 1BBT2 2RDQA 2Q5TA 2NZ9A 5DG2A 5BNQA 4P9LA 3W9AA 2H6BA 3VD3A 2DCTA 3I3BA 2GH8A 4CEWB 2CHHA 1MEC2 5T52A 3DGTA 4Y4YA 4BLJA 4DY3A 5F3EA 1WBLA 1NA1A 2Y60A 2CGOA 2A71A 1W8OA 4IE5A 1V6LA 1WKYA 4FFHA 1D0HA 1UOFA 1G9DA 2X29A 4IEXA 4U36A 5E88A 3ZXDA 4XACA 5FXWA 1CJPA 2OX0A 1GZCA 3SKVA 4Q1RA 4CDXC 3OBZA 4HPKB 3NKGA 4CEYA 2JE9A 4IEUA 4Q4V3 2QZ3A 3TEWA 5FIXA 4V2WA 4AI3A 2PXJA 3RJ2X 5JMOA 3AYCA 5DMYA 3JCIA 2ADEA 4NMIA 4QHOA 3FJSA 5JZGB 2W91A 2ZBJA 4HOOA 4A4AA 1S4CA 2V5DA 1QH6A 4LITA 4AOCA 3ECQA 4K1ZA 1QJU2 2W1SA 3AP5A 3OCPA 3BVCA 5FZ6A 4FPCA 1AR73 2W46A 1Q56A 1Y43B 4FP3A 3T2OA 4QXCA 2I74A 1RXGA 2Q8OA 3S5AA 1G86A 3ZFFC 2A75A 4OULA 2ZGNA 2GC2A 1VPHA 3ILFA 4QPIC 1BMV2 2FBEA 2ETEA 3VBUC 4KWUA 1C28A 2UY9A 2HWD3 2ZGRA 1CQ9A 3MHZA 4X8PA 1CPNA 1OH3A 1IPKA 2WJSA 4RS5C 2VXRA 2PN5A 1HJGA 5GLWA 2P4EA 2RMU3 1VLNA 2QKDA 4HONA 3OF1A 1VR3A 3MDPA 1LOGA 1NXMA 3O12A 4ZKTB 2WSVA 3SLIA 5DZGA 1US2A 5KC6A 1VBD3 4GWJA 4FTEA 1SFPA 5JSOA 4UW4A 3UETA 2J7MA 4Y33A 4PF5A 4YW3A 5K7PA 4I0WB 3S30A 2WZ8A 4MGTA 2VZ3A 4AL9A 2JDUA 5EHDA 1AL23 5A6XA 2ORZA 3O0WA 2C4XA 5KHKA 4MHUA 4X6RB 4J1XA 5JXIA 5K0UA 1GNHA 5C9AC 1UU4A 5FMDA 3VBSC 4G4FA 3WHTA 5FO9B 2E7AA 2C6SA 2HYXA 5JXHA 3LKJA 1CAUA 3PMEA 4CDWA 4EJRA 3FHAA 1ZX5A 1RUE3 2XOMA 1W04A 1NA1B 4BWOA 3BTZA 1EAH2 1C8M3 1RXFA 1XOYA 5L19A 2WN3A 2JENA 1VBE2 3FZ3A 4ET7A 2QQWA 4O61A 4Q29A 4AVVA 4B3NA 2W5FA 2NMOA 1FOD2 2XH6A 1RUI1 2P3JA 1MZ6A 3BTAA 2DUPA 4KWLA 4RD7A 1VBA1 4RL7A 5JR7B 1N47A 4OVEA 4XFFA 4D6SA 4URAA 2PLV2 3K4ZA 5FZ3A 2YMZA 5LB6A 4JGYC 5I0DA 1OURA 4CCMA 1CZSA 3HT1A 2XBO3 4MGQA 2X09A 4AVTA 2VBBA 1PO11 4OCTA 1QJX3 4OHZA 2Y0IA 3KMHA 4BE3A 1QXJA 4MYEA 4OMCA 3MV01 3D0SA 1V6KA 5FK8A 3BPZA 4EN8B 1JZ6A 2RJLA 1AR61 4NHMA 3S7EA 1W8WA 2L9LA 2XWJB 3T2QA 3LGRA 3NV3A 3HOBA 2VUJA 5DDJ2 3PNAA 1ZRIA 1QJEA 3ZYFA 1UU5A 1FNZA 3GZEA 4HK9A 4HSLA 4Q4X3 1RUD2 5IVVA 4CXWA 3TEZA 4WVMB 2FDFA 1POV3 5JUVA 3HR9A 1X50A 5GZGA 4YM1A 3HQRA 1WW6A 1OFNA 4Q0UA 3AKQA 1RTVA 3L2YA 2TBVA 4XIKA 4PIZA 5FREA 5FZBA 5C4WC 4IE0A 1BQPA 2R043 1OVSA 5ANQA 3VV1A 4XILA 1RUC3 1XNBA 5DN2A 2XGXA 4IESA 4CCEA 4UXAA 2OZ6A 4TLGA 3I7DA 1ALYA 1NCRB 3RFRA 2XLGA 3KHBA 5F3GA 5FZEA 4AFAA 4AW7A 2HEWF 3VBHC 3GJAA 3UKVA 4ITCA 2B46X 1J3QA 1SLAA 4EE2A 2RS11 5H9SA 1AF9A 3POYA 2VAUA 2WLPA 3GYDA 3WY6A 1LB2A 3AZVA 4RYDA 2YY1A 5FWEA 4M4RA 5T5LA 2MNGA 2DU0A 1J3RA 4Q4W3 4CUAA 4UFMA 4JKKA 2PQSA 3NW4A 2VQTA 1W03A 1WLWA 3ZPYA 4CRQA 5IT6A 5FPUA 5K0UB 3VKNA 3O1TA 3KCYA 1U5YA 2E53A 4I09A 4HN0A 4AI2A 3ZDVA 4DEVA 2Y6GA 2BFUL 3SEPA 4AE2A 4CP2A 5IVEA 2WFF2 1VAMA 4NRMA 1O3RA 4Y1YA 1IQAA 3FLPA 1ENQA 3M7AA 3MV11 1H9WA 2X10A 3O1PA 4UFIA 2FMYA 5FPZA 2Z4FA 1S0FA 4YZ5A 4AFMA 1HB2A 5CG8A 1AR83 3AKTA 3H3UA 2V09A 4N53B 2XUEA 4CCCA 3K46A 1F31A 4AEJA 2ZGTA 2E51A 3EJKA 4NJ4A 4P00B 4TWTA 4MGKE 2BGPA 4QB6A 1NYWA 5F32A 3S7IA 4LA2A 2GSYA 3KZ4C 2P34A 2VC9A 2PHXA 5AVAA 3HVDA 3VDBA 1V6IA 3KV9A 1PO23 4RHV2 3AJZA 3T2PA 1EUUA 2YXSA 2YBPA 4MGIE 5G04L 1H4HA 4LO5B 3RDIA 4CPBD 5A33A 3WW4A 5A1LA 2J1EA 2ZABA 3D5OA 1XB9A 3MZHA 1DYOA 1X9TA 4KGQA 2DTYA 5L7OA 2WNVC 5EP9A 2XXZA 3WZ1A 3KT4A 3U4XA 5JOZA 1RHI3 2EIDA 3DV8A 4XUPA 3TEYA 5KXBA 1C1FA 3UGFA 3B9IA 2OZJA 3FC0A 4BQ1A 4BB3A 4FOWA 2D5HA 3H0OA 1YQ6A 4NOTA 2SBAA 4LEJA 4KWJA 2NPIA 3NO8A 4FQ4A 3RZZA 5C5TA 1UOBA 5H9QA 1GQPA 1KJLA 2J42A 3U4SA 4UW6A 4C91A 1JODA 2ZXQA 4NAMA 1ULOA 1XPWA 3INAA 2DFBA 1QIQA 1XE8A 4UBHA 5FZ7A 2VW1A 1W8UA 3OB8A 3I2KA 3OTFA 4UFHA 5GJ6A 5A7NA 1KEXA 4W6XA 5FMCA 1RJ7A 4S2HA 4E4HA 1HLCA 5BV6A 2W92A 1PIV1 1TVGA 4HLTA 1MS8A 2EA7A 4L99A 4YVWA 2K46A 1QXPA 2YHJA 3RQ0A 1GKBA 4QGMA 2TUNA 1E5RA 3SH3A 2QQKA 3N3HA 1W3VA 1Z7S1 1QJY3 2QDNA 1RUNA 2WZEA 4YFWA 4C1XA 3B69A 2VZPA 3AYDA 3MFAA 3NV4A 2SLIA 2R7EB 2IWGB 4LBMA 4NHXA 3X29B 3I59A 3JQWA 4FFGA 5FXVA 5BPXA 3ZVXA 4QX1A 2OXBA 1FPN2 1EY2A 1ND3A 2G9GA 3UT0A 2YDEA 4MOAA 1QOOA 1MS0A 1Y7BA 1D4M1 1OF4A 2FQPA 4RGAA 5FV3A 3TNPB 5LWBA 3U14A 3C7HA 2FDGA 1YC61 4BU2A 1D2SA 1HRV1 3CZJA 3K51A 1K12A 5FYHA 5I0RA 2YC4A 5FZ8A 5A7SA 3RMYA 1GR3A 1UF2C 4XJUA 4B7KA 5GZFA 1DQ6A 2NMNA 1ASJ1 1COV1 1CX4A 2RS53 1TME2 1LEMA 2OUHA 3NJXA 3PVEA 3BUCA 3I2GA 3RG0A 3TBDA 1JZ4A 4Q5OA 3MW4A 4OHVA 5DAPA 2AH2A 3ELNA 4E2SA 1G7YA 2W2IA 3IMMA 1BBT3 3NJYA 3NL1A 3THPA 3SISA 2HWF2 1KS5A 2HEYF 4RQPA 1OOPB 1CAWA 1ZRRA 1S0IA 2BTVC 2ZX3A 5IUQA 4BQ2A 1MEC3 2Q1ZB 4KG0A 5EYXA 5CBLA 2RV9A 1PX3A 1BK1A 2VCMA 4R52A 3ZYBA 3JD72 1I1EA 3ATGA 1FNYA 1WA6X 2VY0A 5F6LB 1AXKA 3W58A 4IV3C 1R082 1UMIA 3LPGA 1ZZ8A 5AC93 2PA7A 1DZQA 1O3SA 1MQTA 3NRUA 5ISLA 3LIHA 4MV2A 1W6MB 5C7GA 4PDWA 3Q9OA 1O5UA 1YFWA 2BEOA 4AI1A 2CV6A 3FLRA 4NPMA 2JX9A 5LBFA 2CSGA 4A3ZA 4BK4A 1NXD1 4LHSA 1GBGA 1K45A 4Y1XA 5FLJA 3WP6A 2ZAHA 4AVAA 2ZMNA 3H1YA 3CEWA 3W5NA 1AR91 2O8OA 1OPMA 2ET1A 1QJU3 5DZFA 3VKFC 3ZSEA 2EXHA 2JDHA 1R1A1 4XMAA 4QWNA 5GZEA 1W8HA 3I59B 2BWCA 3LEKA 2GNBA 1KDMA 4HMZA 2HH9A 1ND3B 1PMJX 4OYUA 4QM9A 3T4HB 4LUMA 4D6QA 1AYN2 3SCFA 1LODA 2GU9A 1MACA 1U5XA 1C8NA 5HCHA 4M3CA 5IVCA 3ZFGB 3ACFA 4RR3A 1SLLA 1AR72 3ZR5A 2VOWA 2A3XA 1Q5OA 4YW1A 4XTPA 5D8AA 4BQYA 5FYVA 1CJDA 2ZEZA 4XJ9A 5T54A 4RGKA 4ATEA 3HN3A 5LRRA 1GUIA 3JQXA 1YCIA 1VJ2A 4PIXA 3FLTA 1PK6C 4BMBA 2R1DA 1KRIA 3VZJA 4NO4A 3AKRA 5KHGA 1ZBA1 2BBVA 5EJ1B 1GWLA 3BALA 4Y1UA 1XNAA 3HNYM 4HK8A 1CZVA 4RA0A 3UYJA 1JH5A 4LO8A 1O3QA 4AYUA 3LA7A 5LA9A 3HNMA 2ENRA 1DF0A 1GICA 1O59A 3R6SA 4P5HA 1A34A 5FJKA 5FPVA 1SACA 1F4AA 1UKGA 3PTRB 4CTEA 1V6NA 1TG7A 1CZTA 2W68A 3LDBA 3O7OA 1VBD2 1D0GA 1RINA 1ZVFA 3EMRA 1F9KA 1GU3A 2K0GA 4YG6A 1V9U2 3ZN6A 1W6QB 5FY1A 1AL22 1YLLA 1EAH3 3H9AA 5BYNA 1ZBE2 1VBE3 2CAUA 1Q3EA 4A44A 2EXJA 4DXTA 3OBRA 1QJZA 2JJ6A 1UX7A 1W6NA 2WA3A 2WDBA 2EXKA 2P6HA 2WIIB 3FMGA 3J4UH 5CFDA 3SXWA 4QPGC 1L7LA 3LSDA 3ON7A 3IM0A 4FPOB 1YFXA 1QY4A 3BODA 3HQXA 5A7WA 5F8PA 3WDXA 1S2BA 1UY2A 1MS5A 1STMA 4MXWA 3JUUA 4PT6A 2WYFA 3IKWA 4CDUA 1CVNA 1PGSA 2GN7A 1VB2A 3DYMA 4XBQA 4N43A 4OQ9A 2DV9A 1J1TA 1IGOA 1HV0A 2RM23 4IDZA 4GWIA 1BK0A 5CKQA 1ONAA 1YQCA 5DDJ3 3WD5A 2GMMA 4JHTA 4F7ZA 4TZDA 2DCKA 3N9PA 4M3CB 1QJX2 1V6OA 5F6KA 4RR3B 3DF0A 2ZKNA 4YGDA 4OFGA 3U11A 4AEMA 2VCAA 4G9SB 4INDA 1U5IA 5FZLA 3VZOA 5C33A 3DXTA 1C8M1 4NE9A 3BTYA 3AZZA 2R062 1YO8A 1OKQA 4HL0A 4GB31 4Y3OA 4Q4X2 2D6MA 3LWCA 3B01A 3WNOA 4Q26A 1URXA 5T5OA 5DUXA 5FOJB 2XQXA 3MBWA 3UKTA 3E5XA 1NLQA 1WUVA 1RL3A 2VZUA 1RUF1 1JYXA 2R042 3WUCA 4CDQA 5CEHA 1UY3A 2OW4A 4EZ4A 3FUQA 2ZJCA 2EIEA 4YWAA 1JXNA 5LEKA 4A7ZA 2LUWA 1UYZA 2W87A 1RMU1 5FTTC 2B5HA 4N8MA 4UFJA 3D0JA 2V4AA 3H1MA 2VVFA 2IUWA 1I6XA 2BU9A 2DWRA 2Y6KA 2WN2A 2QQOA 5BNOB 4GMP0 3E1F1 2IZWA 2WFF3 3B93A 1L7QA 3GGLA 3AXEA 3ZN6B 3M2MA 2G4IA 1UNBA 1SMVA 4CP1A 4D8MA 4Z8BA 1I3HA 2RS31 3AFGA 2P6CA 4AEDA 3MI8A 4UI9L 1CAXA 4L2NA 3O1OA 2XJRA 2B39A 4LKSA 2HWC1 1DLLA 1BKZA 3AMQA 1W6NB 1F4HA 1YXWA 4LIUA 1OPOA 4DFSA 1R092 4AFBA 1WWYA 2K9ZA 2WBKA 3GZUC 1K5MA 1PGL1 1EUTA 3AKPA 4K3UA 2ZGLA 4K8RB 5JIAA 4JAAA 1H8VA 1W0OA 2B9UA 4YRDA 5F3IA 4CUGA 2UU8A 2DVFA 5FO7B 2QTWB 1R1ZA 2YB7A 1ND2C 5HV0A 3D82A 4MXWB 5A6ZA 1AX2A 2JG9C 1AR82 4WM7C 4CDUB 4EN0A 2CAVA 1JOBA 3AJYA 4IE4A 4N43B 1MS9A 1DP0A 1N1VA 4DRVA 2R30A 4BCUA 4YVSA 2G1MA 5B4XA 4BZ4A 1VRH1 4R4ZA 3KV5A 1G9FA 2IC1A 1BEV1 5FY0A 1KJRA 1F5JA 1LOBA 1XNCA 2Q1MA 3AP4A 4JGZA 4M01A 4CCLA 2HWE2 3VBOC 4B29A 1A6CA 2XLAA 2PHFA 1EV11 1W9WA 1KFXL 4Y5Z0 3VDAA 5J48A 1UIJA 2QQNA 2ZPXA 1HKDA 4HBNA 2PHDA 4PLMA 1ODMA 4LK7A 2E7TA 1WLCA 2DYCA 1JZ2A 4MVTA 1W6OA 2WNUA 2KA3A 4ZU4A 4CXYA 3H3ZA 4XBNA 3ZXFA 3ZN4A 5H9PA 1Y4WA 5JIUA 5LW9A 4XFBA 3OD0A 5CG9A 3L2HA 1PGW2 2ES3A 4XFIA 2P3YA 1JU4A 2RJKA 5J1XA 4CDQB 4CEWC 4NPLA 5FYCA 1YEWA 2XUMA 2GN3A 1T2XA 1POQA 4QHZA 4YGBA 5F2SA 2QUOA 2ZEXA 4JTNA 3ZYHA 4CCOA 4GH4A 3WSOA 1ULFA 5K4LA 5FPAA 2QCSB 2XL9A 3E5UA 4LQRA 3GBFA 1EP0A 5J09A 1HRI1 5FZCA 1DQ1A 1PM4A 4LORA 4PLOA 3RPQA 4X6QB 4BQWA 1FPN3 2DBIA 5A3WA 5DUUA 1CAXB 1PVXA 4XAAA 3R0RA 4AEDB 3T0DA 1HXS2 3OPZA 4QXBA 1SPPA 1S0CA 3B02A 3M70A 3HEIA 3AFKA 2D6KA 1HB1A 5DABA 5I0TA 1SG3A 2D93A 1W8FA 2VH9A 5GZDA 5IW0A 1JU3A 5T5JA 1K5MB 2NP0A 4I2OA 4JX0A 4LUKA 4C90A 3PMSA 3LDKA 5LATA 4Y1ZA 1H0BA 3DKWA 3CZUA 3CJIA 2YV8A 4Q0SA 4EV0A 1H4GA 2I45A 5FZFA 1ZZ7A 4QX0A 4AK3A 1RC6A 1H2NA 5CFCA 1HB3A 4NUBA 2Y6HA 2WS91 3KSCA 1NUKA 1TME3 5FZ4A 2R072 2VTFA 4HVQA 2WA4A 3AZWA 4QKNA 3SMHA 1DZTA 3GNEA 4YVSB 3HD8B 3ZFEC 3OD4A 1LHOA 3HIFA 4A7YA 1XNDA 4IXLA 1REDA 2X53S 3VHOA 1UIKA 1S0EA 3UKNA 4JGZB 2GALA 2JDNA 1SQ4A 2ZKLA 3J8F2 4CU7A 3FL7A 3ORJA 4DUWA 4NPRA 1NZIA 2HWF3 1H6XA 3IDEA 1CWPA 1VBC2 2JD9A 4Y22A 5GLVA 2WO1A 4LBOA 4OUMA 5FZHA 2WLQA 5C8CA 3MGUA 4AZZA 1GYKA 2D98A 4NHKA 5LY2A 1W6OB 5FO8B 2WNUB 3WP3A 2DUOA 1FYUA 5TSWA 3ALQA 3RJRA 2J1SA 1JYTA 1XU1A 3R4DB 1R083 3GHNA 1NG0A 4LXLA 5HXMA 4FP2A 4DQAA 1YNAA 2LW8A 1RUG1 4XUOA 4W8JA 2Y0OA 3PUHA 2E31A 5DUVA 5CISA 4KL1A 1RJ8A 1NA1C 2DU1A 3K48A 1RUOA 1OQEA 2B4KA 3VB9A 2BDRA 4YW4A 5FOBB 3I49A 4XJAA 1QU0A 3WQ0A 2YU1A 4GH4B 3RYRA 4XUNA 5AC92 3IT8A 4BJ0A 3IDBB 1QOSA 3SCHA 5LA0A 1DYPA 1MPXA 1SBEA 2FCUA 3WF4A 2VGDA 3NNFA 4B4QA 3BU0A 1GP5A 3RZJA 1HJFA 1RGSA 1B35C 3DL3A 4QXHA 1QOTA 4MGYE 4CCDA 5A3PA 1JI6A 1A78A 1AYN3 1FMD3 1SDDB 4UW3A 4K20A 5KXDA 1SPPB 1HN0A 3U1XA 4ISQA 5IFTA 3PLQA 4I30A 2J1TA 2OA2A 4CUBA 2H0VA 1LOEA 1K3IA 4XF3A 5FBZA 3IAPA 1Q8PA 4XABA 2C26A 4CDXA 4CCNA 2X5IA 1QNWA 2B8MA 2VZRA 5C71A 1ZRFA 3WG2A 3AP7A 1W6PB 4KNCA 5CFCB 1CAVA 2B42B 4BDVB 4HETA 3WDWA 1N1SA 3POIA 4QU2A 4K1YA 4GXLA 3UV9A 3WG4A 1MS3A 2EAAA 3BYWA 3C8XA 4BPZA 2HJIA 5F5CA 1UXXX 1QDOA 4QGLA 2C1FA 3KV4A 5IYYA 3VBFB 1JYIA 4O7XA 1PHMA 2Y6LA 3C7FA 4MSVA 2UURA 3I8TA 4UFLA 4CU8A 5ACA1 1NCRC 3ZFFA 1OXCA 1PVC1 3MIHA 4Y22B 4QPIA 2WRAA 5FYMA 2BNNA 3VBUA 5C8CB 2A73B 1C4RA 1AJKA 5IATA 4XXPA 3CMGA 2P3KA 1V9U3 4PCRA 5FAXA 1OMIA 2YUEA 3VDCA 3POEA 5BUVA 5K8SA 3S57A 1ZBE3 4RS5A 3U10A 3H3LA 4OI0A 5K0UC 3DCQA 4CPBA 1S0JA 2JKXA 3MLLA 2VXJA 3WNMA 2QQUA 5J36A 3D4KA 4FOYA 4YLZA 4Z07A 2BERA 1RUI2 4ZONA 1VBA2 2BQPA 2OPKA 4FXGB 3RZLA 1S2EA 2JB4A 1AX1A 4FVVA 2Z79A 2UYAA 1I5PA 2QJVA 4N53C 4CEYB 3OY8A 4B8EA 5F37A 1UU6A 1WCQA 2VZTA 1FV2A 4OUSA 5JI9A 1W8ZA 1PO12 1VBB2 2YFUA 2UY8A 4LULA 2PMWB 4XQ4A 4LBQD 3NJVA 4DIQA 4BIFA 4IEYA 4XBLA 5JOXA 4YFZA 4M00A 1O4ZA 1J1LA 1REFA 4JKMA 4AHWA 2W0XA 3ZMOA 2FMDA 3WNKA 4AQTA 4Y26A 1RUJ1 4LKDA 4AGRA 4P9XA 3I2HA 2RM22 2VE1A 3VZNA 4A41A 2YPDA 5FDBA 4M3CF 2DVDA 2ET7A 5CNAA 3ZSMA 1NY71 2RR11 4LBNA 1DIWA 2X5IB 4LBJA 4P9WA 4XF1A 2W52A 1VBE1 2R063 1JYNA 4GALA 1W0PA 3OEBA 1W9YA 2RDSA 4JGYA 2EIBA 5HV4A 5JCTA 1FOD1 3WF0A 4K21A 4D69A 1CAVB 3ZYPA 1GWKA 3DECA 4E4DX 2PLV1 2R0FA 1NAEA 2FDHA 4LJHA 3SQOA 1H1MA 1ZZ6A 3KGZA 3LD8A 2OS2A 3AMHA 5I8YA 1MZFA 5EPAA 3QACA 2RS12 3IN9A 2NN8A 2N7GA 4EN9B 5HXVA 4QPIB 2X05A 3BPSA 4E27A 3AKSA 3VBUB 1M4WA 4LT5A 1RUH3 3H1WA 4IEVA 3FN9A 3AVSA 3QCWA 2BUKA 3WHUA 1SHWB 3SNMA 1RVF2 1YJKA 5ANNA 1GANA 3WQ1A 2IXIA 3ACIA 1UPSA 2WO2A 5C4WA 1RUD1 2MEV1 4RS5B 2GNDA 4H14A 1WCDJ 4PQQA 1X8MA 4XFCA 1XXNA 1NQJA 2VOVA 2YYOA 3U75A 1OKOA 3WT3A 4IETA 2AENA 1SZBA 4LK6A 3I2OA 3SITA 3NSTA 3ASIA 3GZTB 4IEWA 1CAUB 4LO7A 1U5ZA 1W2AX 1R093 3I3QA 4CDWB 5C3OA 3WDVA 2GDFA 4Q4Y1 4JCKA 3VBHA 2ATFA 4TN7A 1QJFA 4WVWA 5E1RA 4CVUA 3LFIA 1Q8SA 2QVSB 5GALA 2RDNA 2CWMA 2WZR1 2CDPA 4YW7A 3O0VA 1V70A 2NYYA 3JBG1 2WT2A 3B5LB 3MIBA 3RWNA 4FPLA 3LAGA 2JDPA 4AWDA 3ENRA 3ZYJB 3A23A 1WMFA 1HQNA 3GBGA 4ZXKA 2BZDA 2HWE3 4KGGA 3H50A 5FQ0A 3VDDA 1NE4A 1CX1A 2WFF1 3M8LA 4LNVA 3WLUA 3QBQA 2XR4A 5CYYA 4JZRA 5FZIA 4BLIA 3VZLA 4QAWA 1ULEA 3U0ZA 4AFDA 2EVXA 4OMDA 1UAIA 2YG0A 4QQOA 4JGYB 1AYM2 2OIIA 4PI0A 1HQWA 4ES8A 3IBMA 1YIFA 4W6YA 5FZKA 3URFA 2BOJA 1OOPC 2VTXJ 4F83A 3LE0A 2CNAA 2Y33A 1LESA 3TN91 4ATFA 1S2KA 1DFQA 2QDRA 2ZHLA 2WO7A 4OZXA 4QKDA 5FP9A 4DRRA 5T50A 4E9KA 1JZ3A 3DYPA 4OHXA 2VNOA 1O91A 4XF4A 4M0NA 2ZZQA 4RHV1 3ZPOA 4KQ7A 1H30A 3RNSA 2FDIA 4XF9A 3K4DA 2E63A 3VLBB 5IHRA 3WG1A 1YJLA 1Z7S2 5KBFA 4BISA 2VZQA 3OGRA 4GAZA 4LO6B 4BIOA 1NOVA 4OHWA 4QKFA 3MIGA 3MF9A 4QD2A 2J1RA 4CP9A 1UZ0A 5FPXA 1HXS3 1BZWA 3RMXA 2Y34A 4P02B 2JG8C 5C5UA 4MADA 4WVVA 5EFUA 2BFUS 4RN5A 2PQQA 3PDQA 1ULDA 4WM8A 2VNVA 3ETPA 1W9FA 2JIJA 1Y3TA 4QDQA 5KC5A 3MEPA 1D4M2 2QNKA 4COUA 4NHLA 3GZAA 1E5HA 2PHUA 4H7LA 4ZY9A 1ND3C 1DGRN 1HRV2 5DG1A 2O1QA 2J1AA 1O5LA 4JHZA 1HIXA 4QM8A 4R9AA 5FZAA 2ERFA 2RJ2A 5EIYB 1JZ5A 3WINE 3ZFGC 4KBZA 1OSGA 2WNEA 3FX3A 5KWRA 3T30A 2B7YA 2UWAA 4UYBA 2R073 3OUJA 2P3IA 1QEXA 2VO5A 1COV2 1ZZ9A 1W2UA 3M3IA 4J6GA 3W5MA 3K77A 1C57A 4FFFA 3V64A 3P3NA 3RS6A 2P5BA 3BOWA 1A3KA 3J8F3 1C1LA 1H2MA 5FQ0B 3FE5A 3VDDB 4CP0A 1JBCA 3N9QA 5A32A 1DQ0A 1JW6A 1VMFA 3LZZA 1VBC3 4FBFA 2ZX2A 3D3AA 4IGPA 2DFCA 3EHKA 4TXWA 3VHPA 4FAGA 5A33B 4YG0A 1FPN1 4XJ8A 3OOXA 4E4SA 4UOJA 5EJZB 2UWCA 5L7OB 1PMIA 3Q8CA 2BYVE 1LKNA 5IVJA 4Z2WA 2JWPA 4AF9A 1NX9A 3EBRA 2C5DA 4S2DA 2Y6JA 4HKLA 1LU2A 3RYPA 3T1MA 3RRDA 4XF0A 4PBOA 4BA6A 3IMNA 3ZXKA 5FYZA 2VMEA 5LASA 3UGGA 1AVBA 3DPRA 3MIEA 1XU2A 1IG0A 5LA1A 3N35A 5CZKA 4Q27A 5FZOA 3AZXA 3GCXA 3RVHA 1VMJA 3O0XA 1OLRA 3JB4C 2A3YA 3BGAA 1O8SA 1ZM1A 4ASKA 4HVRA 3GJBA 1WA4A 5APAA 1ZRCA 2AYHA 2GNMA 1YQ2A 4EZHA 3A22A 4N9IA 1LTEA 2VVDA 3AC0A 4YVWB 2E7QA 4QPYA 3WQBA 2JIGA 4D0QA 3AB0A 3VUOA 1ENRA 3V0BA 2JDMA 1QQP1 4KH9A 1Y9MA 4M0HA
chains in the Genus database with same CATH topology
1TEIA 1R1A2 5KHIA 5J96B 4WM8B 1B09A 4I3GA 2JICA 4JRLA 2BGCA 1F8VA 2ARXA 2A6ZA 2BWAA 3JD71 2PAKA 2JDZA 3UJOA 1FMD2 3CLPA 1DGWX 1IS4A 1R081 4ASLA 4BH9A 4YG3A 5LEJA 4QQ2A 4RR3C 1C5IA 3L9JT 3PJQA 4LBLA 1IHMA 1PNFA 1G9AA 5BNNA 3WP5A 4LR4A 4DMIA 2UWBA 4N9HA 5A32B 3KLSA 1NCQC 3DN7A 1OA2A 4AQSA 4Q4V1 5I93A 4AVSA 4O9GA 1DHKB 2A3WA 4K7JA 3GF6A 1OQDA 3ZXEA 2YGMA 3POWA 2WQZC 1ZREA 3ZX7A 1Z78A 3ZN5A 3H7JA 1AR71 2LALA 1CAWB 1A8MA 2D44A 2IXLA 4IERA 4QQPA 4RQPB 2F6BA 4I02A 2VUAA 1PK6A 5BNOC 1IKQA 5FMOL 3DPRB 1CPMA 4AGVA 5F9TA 2D6PA 5T3NA 3VBRC 1RUI3 1WBFA 4L8QA 1VBA3 1HV1A 2HWD1 2E9QA 4A3XA 4PLNA 2ZHNA 3LA3A 3ZSKA 4META 1MQTB 1UN1A 5ABJA 3USUA 1PZ8A 2XVLA 3A4UA 4PDWB 3S0MA 3TWIA 5JOWA 4FPGA 4DZGA 1X33A 1DGRA 2RMU1 1PO13 1VBB3 1FV3A 3WDTA 4DPNA 2F4PA 2XB6C 3ZYIB 1SDWA 5HI0A 1VBD1 1AR63 5KHHA 1DG6A 4CDUC 2VW0A 5JMCA 4N43C 1S0DA 4DS0A 3PTYA 4I0BA 1AL21 3PVBB 3KT7A 2XVKA 4FOQA 4QPGA 3VL9A 1X36A 2A6VA 3E5QA 2GAUA 2WZPP 1XNKA 1YI7A 2PHLA 1OI6A 2PAEA 4XFGA 3PVOA 1RUE1 4GB32 4Y20A 4X8NA 5D8AB 4OI4A 1NE6A 2GC0A 5BNNB 4TYSA 3KCXA 2D97A 5EWSA 2HWB2 5A3MA 2DURA 2RS13 3ZXLA 1MVEA 1DQ4A 3ME2A 4KBBA 1HX6A 4HN1A 2R16A 4MGZE 4D7TA 2ZCWA 1RMU2 4CDQC 3CU7A 3H7YA 1PNGA 2XBO1 5BNPA 1SLCA 1RVF3 3BOPA 1QJX1 4D7YA 3MIDA 1XRUA 4FPHA 4Q2FA 1EPZA 1MZ5A 1RUH2 2RS32 1LGBA 1PK6B 1G9CA 1MS1A 3C3VA 1QF3A 3THTA 4YYOA 2GC1A 2HWC2 5T5PA 5EV7A 1OA3A 1XYPA 4JRAA 2AUYA 2ZX0A 4Q4X1 4AI8A 5FFOC 4AEDC 1POV1 1PGL2 2ZHMA 2IFWA 2DVAA 2A7AA 3MW3A 5ABJB 3ZIWA 4BHPA 5CFDB 3TOJA 2R041 1RUC1 1K5MC 3WW3A 4Z82A 1YUDA 4B4RA 5JLVA 4R4XA 1WMDA 5DZEA 2OUJA 1LOAA 1SCSA 1LGNA 1BEV2 2D43A 4FPKA 2H6CA 2VECA 4Q4W1 4YVSC 5I8TA 1EV12 1G8WA 4G3YC 4QPGB 2ZHKA 1X8EA 1DQ2A 5EYYA 1AYM3 1NLSA 4V1PA 5FLHA 2ZTNA 1UD1A 2XPJA 1ND2A 1ULCA 3B9CA 5AFBA 1U12A 2IXJA 2VNGA 5E8AA 2JG9A 1ZRDA 4WM7A 4DOUA 2XL7A 1QDCA 1OHFA 1TNRA 2D40A 2WNUC 4GA9A 2NQYA 4XIOA 1LOFA 1AR81 1LHVA 4PQ9A 5CADA 3NAPA 1YIPA 3WQ7A 3JB8A 3N4MA 1TMF2 2IXCA 3G7DA 3J9SA 1V6MA 1JUHA 4WBBA 3VBOA 5JDBA 2PAMA 5HCFA 1WLTA 1Z7S3 5BNPB 1QWRA 2BVBA 4H7MA 1PZ9A 1FATA 4GH4C 5H9RA 1UW8A 1PO21 1HRI2 2X8KA 4L9BA 5JI7A 3VKOA 4C0HA 1TQ5A 3WW2A 2A6WA 3ILRA 3E6DA 3OJBA 2XKPA 1D4M3 3WXPA 5GZCA 1HRV3 1RHI1 5JZGC 2WT1A 2NM1A 2KXLA 2Z42A 1S0GA 3MPPG 3VZKA 5JSPA 5IK8A 1KFUL 2D3RA 3LOBA 1ASJ3 3IPVA 2ZGUA 1ULGA 1COV3 1XYNA 4AHYA 3RYKA 2ZOEB 1H8TA 3WX5A 4YARA 2Q4SA 1YRZA 5CFCC 5KXEA 4Q0VA 2GC3A 4MUVA 2JEMA 1X82A 4FPYA 3OGGA 4FO9A 5HCAA 4COYA 4LLFA 5L73A 3VHRA 2W39A 2XG3A 1SFYA 2ZGKA 3HWJA 4IEOA 3VBFC 1HXS1 3V56A 1HDKA 1QJY1 4YNIA 1SLIA 2WT0A 1YYNA 2PHRA 4P14A 1ND2B 3ZYGA 4XFHA 1H1IA 1H9PA 1WW7A 5C8CC 1LU1A 1XYOA 1QGLA 4LBQA 4QQLA 4WM7B 1FI2A 4IV1A 2EXIA 4XEZA 3KM5A 1GNZA 1RUG2 3ZFEA 5I91A 1QXRA 3NAPB 1BJQA 3UJQA 4BOWA 2D6LX 1QKQA 2CWSA 2JKBA 4HSJA 3IWZA 3M3CA 1Q8VA 3VBOB 5FRAA 4YM3A 2VG9A 4D94A 3QOPA 4Q1PA 4OHYA 4MH0E 3AM2A 2Q30A 3ES1A 3J8F1 4LE4A 4N7IA 2RS51 1S0BA 1R1A3 5J98B 3ZYRA 4CEYC 1ENXA 4EN6B 4W65A 1PM7A 1BBT1 2RE9A 3GALA 4AVCA 3O14A 3AZYA 1MEC1 1BXHA 4GQ7A 1REEA 4FT8A 1DBNA 3IPVB 4PBPA 3UK9A 2WL1A 4Z1VA 4SLIA 5SV8A 1F2NA 5CAZA 4Q0QA 1O7FA 1ZBA3 2VNRA 2X5IC 3CJIB 3FWEA 1H8TB 2IXKA 4I01A 4DB5A 1VAVA 4H55A 5AC91 4CYDA 1H2KA 1B35A 3IIAA 4OI1A 3WR0A 3P3PA 4RFT0 1JUIA 2D6NA 2CGPA 1J58A 5ACA2 4MZUA 1PVC2 4GWMA 1UPIA 2IFRA 2HKXA 4JDOA 3MIFA 3I4IA 2VOXA 3VL8A 2C9AA 4I0AA 1WMEA 1QJU1 4QT6A 1GFF2 1IZ3A 3AX4A 1CR7A 3HBZA 5J37A 1LULA 3ZXAC 2DUQA 4LBQB 1LOCA 4L92A 1NLRA 5GJ6A 3ZN4A 1YI9A 2A70A 4WVMA 4EN8B 4IV1B 4XPVA 1APNA 5BY5A 4WZCA 1BMV1 4W6WA 2XLFA 1GZWA 4WV8A 3ZFEB 2VVEA 4UBGA 3N7LA 3QD6A 3BB6A 1VB4A 5GLZA 1FXZA 2EIGA 1NCRA 4CDWC 2UYBA 5GKAC 4ISRA 3CL1A 2VULA 4H3WA 4R8HA 1UZZA 3KCCA 4ZU5A 3PHMA 3B3QE 3OBTA 5HBAA 1I9RA 1G6NA 2KM2A 4U2AA 3NKTA 2IXHA 4LE3A 1EPWA 2V73A 1N3OA 4ORFA 1IKPA 3ES4A 4QGNA 3VBSA 4YW2A 1ZZBA 4LA3A 1AUYA 1VALA 1VP6A 1A8DA 2CTVA 4EWDA 1RUJ2 2JD4A 3N36A 1LR5A 1BVP1 2ZZJA 1KXGA 1AR62 5GLUA 3FUOA 1NY72 2RR12 4C0BA 4FPEA 2VQAA 3VZMA 1DGLA 4AQ6A 4BYYA 1QMJA 3AMMA 4GB33 2YZ4A 3TYJA 4FSJA 5JSRA 1EAH1 2LM3A 4CDXB 3NVCA 2DF7A 4N53A 5EXOA 4GKXA 2WKKA 4R9DA 2HWB3 1RUF3 4KG8A 1B35B 1W39A 3LSEA 4I3PA 1JOJA 3PVNA 4YZ3A 4QXKA 5HCBA 2OYZA 1O4YA 4WVZA 3I2DA 1VBB1 1RMU3 3M3EA 3B7MA 1AZDA 2VPVA 2PTMA 4GMP3 3ZFFB 3RSJA 4FOVA 2PHTA 4YM2A 1SLBA 1OA4A 3LA2A 4GIQA 2RM21 2RS33 3FHIB 2MEV2 4Q0PA 4R9BA 2ZGPA 4ONUA 5DDJ1 2HWC3 3WVJA 2ILMA 5DUWA 3AK0A 1DZRA 1GZWB 3KB5A 2EF6A 1BYHA 4Q4Y2 4PIYA 5J3UA 1HQLA 2FZ2A 1SFNA 4QMAA 5K9YA 1AL0G 4D7SA 1OD5A 4HVOA 3B94A 2WZR2 4RSUA 5T55A 3U07A 3CNAA 1DGWA 1IS3A 2A6YA 2V5YA 3MW2A 1C5HA 1NQDA 5FCCA 3JBG2 4GKYA 2XHKA 4LHLA 1VRH3 2ZGOA 3OY8B 3CO2A 1BEV3 3VBSB 1Q8QA 1LCLA 4YSFA 1RVF1 4XE9A 5C9AA 1EV13 1ZNPA 2NLRA 1KDKA 5LK5A 3CJXA 2VMGA 2XKOA 3AP6A 4EROA 2DVGA 3VDDC 3TNQA 1VIWB 2JECA 1WGPA 1CESA 4CZSA 3QH7A 4XYXA 3BCWA 5L7OC 2VU9A 2CY6A 4MX3A 3T1LA 3WCRA 3W59A 5JPNB 3TN92 1LGCA 4R9CA 1TMF3 4QQHA 2G9FA 4J1WA 2YPJA 4E2QA 3RI8A 3ST7A 2ZACA 3E6CC 5LRSA 3FFQA 4F8AA 2OVUA 3BU7A 3KQRA 4HFSA 5CVRA 1DQ5A 3H8UA 4MXVA 1RIRA 2GZWA 2VMIA 1HRI3 1LHUA 1PIV2 5A3LA 2WNVA 4NR1A 5I0UA 3LOIA 1OLQA 2D5FA 1KQRA 3PJYA 5LK7B 1V6JA 1OQ1A 4URTA 1OOPA 4XJWA 4YVWC 1S1AA 1AYM1 4S2GA 4Q8KA 2GH2A 5C4WB 3V0AA 4JDMA 4IQPA 2TNFA 1FT9A 1AJOA 2YGLA 4K40A 2P2KA 5B2GB 4WM8C 2D6OX 4KU8A 3FBMA 2QE3A 3VBHB 3MLJA 4LBKA 4BM8A 1W6MA 2WS93 1N1TA 4Y24A 1C3HA 4XHBA 1UL9A 3M4FA 5D1IA 4OI2A 2DCZA 3VKLA 4EWAA 2JG8A 1ASJ2 5C9AB 2VQ0A 2ZGSA 3D6EA 3AXDA 2EALA 1F5FA 1DYKA 4EWEA 1IS6A 2E6VA 5E16A 2BNOA 4MLOA 1HW5A 4LTAA 1AXYA 3ZFGA 1UMZA 3IDCB 5SV5A 4NWVA 1GLHA 2R1BA 4AEKA 1GQHA 3NV1A 3TRSB 1J3PA 1LRHA 1RUG3 2WC2A 2Z5WA 4B7EA 3V65A 1ZA4A 4TLFA 4YW5A 4ES9A 2D3SA 2ZMLA 4RQPC 3WNXA 4AHXA 3WDYA 2O0OA 3EQEA 2P17A 1AXZA 3R4UA 4JVAA 4XJZA 4E4ZA 2ZX1A 3DPRC 3FFZA 5KHJA 5L36A 4JV4A 2EAKA 1IOAA 3A0NA 3BIWE 1X7NA 1IPJA 3ZMNA 3MF6A 5IK7A 4BMEA 1TME1 2WNVB 1WCKA 1MQTC 1QNYA 4GULA 1EYBA 1QQP2 2Y26A 4PDWC 4F3JA 4K8FA 2P37A 4JDNA 1AR92 3ILNA 1CONA 3ZSJA 3ZDSA 3B00A 5IK4A 3V0AB 2WINB 1LECA 3TAYA 2HWF1 1W6QA 2PELA 3HAGA 5CU1A 2VW2A 3USSA 2XWBB 4O9EA 1O3TA 4IV3A 2B45X 2CYFA 3VN4A 3NJZA 3RI9A 4AXOA 1GSLA 1LHWA 4N90A 1Z0HA 2AREA 3FBYA 2R32A 2XJQA 1LJ7A 4Q8LA 3JZVA 2BNMA 2CGNA 1LENA 1D4VB 1E57A 1AHSA 4HT1T 1RB8G 1BCXA 1SLTA 1H1AA 1Y9QA 5FLIA 2JG8B 2AZ5A 3HT2A 4Z92B 1KS4A 5D8AC 1DDLA 1AX0A 5ACA3 3WV6A 3AYEA 1Q8OA 1ZBA2 5BNNC 2AGSA 1PVC3 3M3OA 2Z69A 3AMNA 5E89A 4OLLA 2LTNA 4Q4V2 5BXXA 3DUIA 2XJVA 4HANA 2PYTA 4N7UA 3SCGA 4B4PA 2W08A 4RGGA 2GNTA 1SBFA 4K6BA 1WLDA 1ZZCA 2Z2SB 1ENSA 2HEVF 4YGEA 4Y1VA 4LHKA 3C2UA 3VHNA 1JYCA 4XZPA 1FMD1 1AYN1 2QZ2A 1CN1A 2PHWA 2D7FA 1WW4A 4A2UA 4AI0A 4EN7B 1S55A 3N7JA 5EZWA 3WCSA 3WP4A 2HWD2 2ZMKA 1NCQA 1QH7A 4XW3A 4D3WA 1SBDA 1RITA 4SBVA 1M06G 1KD7A 2RMU2 3OYWA 1LHNA 2Y38A 4XQWA 5ABJC 4KWKA 5CFDC 3MFCA 4PJYA 3QLQA 3V0BB 3POSA 5BNOA 2GMEA 4TSVA 1RUJ3 4DNYA 1GQGA 5I0SA 1KITA 3VBRA 4NN0A 1N3QA 2RR13 4IV3B 3OGJA 1V9U1 4IEZA 1CIWA 1D2QA 2R6QA 1FOD3 3EO6A 2BPA2 4IEQA 1O4TA 1JTZX 1ZBE1 4P9JA 2PLV3 1RUE2 4LO4B 4GWNA 3JU9A 5CB7A 1C8M2 5DXDA 4AHZA 4HZFA 1MR5A 2JE7A 2DVBA 3O5SA 3TB0A 3LCPA 2ZS6B 3R05A 4C1WA 2DTWA 1MS4A 3AP9A 1RUF2 5GLTA 3KS7A 2XBO2 1I5ZA 3D8CA 1SEFA 1XE7A 1UX6A 4NVPA 4FTSA 3I54A 1RUD3 2MEV3 4FQZA 1PZ7A 4HKOA 3ACLA 4DXZA 4AFCA 2Q0AA 5BNPC 1U0AA 1UCXA 4Q4Y3 1T6GC 4AQ2A 3NV2A 4QX5A 5GM0A 1DU3D 1TE1B 5FMOS 3R4SA 4AGGA 1WCSA 2C0ZA 5C8WA 1L3JA 2ZX4A 2FHRA 2WZR3 3KGLA 2R061 1NCQB 4LLOA 1WD3A 4XMIA 2DCYA 2HWB1 4JTOA 3WUDA 1YHFA 3JBG3 4YM0A 1RUC2 3VKMA 2ZGMA 2O8QA 5C6CA 3OYWB 3ZO0B 1FX5A 4XTMA 1POV0 3USUB 4ASMB 2I2SA 1NZCA 3LB9A 4YZ2A 2JXAA 3GHMA 2BW8A 2ZAAA 2QQPA 4GMP1 2R49A 3J26N 3NWKA 5IK5A 1XQNA 3UL2A 5F1RA 1V00A 2H0BA 2WWSA 3MYXA 4Q4W2 3VBRB 1VRH2 1RUH1 4FCAA