2A5ZA

Crystal structure of protein of unknown function so2946 from shewanella oneidensis mr-1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
239
structure length
239
Chain Sequence
TTPGLMSPSEKLKLSTLTTSIATSDFYASYDFMMHSIGLTSANNISLLSTGNISLQNILSEGNHFGVQPIVSSTTANASFLAGMLMAIFPKESELEVTVYFKTPSAFNPAQLTVIGSTSIGLGISDRSGLIIENGNAFGGIVKASAATETGSTYALSTSTWYICKFKMLTDDRFKVTLYSDSGTQLYSYTSTAAMFRADNATAHIGFKTQCKTATAGISLISIDLIEFKAKVSATRAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SO2946
publication title Structure of SO2946 orphan from Shewanella oneidensis shows "jelly-roll" fold with carbohydrate-binding module.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 54
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2a5zA00
1LCLA 1TEIA 1JW6A 1Q8VA 1UL9A 2YZ4A 5HCBA 2ZABA 2A6WA 2R16A 1LU2A 4DRVA 3N7KA 2ERFA 1JXNA 2PHXA 5H9PA 3RMYA 2JE7A 3U4XA 1YO8A 4AGGA 3O5SA 1MS0A 1ULCA 2AH2A 2YY1A 2VH9A 4ZXKA 3SNMA 2ZA9A 1DGLA 4YM2A 1C1LA 4NO4A 1GYKA 4XDQA 4YZ2A 1I1EA 1AX0A 3SH5A 4FP3A 1WUVA 3T1LA 2AENA 3WCSA 5GZGA 1GZCA 3FLRA 1GKBA 1H30A 4FPCA 4XJUA 3V64A 3BTAA 5GZEA 3M3CA 1MS1A 1VAVA 4K20A 4WV8A 4ATEA 1PZ9A 1DQ0A 2R49A 1GNHA 3SH4A 2ZHMA 2DVGA 4Y24A 4FQZA 2JDZA 5F5QA 5JMCA 3HMYA 4LBJA 5EYXA 3VKOA 1QDCA 2UWBA 3WCRA 1C57A 3N7JA 2DWRA 4UW6A 4AVVA 3IMNA 4FVVA 4FOYA 3AZWA 1NLSA 2D6OX 2GDFA 1Q8PA 3RRDA 5DG2A 2VW2A 3INAA 4R9DA 2E53A 5T5OA 2JKBA 2OW4A 3UK9A 1KDMA 2ZGTA 2JECA 1V6IA 1SLLA 2ZGPA 1W6OB 1WW5A 5T50A 2TEPA 4Y22A 4XIKA 4W65A 1LOBA 3V0BB 2D43A 5GLUA 1QF3A 1QOOA 3AXDA 2EXKA 1J1TA 2ZKNA 4M3CF 5T5LA 4JC1A 2ARXA 1DBNA 3PMEA 3V0AA 2BQPA 1F9KA 1BQPA 2ZGQA 4FPHA 4AVTA 1KDKA 3AJZA 3WDXA 1N1YA 1W6NA 2A75A 1LOFA 3NWKA 4DQAA 2ZAAA 3BIWE 3OGGA 4YGEA 1BYHA 3IN9A 2ZHNA 4P9YA 5FRAA 2A3WA 3UJOA 1MS4A 2YROA 4GXLA 1EPWA 1RITA 3ZXFA 3VKFC 2ZGKA 2DVBA 3R4SA 2CTVA 4YW2A 5GLTA 2NN8A 2G4IA 3IM0A 4C1WA 1D0HA 5H9SA 1WLWA 2DUOA 3VV1A 1SCRA 2A6ZA 4H55A 4CTEA 1CJPA 1DQ2A 1YXWA 4C1XA 2RHPA 3WNXA 3GNEA 1SLAA 3OBRA 4PBOA 1OFSA 1SBDA 3FUQA 4L8QA 5HCAA 1HQWA 1F5FA 1H9WA 1W6QA 4UW3A 4D69A 2AUYA 4FPOB 2OUJA 4XIOA 3USUA 5GZFA 2EAKA 3AYAA 4BQ1A 4LBLA 1H9PA 1OKQA 5BYNA 1N1VA 3ILNA 2P3KA 2UWCA 4AYUA 1OQ1A 1N47A 5E89A 5JVVA 2YXSA 4Y1ZA 4Q1PA 1Q8QA 1QOTA 3FFZA 2ZZJA 3ATGA 1LOGA 1Q56A 4RA0A 4FPYA 1LOFC 1LOEA 1KJRA 4FPJA 2XB6C 2OUHA 1WW7A 2VY0A 1W6PB 4XXPA 1NXD1 4ISRA 1N3QA 4YGBA 1S0GA 3D6EA 1ULFA 3A0KA 1FX5A 1MS8A 1WLCA 2DTWA 1AXKA 1S0JA 2EF6A 2ZGSA 5SV8A 4XJ8A 1C4RA 5JOZA 3MPPG 5GM0A 4Q1RA 3ZPYA 2LALA 2A6VA 3FUOA 3VKLA 4RL7A 3O12A 2I2SA 4OZXA 1JOJA 2ZACA 4LBNA 3ZXLA 1DIWA 1SFYA 2DU1A 2ZHKA 3B3QE 4WVWA 2D44A 4XBNA 1B09A 2PELA 1Q8SA 4YG0A 1GNZA 1GZWB 1GLHA 1LGBA 1IKPA 2D6NA 4AGVA 1VALA 5IUQA 1LGCA 1JYIA 4LBQA 2UU8A 4XMIA 4LBQD 2NZ9A 2GN3A 1O4YA 1KITA 1FV3A 1YYNA 3AP7A 2DU0A 5T55A 3WOGA 3ZVXA 1C1FA 1RIRA 3PVNA 2GNMA 2Z42A 3T2TA 2UWAA 3ASIA 3AK0A 4Z8BA 2DVFA 1JUIA 5JDBA 5CAZA 1G9DA 3WG2A 4XBQA 5KXBA 5E8AA 3RSJA 4YZ4A 1A78A 3TAYA 2C5DA 1N3OA 2GMEA 3A4UA 4Q2FA 1FATA 1KJLA 4M00A 3B00A 4XYXA 1CQ9A 2Q5TA 5DZFA 3ZSKA 1QMJA 1QU0A 3WG3A 1BZWA 2A7AA 4GKXA 1ZM1A 1SLIA 1UPSA 1S0FA 4PCRA 4U36A 1SLTA 4SLIA 3QCWA 1XQNA 2D3RA 3R05A 1WCSA 3OYWB 4R9AA 4YZ5A 2R0FA 4YM3A 2A6XA 1CPNA 5L73A 1QKQA 5DUWA 2EXHA 3WDTA 5DUUA 2DYCA 4FPEA 3I4IA 2ZMKA 1DYKA 1FAYA 1LOCA 3AP6A 4Y1UA 1WBLA 1ULGA 4FOWA 1HDKA 3AYCA 1DLLA 3B69A 3OY8B 4Y20A 3POSA 2AYHA 3BOPA 1PZ7A 4XXAA 4ASMB 2JE9A 2WNEA 5CA6A 5IK5A 1URXA 1MS5A 2D7FA 2JD4A 3SLIA 3PVOA 4LBOA 2E6VA 3HR9A 5GLZA 4BMBA 2YV8A 3AXEA 3M2MA 1LU1A 1LJ7A 4YGCA 5CB7A 3AFKA 3I8TA 4P14A 3FLPA 4BPZA 3V0AB 2V5YA 2WJSA 1AVBA 4M3CB 4TYSA 3AX4A 2NMOA 1G9CA 1A8DA 1IKQA 1VIWB 3MW2A 1IS3A 3L2YA 1D2SA 2VU9A 1DFQA 5DG1A 1G7YA 2GNBA 1LHWA 1MACA 1V6OA 4R9BA 4BLIA 4YFZA 5F9TA 1UX6A 4GWNA 1PZ8A 4M3CE 1ENRA 3VKMA 1Z0HA 2DTYA 5EYYA 2E7TA 1CONA 5T5PA 4AGRA 4YW5A 4Y1YA 4GALA 4BM8A 3CNAA 1MR5A 1S0BA 2HYKA 5KXDA 4K21A 1G9AA 2WT1A 2W08A 3ILRA 2W68A 3B01A 4HL0A 3WUCA 1FYUA 1DQ4A 1SBFA 2PHUA 3QLQA 3USUB 3TB0A 2ARBA 3D4KA 1YIFA 2KM2A 3MW4A 2DUPA 1AX2A 4XILA 2FMDA 1V6KA 4DRRA 1BKZA 4Q8KA 1CVNA 2AREA 3W59A 3AYEA 1V6JA 2ZGMA 1DHKB 3N3HA 3DGTA 3RG0A 2SLIA 1IOAA 1JHNA 5GLWA 1GSLA 4DFSA 3AJYA 4NOTA 4FQ4A 1QNYA 1CR7A 3OPZA 3AZVA 1AJOA 1RINA 3O0WA 1CN1A 3AP9A 2R1BA 3LSEA 3SISA 3WLUA 3RS6A 1W6MA 1GZ9A 1QOSA 4Y26A 3IPVB 3RQ0A 2OVUA 1CPMA 2WSVA 5GJ6A 4UW5A 1APNA 4K1YA 5GLVA 2UURA 3KQRA 1UMZA 4FPGA 1KRIA 1G8WA 1WLDA 1LGNA 3VUOA 3AZXA 3O0VA 4FPKA 1X50A 4JRAA 4CRQA 3A0NA 5IK4A 2P34A 2NP0A 2E51A 3ZSJA 1N1SA 5GALA 4YFWA 3WVJA 1LHOA 5H9QA 3Q9OA 3WDVA 1FV2A 2WQZC 1IS5A 3ZXJA 3AP5A 2ZGUA 1SCSA 2LTNA 3NV3A 1HLCA 1LODA 3MW3A 5FREA 3ZYPA 1WD3A 2D3SA 3ZYRA 1LECA 2R0HA 3JUUA 5JLVA 3AYDA 3WHUA 4TZDA 2EXIA 2CL2A 1G9BA 1FNZA 5EXOA 3M3OA 4YZ1A 3JU9A 1LEDA 1W6PA 3LSDA 3VKNA 4XMAA 5KXEA 3N7LA 5DZGA 5IT6A 3ZSLA 3NV2A 3AZZA 1A3KA 1DQ6A 4MYEA 2ZGOA 4ZKTB 2E7QA 5IK8A 2PHRA 1SLCA 1LTEA 1GANA 1MS3A 1LULA 5JOWA 4FOQA 2GMMA 4BOWA 1CESA 3MEPA 4K1ZA 2D3PA 2NYYA 3GALA 5DUXA 1V6NA 2AGSA 3M3QA 5IK7A 4FP2A 2P3JA 4FPFA 1GZWA 2YMZA 3SH3A 2D6LX 2CWMA 4R9CA 1YRZA 2PHFA 1QGLA 4UW4A 1AXZA 4XBLA 1N3PA 2A3YA 1BJQA 1V00A 4XZPA 1GBGA 4XJ9A 1UAIA 3UJQA 5KXCA 2FHRA 1WBFA 2ES3A 2P2KA 3KM5A 5DUVA 3WHTA 4BLJA 1AJKA 4YGDA 1VAMA 4XJWA 1S1AA 3WDWA 1G86A 2DV9A 4Y1XA 2R1DA 1S0EA 1GICA 3H0OA 2WSUA 4Y20B 1ENQA 1DQ1A 1SBEA 1LHUA 4WZFA 1HQLA 2D6KA 4JCKA 3POYA 4FPLA 4Q26A 3WZ1A 2EXJA 4XJZA 2EALA 1JBCA 1N1TA 4CZSA 2A5ZA 3UL2A 3WDUA 1MZ6A 3APBA 3M1HA 4Y22B 5H9RA 1ZA4A 2GNTA 3M3EA 1LESA 3FLTA 1W0OA 4F83A 2H0BA 1LOAA 2C9AA 4WVVA 5EWSA 4U2AA 5LK5A 3C2UA 2A3XA 2V73A 4HANA 3LCPA 4PQ9A 1Q8OA 3OJBA 4DPNA 3PVEA 3OYWA 4FOVA 1S0DA 2A71A 4PBPA 4XE9A 1W6NB 3B9CA 1BXHA 4YG3A 3SITA 4BMEA 1KQRA 4AVSA 4I30A 2D6MA 4XOGA 4YW1A 2AR6A 1UN1A 2NM1A 1WD4A 2A6YA 2D6PA 3OY8A 1AZDA 1S0CA 1I3HA 1FNYA 1IS4A 3W58A 4ATFA 1UKGA 5DXDA 2GN7A 1SLBA 3WG4A 4DS0A 1W6OA 1AF9A 2ENRA 4GKYA 5JOYA 1WW6A 3V0BA 3OBTA 3HN1A 1V6LA 3PJQA 4YG6A 2DVAA 4M3CA 2CWSA 1MVQA 2ZHLA 1W6QB 2EIGA 4ISQA 4YW4A 1LEMA 1AXYA 2CYFA 1QNWA 1HKDA 3WUDA 1JYCA 2DURA 3N7MA 2JJ6A 2P3IA 3ILFA 1Y7BA 2W39A 1G9FA 3ENRA 4KBBA 3WG1A 5GZDA 5T52A 2ZGRA 2GMPA 5CNAA 1DQ5A 1W0PA 1V6MA 1R1ZA 5CBLA 1UZYA 1W6MB 4YZ3A 4PF5A 2P37A 1MZ5A 4P9WA 4IQPA 4LBMA 1VLNA 2ZBJA 4YM1A 2VW0A 1YI7A 4XHXA 3ZSMA 1IS6A 1UZZA 5HCFA 3ZXKA 5T5JA 1LENA 1JN2P 3NV4A 3WV6A 4XHBA 5GZCA 5JOXA 2WT2A 1ULEA 1WW4A 2VW1A 3AP4A 2WKKA 2WLQA 2ZGNA 1MS9A 1LHNA 2WT0A 4LBKA 1CIWA 4XTPA 3ZXEA 3WDYA 4YLZA 4AWDA 1U0AA 1MVEA 4YW3A 1DZQA 4Q27A 5AVAA 5T54A 2VXRA 2NMNA 3O0XA 2A70A 1SACA 4Y1VA 3FBYA 1AX1A 1S0IA 4XJAA 3BODA 2ZGLA 1GV9A 4LBQB 2DVDA 4M01A 2ZMLA 3IKWA 1QDOA 3IPVA 1LHVA 4GA9A 2B7YA 2PHTA 4XTMA 1O4ZA 4YM0A 4Q8LA 4GWMA 2CY6A 4ITCA 1F31A 1ONAA 1ULDA 3RMXA 2SBAA 2GNDA 1Z78A 1ENSA 3N36A 3T1MA 3NV1A 2GALA 2W52A 2VUAA 3DUIA 3V65A 1DYPA 2XG3A 2DUQA 3N35A 4P9XA 3R4UA 3D5OA 2ZMNA 3POWA 2PHWA 5DZEA 3AZYA 5E88A 2CNAA
chains in the Genus database with same CATH superfamily
1LCLA 2P6CA 5LA2A 5HXMA 1U5ZA 1UL9A 2Y6LA 2VVEA 1TMF2 4CYDA 4RQPB 1LU2A 2IC1A 2QZ2A 2ERFA 2YDEA 5ACA3 3RMYA 2JE7A 3U4XA 1QJZA 3GZEA 5CFCA 5KR7A 1F4HA 1XOYA 1MS0A 3N9OA 5K4LA 2YBKA 1HV1A 1DGWA 2BP6A 3DN7A 4KWUA 3OG2A 5HCHA 2VMFA 5DABA 1TME2 1GYKA 4YZ2A 1YHFA 2HBUA 1I1EA 3AMPA 3VBOA 4MGQA 1WUVA 3WNLA 5GZGA 2VMEA 3FLRA 2P6HA 1NCQC 1ZBA1 5KHGA 1AYM1 1EV12 1U5XA 2BRTA 2X5IA 3N9MA 2WLPA 4JGZC 5DDJ1 1PVC2 1V9U2 1X33A 1OMIA 3I54A 2R49A 4PLMA 4CCKA 4LUMA 1NT0A 2HBTA 1NUKA 4MGIE 1W9WA 2C1FA 5KHHA 4KGQA 1Q5OA 3R6SA 2JDZA 1UF2C 3BIEA 2O14A 5F5QA 2Q8DA 2IFRA 3T0DA 3E5QA 3GDBA 4LBJA 3ZN6A 1PK6A 1O3RA 1PGL2 1QDCA 2UWBA 3UGHA 2YC4A 3DXUA 2YC2A 2JDNA 5C8CA 1ASJ2 1KD7A 1HB1A 1ODNA 2Z69A 3AZWA 2WN3A 1WWYA 2VW2A 4Q4V2 1OVSA 1PMHX 2JKBA 4QPYA 2ZGTA 4RGAA 2JECA 1C8M3 4Q0QA 1W6OB 3RDIA 2QTWB 1QJX2 1WMEA 4K6BA 4LA2A 4XIKA 3VDCA 4EN8B 4Z92B 5GLUA 3MLJA 1RMU1 1QOOA 3DPRB 5A3TA 2O0OA 2BERA 2ZKNA 1RHI3 5E16A 1WKYA 5L7OC 2BQPA 1BQPA 1BLZA 3JBG1 2XLGA 4FPHA 3VZLA 4AVTA 2ARAA 2VMIA 3AJZA 3WDXA 1LOFA 4DQAA 2G19A 2D5FA 2W1WA 5BXXA 4FO9A 1XYNA 3OGSA 1ZZCA 4CCOA 1E5RA 2OQ7A 1Z7S1 3EXUA 1ND3B 2PTMA 2V72A 2ADDA 1D0HA 4QQOA 3VBRC 1WA6X 4MGKE 5C9AA 4AEDB 2DUOA 3CF6E 4D94A 1YXWA 1QQP2 3E1F1 2RHPA 5BUVA 1K42A 4HK8A 4BWOA 1O3TA 1SLAA 1OFSA 3VD9A 1ZZ6A 1IQDC 5HCAA 4HVOA 1W6QA 1H9WA 1MEC3 1WMFA 4UW3A 4EWDA 1R081 5CEHA 4BQYA 2OUJA 4AE2A 2ORZA 2UY9A 3H9AA 2VULA 1FPN3 3WEZA 5FY7A 2HEWF 3ECQA 4AFAA 5AC93 5D21A 5C7GA 1H9PA 2W47A 1NA1A 4I02A 5BYNA 3FHQA 2P3KA 1N47A 5FTTC 5E89A 2RS51 5JVVA 3FZ3A 2BEOA 2YXSA 2QQWA 1QOTA 3ATGA 3AL6A 3J7NA 3JXSA 2G9ZA 2LROA 1A8MA 4OLLA 5IAVA 2E9QA 4ZXEA 1HRV3 1KJRA 4DEQA 5A6ZA 1NCQB 2XB6C 2OUHA 2VY0A 2XHNA 1W6PB 4JGZB 2W92A 4YGBA 1N3QA 1S0GA 2HWE2 1V70A 4Y5SA 5TSWA 4JHTA 1BEV3 1MS8A 1IZ3A 1GUIA 1ZRCA 1S0JA 2FZ1A 3MPPG 1UY2A 2QQLA 4Q1RA 4J1WA 5GM0A 4ZZ5A 4O9EA 1CX1A 5ANQA 4D6SA 3I2HA 4CCDA 2GZWA 4JDOA 4F3JA 1XU2A 2ZACA 4LBNA 1DIWA 2ZHKA 4CVUA 4HBNA 3B3QE 2D44A 2W3JA 2ZX0A 1B09A 4XBNA 1Q8SA 1GLHA 2VO5A 1LGBA 1W8NA 2D6NA 4WM8A 4YPJA 3UKTA 4ARXA 4P9IA 5IUQA 2ZCWA 2X10A 1JYIA 1PIV1 1RVF1 2W1UA 3ZO0B 3M70A 1W2TA 4AAPA 3MYXA 3MICA 4E8DA 4LBQD 2R043 4HN0A 1KITA 1YYNA 3ZKUA 3K2OA 5L19A 1H8TC 1ZRIA 2WO3A 4GMP3 3A23A 1VBB1 2K0GA 3OSDA 2Z42A 2VNOA 4IEUA 1H0BA 4Z8BA 5JDBA 2DVFA 1DDLA 2HWB1 2V09A 3OD0A 3ZIXA 4XBQA 5LASA 1XSRA 5E8AA 5KXBA 3E97A 2W94A 3I2JA 5FMBA 3FL7A 4EN0A 4LXLA 4BQ4A 2Y6HA 1HV0A 5L7OB 1J3QA 3H8XA 2OQ6A 4XUQA 1VB2A 3B00A 5KHJA 4UFKA 4JQTA 2BFUL 3WP6A 1U12A 3MV11 2BOIA 2XVKA 1BZWA 2A7AA 4QMAA 3MIEA 2ZAHA 2IXLA 1SLIA 1REEA 5GKAC 2CU5A 4B7KA 5A1FA 4UF0A 1CX4A 2QQNA 4BYYA 1SLTA 4SLIA 1OUSA 1ZVFA 1YQCA 4UBGA 3TRSB 1HW5A 2D3RA 2F6BA 3OYWB 1CJDA 4R9AA 4YZ5A 4YM3A 3VBRB 4CXYA 4XAEA 3WW4A 5DUWA 4MXWB 4XUPA 3WDTA 3O1UA 2DYCA 3MIHA 5FZ0A 2BWCA 1CAUB 3CQOA 4CP1A 4UI9L 4H7MA 3O1SA 1AR73 4D6RA 1VBA3 5CFCC 4YVSA 5HBAA 1HDKA 3Q8CA 1DLLA 2QCSB 4Y20A 1H1MA 3BOPA 1PZ7A 4OUMA 5IK5A 1RXFA 4FXGB 1ST8A 2D98A 3SLIA 4LBOA 5DN2A 4QGLA 1RUH1 5GLZA 1WA4A 1ZBA2 1AYM2 3AXEA 4BQ5A 3W5MA 2CHHA 2VNGA 3VBOC 2Q8CA 4IXLA 2YUEA 3QD6A 4UXAA 3TNQA 1AVBA 1UOBA 2QBXA 4CP0A 2Y60A 3AX4A 3D3AA 5DAVA 5JIAA 1IKQA 3MW2A 1NLRA 3UGGA 1OLRA 1RUG3 3DYMA 3VBHA 4CSWA 5A3MA 5DG1A 1G7YA 2XBO3 2DCYA 4BLIA 3WP4A 3GCWA 1UX6A 3H3UA 1PZ8A 4GWNA 4BQXA 5C3QA 3DL3A 1ACCA 4QT6A 3ZSEA 5FZOA 5J48A 1Z0HA 3KCCA 1PK6C 2ZTNA 4AGRA 4I0WB 4YW5A 1J59A 4IETA 2E7AA 3OUHA 4NIGA 4XF9A 1JZ4A 3ILRA 1OD3A 1F2NA 2W68A 4Q4W1 3T08A 3BU7A 2ET1A 3M3IA 1FYUA 1W9YA 2PHUA 1TNFA 2FQPA 3J9SA 1D7PM 2ARBA 5FBZA 1NCRA 1RMU2 2HWC1 2WS91 1UU5A 4XILA 5FZAA 2DUPA 1AX2A 5FLJA 3DCQA 2FMDA 1V6KA 5CG9A 1BKZA 4K7JA 2HKXA 4R8HA 2AREA 4QX0A 4WM7A 3JBG2 3QOPA 1V6JA 2JG8C 1DHKB 1H8TB 3DGTA 3N3HA 5J37A 3NJXA 2PYTA 1LRHA 1UOJA 1TME3 2W9XA 5JMOA 1QNYA 2B39A 5LRRA 1ALYA 4KQ7A 3CLPA 1AJOA 1RINA 4IGQA 3RZLA 2DBNA 1QOSA 4XZUG 2G9GA 3IPVB 4AFDA 1Z7S2 2H6CA 4UW5A 1APNA 1RUE1 5GLVA 5CISA 2UURA 5L36A 2D40A 1KEXA 3PUSA 4FPGA 4LHSA 1KRIA 1UPIA 1PVC3 3QBQA 1WLDA 1LGNA 2Y33A 3O0VA 4YNIA 4KH9A 3AKPA 2P34A 1OURA 1BBT3 4PIZA 1OH3A 5C9AC 3FMGA 1UQXA 3Q9OA 4Q4X2 1FV2A 1R082 1IS5A 1EUTA 3MIFA 3AP5A 4RGGA 5FY5A 3ZXJA 5KC6A 1VPHA 3K4AA 1XC6A 1XNCA 4FT8A 3ZYRA 1LECA 3JUUA 3DF0A 1ASJ3 1DGWX 4CDXA 2BW8A 2YFUA 4YYOA 5CFCB 4LLFA 2I45A 3M3OA 4YZ1A 1F35A 1NA1C 1XE8A 2V4AA 2BVVA 1ZZBA 5FYUA 1HN0A 2RR12 3NV2A 1A3KA 1UZ0A 3ZSLA 1QJX3 5I8YA 2E7QA 3VBOB 1SLCA 1UU4A 3GCXA 3KZ4C 1LB2A 1UY3A 1QXPA 2GMMA 3LEGA 3WSOA 3RYRA 4BOWA 1FPN1 2NYYA 1XNAA 2R32A 4JRLA 3IAPA 3WP5A 1WMXA 4COZA 3RZKA 2HEYF 2P3JA 1CWPA 2YMZA 4MX3A 4NR1A 3SH3A 4YVWA 3O7OA 2D6LX 3MFCA 2CWMA 2GC3A 2PLV2 4N9HA 5LK7B 1XE0A 2RE9A 1DZTA 5FZ8A 3VD5A 4RQPA 1N3PA 4E2QA 3I7DA 3M7AA 4LTAA 5FMCA 4Z2AA 3HJRA 4ET7A 2BBVA 4XJ9A 3ZN6B 1PK6B 3GYDA 1WBFA 2ES3A 1PIV2 2P2KA 5DUVA 3LZZA 3WDWA 4AI8A 1S2KA 4Z2WA 1NKGA 2DV9A 4A3ZA 2R1DA 3UGFA 1GICA 3H0OA 2WSUA 4HLTA 3RI8A 4JV4A 2R061 1SBEA 1VBB2 3KD4A 1ZRRA 4Q0PA 4CEYA 2D6KA 1C28A 4FPLA 4Q26A 1R091 4B29A 4EJRA 2HWB2 2ET7A 4JTOA 2EALA 4XJZA 3MF9A 3PLQA 1POV0 4I3PA 1RUI1 4G9SB 1IHMA 2A5ZA 2B9VA 4E4SA 4HK9A 2IZWA 2J1RA 5LBFA 5H9RA 3M3EA 2EIDA 2JG8B 2H0BA 2N7GA 2C9AA 3BN6A 5A7PA 5EWSA 3LIGA 1L3JA 4U2AA 3VBFA 2A3XA 2OZJA 1YLLA 1CZTA 4Y4YA 2B8MA 3CJIC 4PQ9A 3H1MA 4R52A 5FXXA 4MGTA 1OVPA 3EMRA 4NMIA 5FZEA 4AI1A 5J09A 1S0DA 4OHVA 1J58A 3VHOA 2EVXA 1JH5A 4FFHA 4MHRA 3NAPA 4RD7A 4I30A 4YW1A 4LHNA 2J1AA 4AI2A 2BU9A 3UT0A 4QDRA 1W2UA 1VMJA 1NOVA 1FNYA 1K45A 4ATFA 5DXDA 3VD7A 2GN7A 3HN3A 4DS0A 1W6OA 1PX3A 1CAXA 2RJ2A 5D8AA 2ENRA 5A7NA 4X8NA 5AFBA 4GKYA 5IVEA 1H4HA 4HSJA 4BH9A 4YVSC 3DPRA 4GAZA 2CWSA 4ASLA 3UNPA 1W6QB 4DEVA 4RGKA 2CYFA 1JYVA 1WCUA 3IZOA 3WUDA 3OB8A 1JYCA 2Y64A 3N7MA 4QKFA 3N4MA 5A1AA 1NA1B 2JKXA 3PUQA 1VBC3 3I2DA 3ACFA 4E4ZA 3RZHA 5IATA 5CNAA 1DQ5A 1W0PA 1O6UA 1V6MA 4XETA 4HVQA 2XL7A 5IYYA 2C0ZA 1W6MB 4PF5A 1ND3A 3VBHC 1XNDA 1D0GA 5K9YA 2E63A 2ZBJA 3QH6A 4QPGA 1PO21 1XE7A 1YFWA 3Q8FA 1GMMA 3LA7A 2VNVA 3NV4A 3WX5A 2ZKLA 2X05A 3AFGA 5B4NA 1WW4A 3MIBA 3FJSA 1UD1A 2ZGNA 4CCEA 3HWJA 1X8MA 4Q4W2 1VB4A 4QXBA 4XW3A 4XTPA 3SEPA 5FP4A 2VM9A 3AKQA 3ZXAC 4DNYA 4LMFA 3KB5A 3WDYA 3SEEA 4E2SA 2FZ2A 5FFOC 2Z5WA 4XEZA 4DUWA 2HWC2 1E5SA 5SV5A 4XF4A 2WUHA 1RUD1 3HNMA 1OLME 5AVAA 5FUPA 5T54A 4E4DX 4CU6A 3HQXA 1AR91 3HBKA 5F2SA 2B5HA 2RV9A 5FP7A 5FZ9A 1YCIA 1RUC2 3BOWA 1VRH3 4UYBA 4CA9A 4WZCA 1NCRC 1GV9A 2DVDA 2ZMLA 3J8F2 2YYOA 4FFIA 1EY2A 3POGA 2I07B 1LHVA 4WM7C 3SKVA 3NQHA 4IEZA 3B94A 4PQQA 4QPIA 5IVCA 2BNOA 4NAMA 4AR2A 4E4HA 3ETQA 5BNNA 3IDCB 5J98B 3T2PA 3N36A 1RUE2 4OMDA 2VUAA 3ES1A 3K3NA 4HKWA 1DYPA 2XPJA 1NAEA 2DUQA 1Y9MA 3R4UA 3CJIB 4BCUA 4P02B 2XHKA 1K5MA 4PLNA 5A7WA 1R1A1 5A7SA 1GFF2 3ZOIA 2FDFA 3LPFA 4BQWA 4LOTA 1W3VA 1XNKA 2ZABA 4AI3A 2A6WA 1M06G 4DRVA 2CGOA 4RYDA 2R6QA 1ZRDA 3LOBA 4UF0B 3R0RA 5FP9A 2J1VA 2VGDA 2VH9A 4ZXKA 4JQRA 2XLFA 5EJ1B 4LLOA 3SNMA 5F3CA 4QDSA 3J4UH 3U14A 1U5IA 1XRUA 3K3OA 4QB1A 3AM2A 3KV5A 3WR0A 4NO4A 4XDQA 2RMU3 2DCKA 3SH5A 1W2OA 2QDNA 3PVBB 4YVSB 1MZFA 2AENA 3WCSA 5A3WA 1GZCA 1POV1 2Z2SB 1OH4A 2XQXA 2XDVA 4XJUA 4MHUA 2E32A 3B02A 2VOVA 3GXUA 2R30A 5CZKA 3M3CA 5F6KA 5LRSA 1VAVA 3ZXDA 2ZHMA 4C90A 2CDOA 5FZ6A 3KV9A 1KFXL 1NX9A 4FQZA 3AL5A 1NY71 3CHXA 5JMCA 2WO7A 3HMYA 1SDWA 1NZCA 4PT6A 3VBHB 2VOWA 3DECA 3JD71 2DWRA 4QDQA 3T3YA 3IMNA 4YVWC 2W2IA 2XQRA 3U07A 3VGIA 3BCWA 5CG8A 1US3A 2VCBA 4Q0UA 4F7ZA 4FOYA 2RS13 1NLSA 2D6OX 2GDFA 1AHSA 1RB8G 5DG2A 2FDJA 4NJ4A 3CZJA 1EAH2 4QQLA 4W4ZA 5FZOB 3VHRA 5T5OA 3UK9A 4S2DA 1KDMA 3E6CC 4JVAA 1SLLA 1FT9A 1DF0A 2R062 5JR7B 3RWKX 1WW5A 1R092 2WFF3 4W65A 2Y6FA 3OPWA 1LOBA 2OXBA 1QWRA 1HXS3 2C26A 4Q4X3 4UFJA 1RUI2 1QF3A 2IXKA 5ANNA 1RUOA 2VZ1A 5T5LA 2WBKA 4PJYA 1PO11 4JC1A 2ARXA 4CEYC 1DBNA 5A3LA 4UBHA 2P3YA 4A2UA 4DXZA 5LW9A 5FZ4A 1N1YA 4GH4A 2WQ8A 3KCXA 2X29A 4YGEA 2C4XA 3IN9A 4WM7B 1NLQA 5FRAA 5FY8A 3USSA 4B1LA 3UJOA 3IB3A 4F8AA 1FXZA 1K3IA 3KWVA 3VBFC 1EPWA 1C5IA 3RNSA 2RDNA 3ZXFA 4C0HA 1PGW1 4FSJA 2JDPA 2CTVA 2BBAA 5GLTA 4N90A 2XGXA 3FHIB 1OHFA 2B46X 4XF3A 2JDKA 1AR83 3LE0A 4X6RB 2YC0A 4OHZA 3NAPC 4BE3A 4ORFA 4LIVA 5G05L 4HOOA 3ZYBA 4AVBA 1SBDA 4ZZ8A 1HQWA 3GHMA 2PLV3 4D69A 3O1MA 1W2NA 4XIOA 5GZFA 2VD7A 1XPWA 3AYAA 5FYSA 3S30A 2FDKA 4LBLA 4RHV3 1RTVA 1PVXA 5D8AC 3DKQA 2UWCA 4AYUA 1OQ1A 2Q1FA 4CDWC 1YQ6A 1VBE1 2BOJA 3EHKA 4ZU7A 5BNOA 4FBFA 4WVZA 2XJTA 1PMIA 4RA0A 2WL1A 3T2OA 4LORA 1M4WA 3ZFGA 5FZ1A 3ZMOA 2JG9A 1WW7A 3P6BA 1R64A 4NRQA 4H14A 1SDDB 2O1QA 1QJY3 3TN91 5FPLA 3LFIA 5C3RA 1PO22 1AXKA 2DTWA 2ZEXA 4NIAA 3O1OA 1C4RA 2TBVA 3RYKA 2V4VA 1ND3C 1RUJ2 4EN7B 3W5NA 3AVRA 3FC0A 3LDBA 4JKMA 2I2SA 2VMHA 1UOFA 3N9QA 3VKLA 4QPGC 3I2OA 3OGVA 4E2GA 4QAWA 5A3OA 2PELA 4IEXA 4UFIA 2HWD1 5E1RA 4YVWB 4AGVA 2HWF1 1VALA 3LB9A 4DXSA 1H2KA 3MV01 1RUD2 2PMWB 3TEXA 1VBD2 3I3EA 2UU8A 4C8DA 3M4FA 5K0UC 5F8PA 3AKRA 1O4YA 3AMQA 1FV3A 3IDEA 3NNJA 2DU0A 5EHDA 3ZVXA 1JZ6A 4COYA 3U11A 1C1FA 3LEMA 3PVNA 5A7QA 3HNBM 4M0NA 1SFNA 4E27A 2QQOA 2GNMA 3WNOA 3T2TA 1XB9A 1AYN3 3AK0A 1JUIA 5A70A 5CAZA 4DUVA 1YWKA 4XUOA 1QH7A 4YZ4A 4I0BA 2C5DA 2G1MA 4XUNA 4CEYB 5LY1A 2LW8A 1JYWA 5FK7A 4OI1A 3ABZA 4Q2FA 2VQUA 1BK1A 1KJLA 5JI9A 1CQ9A 4QPIC 5DZFA 2YU1A 1QU0A 4FCAA 1FOD3 5BNNC 3SCHA 4XFCA 4LK7A 4GKXA 4NRPA 3PHMA 1R1A2 1S0FA 1UPSA 2WNUC 4COVA 4NVPA 3VBFB 1UYPA 4U36A 4IEWA 1QEXA 3VZMA 1GOFA 3R05A 1WCSA 3T4VA 1K5MC 2ZEYA 4TLGA 3ZYGA 1QJU1 2W1SA 4XF1A 3T0BA 2EXHA 4MUVA 4CU9A 4A3XA 2R073 4OYUA 3NAPB 3I4IA 3ZN5A 4IEPA 2XXZA 1RUF3 5FJKA 3LA2A 4GIQA 1FAYA 3MUY1 3AP6A 4Y1UA 5FXWA 1WBLA 1UIKA 1O4TA 5FYMA 3AYCA 4I3GA 3B69A 3FWEA 4NHYA 4XXAA 4QX8A 4QWNA 1MS5A 1OD5A 4KU7A 5DMYA 1GWKA 3PVOA 2YU2A 3DKWA 3RZJA 1CAXB 5D8AB 2OT7A 1LU1A 4NUBA 4YGCA 5CB7A 4W6XA 5F39A 4P14A 4DMIA 2JG8A 4CDWB 4BPZA 1OA2A 1EPZA 4TYSA 4QX2A 1W90A 1H4GA 1OOPA 4XUTA 1XU1A 3L2YA 3WF4A 1JZ8A 1GP4A 2JDMA 2QZ3A 1YQ2A 2P1BA 2PAKA 1LHWA 2ZPXA 4BK5A 1V6OA 4MGZE 3VL8A 4IERA 3JD72 1FMD3 4M3CE 3THTA 3VKMA 4A4AA 5FBJA 2B9UA 3WW2A 2PN5A 4HFSA 4NPMA 3WNPA 2PAMA 2XOMA 4UWDA 4LR4A 4GALA 4Y1YA 4BM8A 3QACA 1HX6A 2RM23 1S0BA 3CNAA 4CCCA 5CU1A 2B45X 4BIFA 4QPGB 4KWKA 2WQ4A 4CE8A 1CIYA 5KXDA 2R7EB 2W08A 2BYVE 2ZX1A 2VAUA 3O1VA 4BHPA 3LEIA 5DPNA 4HL0A 3WUCA 1HJGA 3MDPA 3WF2A 4LE3A 3TB0A 4XPVA 4EN6B 1AL22 3D4KA 2IUWA 4TLFA 5K0UB 1PO12 1D4M3 5CFDB 4QXKA 1CVNA 4XQ4A 1STMA 4AEKA 1YEWA 2OIIA 2OX0A 3RG0A 5I0DA 1CD3G 1VP6A 5BNQA 1GSLA 1JS9A 4N7UA 4DFSA 2PQQA 5I0SA 2YHJA 5EPAA 3CBNA 4BDVB 2J42A 3AZVA 1CN1A 3AP9A 2R1BA 3ST7A 1H6YA 1DP0A 1OQEA 1W6MA 2WWUA 1GZ9A 1PGW2 4GH4C 4Y26A 3RS6A 4AFCA 2WSVA 1F4AA 4K1YA 2WFF1 3NRUA 1X8EA 1UMZA 4QPIB 2MEV1 2JICA 3LDKA 4EQVA 1G8WA 5BNNB 1HRI3 3AZXA 1ZBE1 1X50A 1WZXA 4TXWA 3NL1A 4JRAA 4AVAA 2VZOA 1ZZ8A 3A0NA 5C3PA 2WNUB 3PMSA 4LO6B 3RJ2X 1N1SA 3ZSJA 4QX3A 4BJ0A 3PL0A 4YFWA 4G4FA 3WVJA 5JCTA 3OTFA 3URFA 3IWZA 4YW6A 1HQNA 5E6HA 4FFFA 5FQ0B 1K5MB 2WQZC 4QU2A 5A7WB 2ZGUA 2LTNA 3NV3A 3PUAA 3RFRA 2I74A 1XNTA 4CCNA 3ZYPA 1F15A 3HD8B 1NG0A 4V1PA 2D3SA 2VUDA 1OA3A 5A6QA 4N53A 1T6GC 2RVAA 2LM3A 1J83A 2XKOA 3OD4A 1VBE2 3AB0A 3BALA 3W9AA 4BXFA 1FNZA 3HEIA 1YJKA 2VUJA 1YQ8A 3JU9A 4IE6A 5FYHA 1AR62 3I59B 4MZUA 1LEDA 2VMCA 3VKNA 5IHRA 5FYTA 2ILMA 2ETEA 4LITA 4RN5A 3ELNA 1TQ5A 2YGLA 5BNOC 5JXHA 5IK8A 2VXJA 2ZJCA 3ZLIA 1SQ4A 3TN92 4DXRA 1IG0A 1MS3A 2Z79A 5A3NA 2CGPA 3D8CA 1LULA 4QQPA 3G7DA 3ZFGC 4ZONA 3E6DA 4DOUA 3WY6A 2JG9C 3CJIA 3GF6A 3ZDSA 2AGSA 2KXLA 3I2IA 3M3QA 3MUZ1 4AI0A 1GZWA 1I5PA 4N43A 3K51A 1YRZA 4QKBA 1RJ8A 4ZS3A 4UW4A 5FUNA 5A7OA 1AXZA 2FCTA 2HWD2 2WZR2 2VOXA 2HWF2 4RFT0 1V00A 4MGYE 3KHCA 5JAXA 4OCTA 4META 4ES9A 2RS31 1SHWB 3OCPA 2QDRA 4YGDA 1S1AA 1G86A 5FZ7A 4Y1XA 1QJY1 3ZXGA 2GP5A 4AL9A 4HVRA 4A7YA 5IVJA 3TBDA 4CUGA 4WZFA 4JCKA 4CP9A 4Q4Y3 5BNPA 1W9TA 4J25A 3UL2A 4AVCA 3P3NA 4XDPA 1C3HA 4OHYA 2XR4A 2RDQA 1W8OA 4E8CA 3FLTA 1HJFA 1W0OA 3K75B 2TUNA 4YWAA 2CAVA 1KS4A 3GJBA 1O91A 4QX5A 5DDJ2 3BTZA 2DDUA 5AVPA 2P17A 5LK5A 2V73A 4A41A 5ABJA 5LEKA 1KS5A 1Q8OA 3OJBA 5ACA1 3PVEA 2JDUA 4IV1A 3KGZA 3ES4A 4FOVA 4XE9A 2K46A 2GC0A 2W0XA 4RFRB 3NNMA 2HYXA 3MO4A 4GH4B 4YG3A 4A6OA 1ND2A 1OPMA 2TNFA 2ARCA 1RUNA 4AVSA 1ODMA 3K46A 1AYN1 1L7RA 4GMP0 2XH6A 1QJU2 1COV3 3KF3A 4K8FA 3TWIA 4YW7A 2A6YA 1AZDA 1OF4A 3LKJA 1OUXA 5FZFA 5F5CA 1SLBA 2DBIA 3PU3A 2JXAA 4GB33 4KBZA 3WQ1A 4AQ6A 3IDAA 1QHDA 1T2XA 1FOD1 4CEWA 3HIFA 5DAPA 5I8TA 5JOYA 4BB3A 3OBTA 3NNFA 1F5JA 1C8NA 1GWMA 3OBAA 3I3DA 2VTXJ 3WW3A 4CDUA 4ZU5A 1GOHA 3LF7A 4LKSA 4YW4A 1FI2A 2EIEA 1AXYA 1OSGA 1TMF3 2DURA 4NPLA 5T3NA 2AEYA 2JJ6A 2VZQA 4TN7A 4ZY9A 4CU7A 2LS6A 2RDRA 3ENRA 4ZS2A 3X29B 4DB5A 3WG1A 3AVSA 5GZDA 2ZGRA 2XVLA 3Q8BA 1RUF1 5BNOB 4EYUA 1UZYA 4O7XA 1OOPC 4YZ3A 4AHXA 4FAHA 4MO3M 3Q8EA 4A7KA 3ZFGB 1XJAA 4IQPA 4LBMA 1VLNA 4CUBA 1Y4WA 2JG9B 1C8M1 5F32A 5FZHA 4NIHA 2AC1A 1JN2P 3H7JA 1EV13 2BFUS 2KD7A 5IWFA 1V9U3 2VBDA 3GZAA 3AP4A 2WKKA 2WLQA 4XDOA 5FZIA 5FZGA 4MG2A 2VVDA 2WA4A 1RHI1 2WT0A 2IXHA 4LBKA 1CIWA 2E33A 3ZPOA 3D0SA 2VC9A 3MFAA 1ZREA 2C9KA 4P9LA 3GGLA 4D7YA 1JODA 2VECA 1PNFA 2Z4FA 3IT8A 3SHRA 2FD8A 2UY8A 2F4LA 3FBYA 1AX1A 3LDRA 4D3WA 3BODA 5A3UA 1FMD1 3VDAA 3HAGA 5FK8A 3C7GA 3VD3A 1Q43A 1P8JA 1JOBA 2RS52 4QXHA 5D2AA 2W87A 2B7YA 4Q4V3 1DU3D 4Q8LA 4QX7A 2CY6A 3MI8A 4RS5A 1TVGA 1ULDA 3RMXA 4AK3A 2SBAA 2G9FA 1WCQA 4N7IA 4JTNA 1OQDA 3T1MA 3NV1A 1PM7A 3DUIA 3RVHA 2MEV2 2L9LA 2XG3A 4P9XA 1MEC1 1ZBE2 3BYWA 2ZMNA 4GD4A 2PHWA 5DZEA 1DGRN 5F5IA 3NVCA 1GQHA 3KT1A 4QM8A 4D0QA 2AACA 1JW6A 3DEMA 1Q8VA 1OBNA 2YZ4A 5HCBA 2QQPA 2WNVB 1UY0A 5FZDA 1HB2A 1JTZX 1YO8A 5LB6A 3O5SA 5EZWA 2YY1A 5FV3A 5IVFA 5FYZA 1W99A 4Y3OA 2ZEZA 5FZMA 1HRV1 2EA7A 5FXVA 1RVF2 2CV6A 3H42B 1H2NA 2D97A 1GP5A 4LUKA 3VZKA 4L2NA 1HRI1 2ATFA 2WO2A 4N53C 2DCTA 3LWCA 3WT3A 4FP3A 1RYYA 1BEV1 4EWEA 1QQP3 3T1LA 4HPKA 4EE2A 3HQRA 3WW1A 1OT5A 3DYPA 1H30A 5CIRA 4FPCA 3V64A 1SPPA 2BDRA 1AL23 3BTAA 1XYOA 3LA3A 5GZEA 1U5YA 1MS1A 2BGPA 4K20A 2GH8A 2Q0AA 1PZ9A 3SH4A 1GNHA 3WQ0A 2O8OA 1K5JA 5ERLA 1O3SA 4Y24A 1CAWA 5FDBA 4LO7A 4QHOA 3U75A 2WZ8A 1JZ7A 4B4RA 1LR5A 4XC9A 5EYXA 2CSGA 3VKOA 1OOPB 2R041 3N7JA 1IG3A 4K40A 4I2OA 4FVVA 4N43C 4NIDA 3ON7A 2X8KA 4GMP1 2RS32 4AQTA 1CZVA 1UXZA 3MF6A 3RRDA 4NN0A 5A1LA 5DAWA 1YFXA 2HWE3 1JYXA 2E53A 2CAUA 3OPTA 4Z1VA 1Y9GA 4OMCA 3LPGA 3S5AA 3IMMA 4NE9A 4DY5A 4QKNA 2TEPA 4FTSA 4QGNA 3CO2A 3V0BB 4H2AA 1J1LA 2JDAA 3T30A 5B2GB 4OUEA 1WLTA 2EXKA 3KV6A 3B5LB 4M3CF 1GU3A 2VQAA 4EROA 4CDWA 3G6JB 2XJUA 4MV2A 1RUH2 5FY0A 1F9KA 2ZGQA 5AC91 3MPBA 4QD2A 5BNPC 3ALQA 1KDKA 2VOKA 2A75A 3NWKA 3PDQA 3OGGA 5ACA2 3ZR6A 2YG0A 4CCJA 2A3WA 1MS4A 4A42A 3NSTA 4GXLA 1RITA 1NE6A 4CXWA 4URAA 3VKFC 4AHYA 2D93A 5ABJC 3I97A 2VL4A 3PNAA 1AR71 2NN8A 2G4IA 1VBA1 2PHLA 3AKTA 3IM0A 4IV1C 3ZYFA 3OEBA 4LJHA 4Q4Y1 5FY1A 3GM8A 3MGUA 5FXZA 4HKLA 1ND2C 2JX9A 1SCRA 4CTEA 4LHLA 4E9KA 5JZGC 3NJVA 1DQ2A 1W2AX 2Y6JA 3OBRA 5L9RA 4PBOA 4X6QB 3FUQA 4L8QA 3SMHA 1F5FA 3TYJA 2DFCA 4P5YA 3VHNA 2AUYA 2QQUA 3CIHA 2KR2A 1IPJA 3SC7X 2QJVA 2WZR3 3D82A 3DV8A 2PQSA 3ROUA 2EICA 2EAKA 1CZSA 1W3XA 4XFHA 5K0UA 5FJHA 1OKQA 2BPA2 1UYYA 1RUG1 5CFDA 3ILNA 2QQKA 4NWVA 4CEWC 3F2ZA 4A45A 3EO6A 4JX0A 2WS92 2WC2A 2XJPA 2XBO1 3BB6A 4CDUC 1JZ3A 1ULOA 1Q8QA 3FFZA 2ZZJA 4N53B 4AAXA 4FPYA 4O9GA 1Q3EA 4CCMA 3HNYM 3ZFFA 2QVSB 2RJKA 4FPJA 3RZMA 2P4EA 4N9IA 1NXD1 1CGPA 4ISRA 1ULFA 1OLMA 5JI7A 3A0KA 1HB3A 4TTGA 3B9IA 3IBMA 1O8PA 3LFMA 4XJ8A 1ZBA3 1NYWA 3KSCA 1AYM3 2CGNA 2A6VA 5JOZA 2VBPA 3FUOA 3S7EA 2WNUA 4GULA 4OZXA 4QPWA 5FIXA 1WMDA 5FQ0A 1GNZA 1MPXA 1GZWB 2WA3A 1IKPA 4N43B 4X8PA 3H1YA 4D7SA 1RXGA 3POIA 3NW4A 1LGCA 1MZEA 4EN9B 1JYTA 1T6BX 4LBQA 1TME1 1VAKA 4ZU4A 3MZHA 2NZ9A 4L97A 2GN3A 5C5TA 5T55A 1I6XA 1IPKA 3WOGA 1RIRA 3I59A 4BK4A 2VMGA 3PIGA 3EB7A 4S2FA 1J3RA 2UWAA 3ASIA 2BUKA 3UYJA 4BA6A 4P08A 5FYCA 4D8MA 1G9DA 1PVC1 3FN9A 4KMQA 3WG2A 1V9U1 3P1IA 4CUAA 2XMLA 3RSJA 1A78A 3OF1A 4ASKA 2GMEA 4CP9B 4KG8A 1BBT1 1H2MA 3HT2A 5BNPB 2GH2A 1TG7A 2WZEA 4RS5C 4IE4A 1QMJA 1RMU3 1MEC2 5FPUA 3WG3A 4HN1A 5CYYA 1PGL1 3K4DA 5C4WC 4LPLA 5FPZA 3PUIA 1FPN2 1ZZ9A 4OHWA 4AG4A 3JBG3 1ZRFA 3WD5A 4XQWA 5FLHA 5ABJB 4L11A 1XQNA 4ES8A 1ASJ1 1Y43B 3LAGA 4IV1B 3U0ZA 2XUMA 2Q4SA 2VQ0A 3S57A 1H1IA 4NHXA 1CPNA 4QQHA 1QKQA 4DZGA 2K2SA 1ND2B 3N9NA 4FPEA 5JZGB 3WQ7A 4Q29A 1Z7S3 1BMV1 2VQTA 1DYKA 1HRV2 1LOCA 1QJX1 1BVP1 4FOWA 3H1WA 2VOTA 3POSA 4ASMB 2BVBA 5L9BA 3H8RA 4M4RA 1O5LA 4AFMA 2D7FA 1BEV2 4KG0A 5JUVA 5CKQA 3KQ4B 4XQDA 1W8FA 1BHGA 1OKOA 2XJVA 2Q8EA 4H3WA 4AEJA 4CEWB 4BXSV 4NROA 5IAXA 5KHIA 3FLPA 1R083 3OUJA 4CDUB 3V0AB 1IQAA 4DUXA 3FX3A 4GQ7A 2NMOA 3H50A 1A8DA 3HQUA 1IS3A 2IVJA 2ID4A 1VE0A 2Y38A 1UWWA 1D2SA 1DFQA 5EP9A 1OPOA 5LBCA 5F7UA 4R9BA 1G6NA 4QHZA 5FPAA 4YFZA 4FTEA 2R042 1NZIA 5F9TA 1REFA 3POBA 5LATA 1SFPA 4YARA 2RR13 1QQP1 2BJSA 2E7TA 5T5PA 5C70A 4PF1A 1W0NA 3CKHA 1MR5A 2HYKA 4PLOA 5FP8A 2WT1A 4SBVA 3U4SA 3UKVA 3ME2A 5GZCA 1VR3A 2XLAA 3B01A 4CDQA 1W8UA 4RR3A 1DQ4A 1PNGA 1SBFA 3USUB 3QLQA 2YB7A 4W6YA 3S0MA 3POFA 4LK6A 4OUSA 4MH0E 3MW4A 4AQ2A 4AOCA 1RJ7A 3VBSA 3AYEA 2KA3A 5AC92 2ZGMA 2SLIA 1IOAA 5GLWA 3O1TA 1PIV3 1REDA 2HJIA 4LO5B 4PI2A 4FQ4A 3CZUA 4JKKA 5FY4A 5F3EA 5I0TA 4XCAA 3ZYIB 3OPZA 5A3PA 1GZTA 1KXGA 3LSEA 3WLUA 2VCCA 3J7MA 4HKOA 4KNCA 1VBB3 3RQ0A 3SKJE 1AR72 3B7MA 1VBA2 3PUHA 5HV4A 3CU7A 2HWB3 4RS5B 1GP6A 1L7QA 4IV3B 1YI9A 2VBBA 3VBUA 4XFFA 2J1TA 3VZNA 4B3NA 1XBFA 3EYPA 4FPKA 4XFAA 3WINE 5C4WB 5KC5A 2NP0A 2ZXQA 4EV0A 2XUEA 4CU8A 1HB4A 5FKBA 5GALA 5C3OA 1W8ZA 5H9QA 3RJRA 1MQTA 1HN1A 4L92A 3IIAA 1HLCA 1LODA 1QXJA 3MW3A 1W05A 5FMDA 3JQXA 5EIYB 1K12A 1QH6A 1WD3A 1VBC1 2VZVA 5JLVA 1RUG2 2R0HA 3WP3A 4XF0A 2QFEA 3MLKA 4EZHA 1OA4A 4TZDA 2EXIA 2XBO2 1UMIA 3A22A 5EXOA 1AR92 2VTXA 1UY4A 4S2HA 4URTA 3LSDA 5CFDC 3I3MA 3C7HA 4LA3A 4XMAA 5LY2A 3N7LA 5KXEA 5IT6A 4W6WA 4MYEA 4XVHA 2W91A 2ZGOA 3VDBA 2OKXA 2PHRA 3TNPB 1LTEA 2PHDA 3IIIA 4GJZA 4HPKB 4BISA 5IJRA 3ZFFC 3PIJA 4FOQA 5JOWA 2HH9A 2IXCA 1OXCA 3AKSA 3KS7A 2D3PA 3SQOA 1SPPB 3GALA 1V6NA 3MHZA 1W04A 4FP2A 4L0PA 1JOPA 1UYXA 1ZZ7A 4R9CA 1YFUA 2V5DA 1CAWB 2WNVA 4H7LA 4XBLA 4EWAA 1VRH1 4OQ9A 1BJQA 2XL9A 2HEVF 4XZPA 1UAIA 3UJQA 4NHMA 3ZM8A 4LEJA 2FHRA 3KM5A 2K9ZA 1AJKA 2NLRA 2FCUA 4XJWA 3U78A 5I8SA 4IE7A 3E6BA 2J22A 5F3IA 1ENQA 1DQ1A 1LHUA 2EAAA 1HQLA 3POYA 2HLEA 2EXJA 4INDA 5A80A 4CUCA 1JBCA 3THPA 1MZ6A 3APBA 3T2QA 1UIJA 4Q4W3 1EP0A 1ZA4A 4Q0SA 3BUCA 2A1XA 4ONUA 1BBT2 4F83A 3NO8A 1LOAA 3J26N 3C3VA 4WVVA 5IVBA 2HWC3 5B4XA 2WS93 4HANA 5EJ3A 5JOXA 3LCPA 3C8XA 3I2KA 3KVAA 4Y5Z0 1UXXX 2WYFA 4DPNA 1RUC3 5BV6A 1RC6A 2EIBA 1S4CA 3SITA 4Z82A 4BMEA 1NY72 4MLOA 5HXVA 1S55A 3J8F3 2OPKA 2D6MA 5A6YA 2AR6A 5F37A 4MOAA 1UN1A 2NM1A 4ZPIA 5JR2A 1YC61 3WF0A 4BIOA 2RMU1 1WD4A 4HONA 3OY8A 1EUUA 1S0CA 5C33A 4AHWA 1BMV2 1UKGA 3OUIA 1RUE3 2XKPA 2DF7A 4COUA 3WG4A 3KGLA 2VZTA 2PXJA 4IEVA 4W8JA 1AL0G 3V0BA 2YBSA 1UOGA 1V6LA 3A7QA 3PJQA 4CP2A 1SZBA 4HG6B 2DVAA 3POJA 4YG6A 4M3CA 1GOGA 1MVQA 2ZHLA 2EIGA 2ZZQA 1F8VA 1LEMA 2WIIB 5LA0A 1QNWA 1HKDA 4A44A 4LNVA 5JWPA 3CEWA 1XNBA 3F95A 3HVDA 1RL3A 4O65A 1TNRA 1Y7BA 2W39A 1G9FA 2WO1A 3MIGA 2WRAA 3AMMA 1DZRA 3OOXA 4I09A 3JZVA 5CBLA 2RS11 3CJXA 4BQ3A 3K77A 1B35A 1E5IA 4IESA 2P37A 3A21A 4JGYA 2BV4A 3ZFFB 4C91A 3PJYA 4YM1A 5FWEA 2VW0A 1YI7A 2XONA 4OI4A 1IS6A 4XHXA 5HCFA 3ZXKA 5FPXA 5I0RA 1LENA 2E31A 4KU8A 4OZOA 4QGMA 3WV6A 5FZKA 4AW7A 4XFBA 1HXS1 4Q4X1 3VL9A 5FWJA 3K4ZA 1POQA 4YRDA 1O8SA 4UFHA 2Q1MA 1LHNA 3FBMA 1XSQA 3ZXEA 2ADEA 4M0HA 4PI0A 2J1SA 2J1EA 4YLZA 1GWLA 1U0AA 4NWWA 2VVFA 2BWAA 3WQBA 4XABA 1ENXA 1DZQA 3R4DB 1E57A 2NMNA 3KHBA 3O1PA 3BI3A 2ZEWA 1SACA 4CDQC 4RR3C 4XJAA 5FPVA 3IAQA 5KWRA 3O14A 5JSRA 5F3GA 2IVIB 5KBFA 4LBQB 2E26A 1YIPA 2RR11 3N9LA 4M01A 2PAEA 1QDOA 3RYPA 4AEMA 2JDYA 4JDMA 2ZX3A 4L99A 5J36A 4GA9A 4XTMA 1EAH3 2PHTA 3VBSC 1O4ZA 5A32B 1AR81 4ITCA 3VLBB 1F31A 1OLQA 5IW0A 2GNDA 1ENSA 1Z78A 1WCDJ 2R063 3ORJA 3S7IA 5IFTA 3M8LA 1R093 2GALA 1UX7A 2DCZA 2W5FA 5C5UA 1RUI3 2VCMA 5I93A 1SMVA 5FLIA 3FE5A 2PLV1 3D5OA 5EFUA 5CKNA 3AZYA 5E88A 5M0TA 2QQVA 4UT5A 5FO8B 1TEIA 2VMDA 2IXJA 4RHV1 4PDWA 1NXMA 2BNNA 2WAAA 3VBUC 3W21A 4IW3A 4EZ4A 2R16A 4LQRA 1SEFA 1X9PA 2ORXA 3N7KA 1JXNA 1ZYBA 2PHXA 5H9PA 5FZLA 2UYAA 4NPRA 4LKEA 1ZNPA 2BNMA 4NHKA 4XURA 4AGGA 5L9VA 1ULCA 2AH2A 4FFGA 1VBC2 5JPMB 2VUCA 2QQJA 2WDBA 2ZA9A 1MQTC 1DGLA 2GU9A 3HPNA 4YM2A 1C1LA 1H8VA 3FHAA 3SCGA 3DXTA 3GBFA 1BCXA 5JPNB 3N9PA 3ACLA 4P9JA 5I91A 2XWBB 1AX0A 3EQEA 5FO7B 4MXVA 4IE0A 5LBEA 3ZMNA 1LKNA 5EV7A 5APAA 1JZ5A 2BTVC 3OEAA 1GKBA 4M4PA 4IDZA 3VDDA 1UO9A 3CL1A 4D7TA 4WBBA 2QUOA 4GWJA 2UYBA 4V2VA 4WV8A 4ATEA 2JB8A 1DQ0A 5FO9B 3GBGA 2DVGA 1JYNA 3LIHA 2WWSA 4QX1A 1X36A 3I49A 5FP3A 4LHKA 2ZX2A 5CVRA 4O61A 4P00B 1DLCA 3ACGA 5FCCA 5FYIA 3NNGA 4Q0VA 5JIUA 4FAGA 3WCRA 5LBBA 1C57A 4WVMB 2WAOA 1VRH2 2AEZA 4UW6A 3TOJA 4AVVA 4JDNA 4ZHNA 1D4VB 2ZS6B 1UKRA 2CDPA 4BQ2A 3H8OA 3ZX7A 5JZGA 5ISLA 1O3QA 4CPBD 1Q8PA 1JU4A 2WNVC 4P5HA 3P3PA 3KT7A 3INAA 4R9DA 4LIUA 1IGOA 2OW4A 5JSOA 3BVCA 3KV4A 1A6CA 1OC1A 1PO23 1V6IA 3GHNA 2JEMA 2ZGPA 3L2HA 5T50A 1YFYA 4Y22A 5J7MA 1RUJ3 2WWJA 3RI9A 2D43A 3IDBB 3U1XA 1PMJX 5JSPA 4XFGA 1YUDA 2B42B 3AXDA 2PFWA 3T4HB 1J1TA 4CDQB 2O8QA 4RR3B 2GC1A 3ZKYA 2WN2A 2X5IC 3PMEA 3ZDVA 3V0AA 1I9RA 3LD8A 1D2QA 5LCWL 3BPSA 1RUD3 1W6NA 2JENA 1BK0A 1KFUL 1VBD3 2D5HA 2ZAAA 5BPXA 3BIWE 1AR93 3RPQA 3VBSB 1BYHA 4P9YA 2ZHNA 3AMNA 1S2BA 3S5QA 2X09A 2YROA 3NJYA 5FZCA 2R071 2GC2A 2WYSA 3GZUC 3I2GA 2JD9A 2ZGKA 3JB4C 2XWJB 4AXOA 3RZGA 2DVBA 3R4SA 2J1UA 4YW2A 4QQ2A 3MIDA 3C7EA 3ZYHA 4C1WA 4CCLA 3L9JT 5H9SA 3DYOA 1NE4A 2RMU2 2VZ3A 1WLWA 5C8CC 3VV1A 2OA2A 2A6ZA 4H55A 3ZFEA 1CJPA 2C6SA 4C1XA 3C7FA 3WNXA 3GNEA 1TZOA 1UZVA 4KWJA 1VMFA 3VBUB 3TEWA 4I0AA 3WNKA 5A6XA 2JWPA 2IXIA 2H0VA 3SXWA 1E5HA 4FPOB 3USUA 1H1AA 1KGYA 1CAVA 1S2EA 2FDIA 1R1A3 3ITQA 1RUC1 1SG3A 4BQ1A 5FPBA 2QKDA 5CADA 1N1VA 1MQTB 4K3UA 4KGGA 4XACA 4DINB 3J8F1 3BTYA 2QQIA 3ZN4A 4DXTA 4MSVA 2WR9A 4Y1ZA 4Q1PA 1OFNA 2W1QA 1LOGA 1Q56A 2JIJA 3K48A 2VZPA 3ZR5A 5J3UA 1LOFC 2X53S 1LOEA 1UZWA 2RS12 3UESA 4XXPA 5LEJA 2PA7A 2RM21 3D6EA 2DCJA 3KMHA 2VZRA 1QJFA 2LUWA 4IV3A 1FX5A 5A33A 1WLCA 2WABA 3O1RA 2EF6A 2ZGSA 1POV3 5SV8A 2YBPA 1B35C 2AZ5A 1TE1B 3JB8A 3ZPYA 3PTYA 2WFF2 2LALA 3LGRA 5C4WA 2WFPA 4B4QA 4JGYC 1HXS2 4RL7A 3O12A 3ZXLA 4AHZA 1JOJA 3BTXA 4S2GA 4WVWA 1SFYA 2DU1A 5G04L 3RZZA 4YG0A 1W8HA 1D4M1 3JQWA 3I2FA 1O7FA 3NJZA 4B7EA 4C0BA 5FY9A 1X82A 1QY4A 3E5UA 1I5ZA 4GJYA 3LOIA 4XMIA 1L7LA 4IEYA 1W8WA 3AP7A 3JD73 4IGPA 4OI2A 3J7HA 4TWTA 2JDHA 5FR3A 2GAUA 4TSVA 2RG4A 2VJXA 5EJZB 1W06A 1PX4A 3JCIA 2VR4A 4QU1A 1ULPA 4QHBA 1AR82 1QJEA 2VPVA 3BU0A 3TAYA 2OPWA 2A73B 1N3OA 2X5IB 3A4UA 1FATA 3EBRA 5DQ0A 4M00A 4JAAA 4XYXA 2WZPP 2Q5TA 5C3SA 4CXXA 3ZSKA 4B1MA 2P5BA 4QKDA 2QQMA 4HMZA 1W9FA 1Y9QA 1PO13 2VNRA 3U37A 2H6BA 3RGBA 1ZM1A 2FDGA 2Y6GA 4ARYA 4PCRA 1JU3A 4IE5A 4RHV2 4FI9A 3ZYJB 3QCWA 3UETA 4PHZA 2NQYA 2VG9A 5J96B 1UW8A 2R0FA 4WM8C 2A6XA 1DGRA 1EAH1 3THDA 5L73A 4PDWC 5C8CB 5DUUA 5F1RA 3FFQA 5FMOL 1PGSA 5JXJA 2ZMKA 3H7YA 5LA9A 1OI6A 1ULGA 4BU2A 1GQPA 2Y0OA 3OY8B 4QM9A 1X7NA 2AYHA 3W20A 1H6XA 5CA6A 1QJY2 2JE9A 2IFWA 2NPIA 2WNEA 1URXA 3V56A 5LA1A 2JD4A 4W50A 3KF5A 2E6VA 3HR9A 4BMBA 5KHKA 2RJLA 2YV8A 2WINB 4MGSA 3M2MA 1LJ7A 4LO8A 5FYYA 3AFKA 3I8TA 4HZFA 2V5YA 2WJSA 4M3CB 3BGAA 1JUHA 5FZBA 2FBEA 4Y4RA 3VDDC 1G9CA 1VIWB 4L9BA 4OQ8A 1BVVA 4IGOA 1YJLA 4K9SA 2VU9A 2GNBA 1VBE3 1W39A 1ZA7A 1MACA 1AR63 1X9TA 4HSLA 5JXGA 4I01A 3KCYA 3UKNA 1ENRA 4V2WA 3PTRB 3ACHA 2DTYA 3WF3A 4P9GA 3VN4A 1H2LA 5EYYA 3WNMA 1B35B 1CONA 2Y34A 1A34A 4AF9A 5C9AB 2BGOA 1AYN2 4JGYB 3TN93 3BPZA 4K21A 2Y26A 4MVTA 2OYZA 1G9AA 1W8TA 3NNLA 5HI0A 4Y5TA 1YQ5A 5FYVA 3KLSA 2VTFA 1FOD2 1YIFA 1QIQA 2KM2A 5LWBA 4DRRA 2HWD3 4JZRA 3T09A 2MNGA 4Q8KA 3W59A 2HWF3 2YGMA 4OULA 4QB6A 1JHNA 5FUIA 4YSFA 5HV0A 1OF3A 3AJYA 3VB9A 4NOTA 1CR7A 1RGSA 2WNOA 2YFZA 5FAXA 1COV1 5K7PA 3O0WA 4IUGA 4R4XA 3SISA 2R072 4K8RB 2JIGA 3WXPA 1JZ2A 1RUF2 1AUYA 1V0AA 5F6LB 4AEDA 2OVUA 1CPMA 3LEKA 5GJ6A 3S6PA 1RUJ1 3KQRA 5F5AA 4GB31 2W95A 4DY3A 3VUOA 3J7LA 3HT1A 4UFLA 3E5XA 1C8M2 4CRQA 5IK4A 2E51A 3LQCA 1LHOA 5DDJ3 3WDVA 3ZFEC 1TMF1 1VBD1 2Y0IA 1SCSA 4UAPA 4WM8B 3Q8AA 1RHI2 4PDWB 5FREA 4QB2A 5FMOS 1J84A 3OGRA 4PIYA 3D0JA 2ZX4A 3AYDA 3WHUA 2CL2A 4AQSA 1LNSA 1NCQA 1QJU3 3I3BA 2Y6KA 4FTBA 1XYPA 5A33B 1W6PA 2F17A 1FMD2 4JGZA 2BZDA 4IEOA 4AZZA 5C6CA 5DZGA 2VE1A 5A32A 3AZZA 1DQ6A 4ZKTB 2ZOEB 1EV11 1QXRA 2RM22 1VRBA 1GANA 1Y3TA 3AC0A 1IPSA 4QXCA 3NMBA 2VZUA 2MPFA 5IFPA 3VDDB 1CESA 3MEPA 4K1ZA 1UY1A 5DUXA 5DAXA 3H3LA 5IK7A 4FPFA 2W46A 4LKDA 4IV3C 3EJKA 4LULA 1UNBA 2PHFA 1QGLA 2FCVA 4B8EA 1D4M2 3I3QA 4MADA 2XJQA 4J6GA 2A3YA 1W28A 1GBGA 1XXNA 1GQGA 4J1XA 5KXCA 3WHTA 5F2WA 4XAAA 5FKCA 4BLJA 4D6QA 4BZ4A 4OI0A 1VAMA 3VD4A 4Q4V1 1W9SA 1S0EA 2GP3A 4CDXC 2J7MA 2C24A 1WCKA 3ACIA 4Y20B 4R4ZA 1DCSA 3WZ1A 4AFBA 5L7OA 5FYBA 1N1TA 5EQUA 4CZSA 2YPDA 1HRI2 3WDUA 5FOBB 3M1HA 4Y22B 2GNTA 4A6SA 2VCAA 1G9BA 1LESA 2QNKA 2OZ6A 4KI5M 1DG6A 3C2UA 1US2A 2OS2A 5DAQA 3WNNA 3OYWA 3C7OA 5J1XA 4PBPA 2A71A 1GNYA 5CKMA 3VBRA 1W6NB 1C5HA 1BXHA 2FMYA 3B9CA 3GBWA 4MXWA 3AMHA 1KQRA 4CPBA 4WVMA 5BY5A 2RS53 4XCBA 4OFGA 1CAUA 2XJRA 4RQPC 4JKLA 4XOGA 2Q8OA 3T0AA 4Q5OA 3UV9A 5HPOA 2JE8A 1VMHA 2D6PA 2JB4A 1I3HA 2Q1ZB 1IS4A 1PM4A 3HOBA 3W58A 3OGJA 4LOSA 1ZX5A 4IL7A 1LAJA 1GR3A 2BGCA 2IWGB 2MEV3 2YPJA 4NRMA 4IEQA 3ZFEB 3NKTA 3SCFA 1AL21 1AF9A 4HXCA 1ZBE3 1WW6A 5IVYA 3HN1A 2DFBA 2LRPA 5FOJB 4HETA 5K8SA 3P5BA 4ISQA 1O59A 1NCRB 4GZ9A 4UOJA 3TEYA 2FDHA 2Y8KA 4N8MA 1CAVB 1HIXA 4GWIA 4LT5A 1VJ2A 2P3IA 3BKZA 3ILFA 4G3YC 4XFIA 3H3ZA 4KBBA 1YNAA 1W03A 4NAOA 5I0UA 5T52A 5C8WA 1WGPA 2GMPA 1R1ZA 3GJAA 3VZOA 1RVF3 5LZ6A 4AI9A 2F4PA 2XJSA 4RSUA 3TEZA 1J3PA 2HWE1 1EYBA 1MZ5A 3ETPA 4P9WA 5FZ3A 4FXKB 3ZSMA 3MLLA 4A7ZA 1O5UA 1UZZA 4NHLA 5T5JA 5JXIA 3QH7A 4Y33A 3CDZB 2MHFA 1NQDA 1UU6A 4Q4Y2 4XHBA 3CMGA 2WT2A 1JMUB 1ULEA 2VW1A 3GZTB 4OHXA 3THCA 3POEA 5AFEA 1MS9A 4UFMA 3H8UA 4Z07A 2XVGA 4B4PA 2RDSA 4AWDA 1MVEA 4YW3A 4KWLA 4Q27A 3VZJA 1H8TA 2VXRA 3DPRC 3O0XA 4KL1A 2A70A 1AR61 5C71A 4Y1VA 3MBWA 1S0IA 1UYZA 4CDXB 2ZGLA 4LE4A 3PU8A 4LO4B 3WF1A 3U10A 3HBZA 2RS33 3KVBA 3IKWA 1NQJA 4PIXA 3IPVA 3NKGA 4YM0A 1COV2 2Q30A 2VZSA 3KT4A 4GWMA 4HT1T 5IVVA 1UMHA 2GSYA 1ONAA 1JHJA 1PHMA 3RWNA 3ZIWA 3VHPA 1UCXA 2W52A 1DYOA 4GB32 4DO0A 3V65A 4JHZA 4COWA 3PURA 3N35A 4NIIA 3OBZA 4OVEA 4AEDC 3POWA 5D1IA 4LKFA 3B93A 4DIQA 1JI6A 2WZR1 2B4KA 1RUH3 2QE3A 2CNAA
chains in the Genus database with same CATH topology
1LCLA 1U5ZA 1UL9A 2VVEA 1TMF2 4CYDA 4RQPB 1LU2A 2IC1A 2QZ2A 2ERFA 2YDEA 5ACA3 3RMYA 2JE7A 3U4XA 1QJZA 5CFCA 1MS0A 1HV1A 1DGWA 3DN7A 1TME2 1GYKA 4YZ2A 1YHFA 1I1EA 3AMPA 3VBOA 1WUVA 5GZGA 3FLRA 1NCQC 1ZBA1 5KHGA 1AYM1 1EV12 1U5XA 2X5IA 5DDJ1 4JGZC 2WLPA 1PVC2 1V9U2 1X33A 1OMIA 3I54A 2R49A 4PLMA 4LUMA 4MGIE 2C1FA 5KHHA 4KGQA 1Q5OA 3R6SA 2JDZA 1UF2C 5F5QA 2IFRA 3E5QA 3ZN6A 4LBJA 1O3RA 1PK6A 1PGL2 1QDCA 2UWBA 5C8CA 1ASJ2 1KD7A 2Z69A 3AZWA 2VW2A 4Q4V2 2JKBA 4QPYA 2ZGTA 4RGAA 2JECA 1C8M3 4Q0QA 1W6OB 3RDIA 4K6BA 1QJX2 1WMEA 4LA2A 4XIKA 4EN8B 4Z92B 5GLUA 3MLJA 1RMU1 1QOOA 3DPRB 2O0OA 2ZKNA 1RHI3 5E16A 5L7OC 2BQPA 1BQPA 3JBG1 4FPHA 2XLGA 4AVTA 3VZLA 2VMIA 3AJZA 3WDXA 1LOFA 4DQAA 2D5FA 5BXXA 4FO9A 1XYNA 1ZZCA 1Z7S1 3EXUA 1ND3B 2PTMA 1D0HA 4QQOA 3VBRC 4MGKE 5C9AA 4AEDB 2DUOA 3CF6E 4D94A 1YXWA 1QQP2 2RHPA 5BUVA 4HK8A 4BWOA 1O3TA 1SLAA 1OFSA 1ZZ6A 5HCAA 4HVOA 1W6QA 1H9WA 1MEC3 1WMFA 4UW3A 4EWDA 1R081 2OUJA 4AE2A 2UY9A 3H9AA 2VULA 1FPN3 2HEWF 3ECQA 4AFAA 1H9PA 4I02A 1NA1A 5BYNA 2P3KA 1N47A 5FTTC 5E89A 2RS51 5JVVA 3FZ3A 2BEOA 2YXSA 1QOTA 3ATGA 1A8MA 4OLLA 2E9QA 1HRV3 1KJRA 1NCQB 2XB6C 2OUHA 2VY0A 1W6PB 4JGZB 4YGBA 1N3QA 1S0GA 2HWE2 1V70A 5TSWA 1BEV3 1MS8A 1IZ3A 1ZRCA 1S0JA 2FZ1A 3MPPG 5GM0A 4Q1RA 4J1WA 4O9EA 2GZWA 4JDOA 4F3JA 1XU2A 2ZACA 4LBNA 1DIWA 2ZHKA 1ZRFA 4HBNA 3B3QE 2D44A 2ZX0A 4XBNA 1B09A 1Q8SA 1GLHA 1LGBA 2D6NA 4WM8A 3UKTA 4P9IA 5IUQA 2ZCWA 1JYIA 1PIV1 1RVF1 3ZO0B 3M70A 3MYXA 3MICA 4LBQD 2R043 4HN0A 1KITA 1YYNA 5L19A 1H8TC 4GMP3 1VBB1 2K0GA 2Z42A 2VNOA 4IEUA 1H0BA 4Z8BA 5JDBA 2DVFA 1DDLA 2HWB1 2V09A 3OD0A 3ZIXA 4XBQA 5KXBA 5E8AA 3E97A 4EN0A 5L7OB 1HV0A 1J3QA 1VB2A 3B00A 5KHJA 2BFUL 3WP6A 1U12A 2XVKA 1BZWA 2A7AA 4QMAA 3MIEA 2ZAHA 2IXLA 1SLIA 1REEA 5GKAC 4B7KA 5AC93 1CX4A 4BYYA 1SLTA 4SLIA 1ZVFA 4UBGA 3TRSB 1HW5A 2D3RA 2F6BA 3OYWB 1CJDA 4R9AA 4YZ5A 4YM3A 3VBRB 3WW4A 5DUWA 4MXWB 3WDTA 2DYCA 3MIHA 2BWCA 1CAUB 4CP1A 4H7MA 1AR73 1VBA3 5CFCC 4YVSA 5HBAA 1HDKA 4Y20A 1DLLA 2QCSB 1H1MA 3BOPA 1PZ7A 4OUMA 5IK5A 4FXGB 2D98A 3SLIA 4LBOA 4QGLA 1RUH1 5GLZA 1WA4A 1ZBA2 1AYM2 3AXEA 3VBOC 2VNGA 4IXLA 2YUEA 3QD6A 4UXAA 3TNQA 1AVBA 4CP0A 3AX4A 5JIAA 1IKQA 3MW2A 1NLRA 1OLRA 1RUG3 3VBHA 5A3MA 5DG1A 1G7YA 2XBO3 2DCYA 4BLIA 3WP4A 1UX6A 3H3UA 1PZ8A 4GWNA 3DL3A 4QT6A 3ZSEA 5J48A 1Z0HA 3KCCA 1PK6C 2ZTNA 4AGRA 4I0WB 4YW5A 1J59A 4IETA 2E7AA 4XF9A 3ILRA 1F2NA 2W68A 4Q4W1 3BU7A 2ET1A 3M3IA 1FYUA 2PHUA 1TNFA 2FQPA 3J9SA 5FBZA 2ARBA 1NCRA 1RMU2 2HWC1 2WS91 1UU5A 4XILA 2DUPA 1AX2A 5FLJA 2FMDA 1V6KA 5CG9A 1BKZA 4K7JA 2HKXA 4R8HA 2AREA 4WM7A 3JBG2 3QOPA 1V6JA 2JG8C 1DHKB 1H8TB 3DGTA 3N3HA 5J37A 2PYTA 1LRHA 1TME3 1QNYA 2B39A 5LRRA 1ALYA 4KQ7A 3CLPA 1AJOA 1RINA 1QOSA 4AFDA 2G9GA 3IPVB 1Z7S2 2H6CA 4UW5A 1APNA 1RUE1 5GLVA 5L36A 2UURA 2D40A 4FPGA 1KRIA 1UPIA 1PVC3 3QBQA 1WLDA 1LGNA 3O0VA 4YNIA 4KH9A 3AKPA 2P34A 1BBT3 4PIZA 5C9AC 3FMGA 3Q9OA 4Q4X2 1FV2A 1R082 1IS5A 3MIFA 3ZXJA 3AP5A 4RGGA 5KC6A 1XNCA 4FT8A 3ZYRA 1LECA 3JUUA 3DF0A 1ASJ3 1DGWX 4CDXA 2BW8A 4YYOA 5CFCB 4LLFA 2I45A 3M3OA 4YZ1A 1NA1C 1XE8A 2BVVA 1ZZBA 3ZSLA 2RR12 3NV2A 1A3KA 1QJX3 5I8YA 2E7QA 3VBOB 1SLCA 1UU4A 3KZ4C 1LB2A 1QXPA 2GMMA 3RYRA 4BOWA 1FPN1 2NYYA 4JRLA 2R32A 3WP5A 4COZA 2HEYF 2P3JA 2YMZA 4MX3A 4NR1A 3SH3A 4YVWA 3O7OA 2D6LX 3MFCA 2CWMA 2GC3A 2PLV2 4N9HA 5LK7B 2RE9A 1DZTA 4RQPA 1N3PA 4E2QA 3I7DA 3M7AA 4LTAA 2BBVA 4XJ9A 3ZN6B 1PK6B 3GYDA 1WBFA 2ES3A 1PIV2 2P2KA 5DUVA 3LZZA 3WDWA 4AI8A 1S2KA 4Z2WA 2DV9A 2R1DA 1GICA 3H0OA 2WSUA 4HLTA 3RI8A 4JV4A 2R061 1SBEA 1VBB2 3KD4A 1ZRRA 4Q0PA 4CEYA 2D6KA 1C28A 4FPLA 4Q26A 1R091 4B29A 4EJRA 2HWB2 2ET7A 4JTOA 2EALA 4XJZA 3MF9A 3PLQA 1POV0 4I3PA 1RUI1 4G9SB 1IHMA 2A5ZA 4E4SA 4HK9A 2IZWA 5H9RA 3M3EA 2JG8B 2H0BA 2N7GA 2C9AA 5EWSA 1L3JA 4U2AA 3VBFA 2A3XA 2OZJA 1YLLA 4Y4YA 2B8MA 3CJIC 4PQ9A 3H1MA 4R52A 4AI1A 5J09A 1S0DA 4OHVA 1J58A 3VHOA 2EVXA 1JH5A 3NAPA 4RD7A 4I30A 4YW1A 4LHNA 4AI2A 1W2UA 1NOVA 1FNYA 4ATFA 5DXDA 2GN7A 4DS0A 1W6OA 1CAXA 5D8AA 2ENRA 4X8NA 5AFBA 4GKYA 1H4HA 4HSJA 4BH9A 4YVSC 3DPRA 4ASLA 2CWSA 1W6QB 2CYFA 3WUDA 1JYCA 3N7MA 3N4MA 1NA1B 1VBC3 3I2DA 4E4ZA 5CNAA 1DQ5A 1W0PA 1V6MA 4XETA 4HVQA 2XL7A 2C0ZA 1W6MB 4PF5A 1ND3A 3VBHC 1XNDA 1D0GA 5K9YA 2E63A 2ZBJA 3QH6A 4QPGA 1PO21 1XE7A 1YFWA 3LA7A 3WX5A 3NV4A 2ZKLA 3AFGA 1WW4A 3MIBA 3FJSA 1UD1A 2ZGNA 3HWJA 1X8MA 4Q4W2 1VB4A 4XW3A 4XTPA 3AKQA 3ZXAC 4DNYA 3KB5A 3WDYA 4E2SA 2FZ2A 5FFOC 2Z5WA 4XEZA 2HWC2 5SV5A 4XF4A 5AVAA 1RUD1 5T54A 4E4DX 3HQXA 1AR91 2B5HA 1YCIA 1RUC2 3BOWA 1VRH3 4WZCA 1NCRC 1GV9A 2DVDA 2ZMLA 3J8F2 2YYOA 1EY2A 2I07B 1LHVA 4WM7C 4IEZA 3B94A 4QPIA 2BNOA 5BNNA 3ETQA 3IDCB 5J98B 3N36A 1RUE2 2VUAA 3ES1A 4HKWA 1DYPA 2XPJA 2DUQA 3R4UA 3CJIB 4BCUA 2XHKA 1K5MA 4PLNA 1R1A1 1GFF2 1XNKA 2ZABA 4AI3A 2A6WA 1M06G 4DRVA 2CGOA 1ZRDA 2R6QA 3LOBA 3R0RA 2VGDA 2VH9A 4ZXKA 4JQRA 2XLFA 3SNMA 4LLOA 3J4UH 1U5IA 1XRUA 3AM2A 3WR0A 4NO4A 4XDQA 2RMU3 2DCKA 3SH5A 2QDNA 3PVBB 4YVSB 1MZFA 2AENA 3WCSA 1GZCA 1POV1 2Z2SB 4XJUA 5LRSA 3B02A 2VOVA 2R30A 3M3CA 5F6KA 1VAVA 3ZXDA 2ZHMA 4C90A 1KFXL 4FQZA 1NY71 5JMCA 3HMYA 1SDWA 1NZCA 3VBHB 2VOWA 3JD71 2DWRA 3IMNA 4YVWC 3VGIA 3U07A 5CG8A 3BCWA 4Q0UA 4F7ZA 4FOYA 2RS13 1NLSA 2D6OX 2GDFA 1AHSA 1RB8G 5DG2A 4QQLA 1EAH2 3VHRA 5T5OA 3UK9A 4S2DA 1KDMA 3E6CC 4JVAA 1SLLA 1FT9A 1DF0A 2R062 5JR7B 1WW5A 1R092 2WFF3 4W65A 1LOBA 1QWRA 1HXS3 4Q4X3 1RUOA 1RUI2 1QF3A 2IXKA 5T5LA 4PJYA 1PO11 4JC1A 2ARXA 4CEYC 1DBNA 5A3LA 4UBHA 4A2UA 4DXZA 1N1YA 4GH4A 3KCXA 2X29A 4YGEA 3IN9A 4WM7B 5FRAA 3USSA 3UJOA 4F8AA 1FXZA 3VBFC 1EPWA 1C5IA 3RNSA 3ZXFA 4C0HA 1PGW1 4FSJA 2CTVA 5GLTA 4N90A 2XGXA 3FHIB 1OHFA 2B46X 4XF3A 1AR83 4X6RB 2YC0A 4OHZA 3NAPC 4BE3A 4ORFA 4AVBA 1SBDA 1HQWA 3GHMA 2PLV3 4D69A 4XIOA 5GZFA 3AYAA 3S30A 4LBLA 4RHV3 1RTVA 1PVXA 5D8AC 2UWCA 4AYUA 1OQ1A 4CDWC 1VBE1 3EHKA 4ZU7A 5BNOA 4FBFA 4WVZA 2XJTA 1PMIA 4RA0A 2WL1A 1M4WA 3ZFGA 3ZMOA 2JG9A 1WW7A 4H14A 2O1QA 3TN91 1QJY3 1PO22 1AXKA 2DTWA 1C4RA 2TBVA 3RYKA 1ND3C 1RUJ2 4EN7B 3FC0A 3VKLA 2I2SA 2VMHA 4QPGC 4E2GA 2PELA 4IEXA 2HWD1 5E1RA 4YVWB 4AGVA 2HWF1 1VALA 3LB9A 1H2KA 1RUD2 1VBD2 2UU8A 3M4FA 5K0UC 3AKRA 1O4YA 3AMQA 1FV3A 3IDEA 2DU0A 3ZVXA 4COYA 3U11A 1C1FA 3PVNA 4M0NA 1SFNA 4E27A 2GNMA 3T2TA 3AK0A 1AYN3 1JUIA 5CAZA 1YWKA 1QH7A 4YZ4A 4I0BA 2C5DA 4CEYB 4OI1A 4Q2FA 1BK1A 1KJLA 5JI9A 1CQ9A 4QPIC 5DZFA 1QU0A 4FCAA 1FOD3 5BNNC 3SCHA 4XFCA 4GKXA 3PHMA 1R1A2 1S0FA 1UPSA 2WNUC 4COVA 4NVPA 3VBFB 4U36A 4IEWA 3VZMA 3R05A 1WCSA 1K5MC 3ZYGA 1QJU1 4XF1A 2EXHA 4MUVA 4A3XA 2R073 3NAPB 3I4IA 3ZN5A 4IEPA 1RUF3 3LA2A 4GIQA 1FAYA 3AP6A 4Y1UA 1WBLA 1UIKA 1O4TA 3AYCA 4I3GA 3B69A 3FWEA 4XXAA 1MS5A 1OD5A 4KU7A 3PVOA 3DKWA 1CAXB 5D8AB 1LU1A 4YGCA 5CB7A 4DMIA 4W6XA 4P14A 2JG8A 4CDWB 4BPZA 1OA2A 1EPZA 4TYSA 1H4GA 1OOPA 1XU1A 3L2YA 2QZ3A 2PAKA 1LHWA 2ZPXA 1V6OA 4MGZE 3VL8A 4IERA 3JD72 1FMD3 4M3CE 3THTA 3VKMA 2B9UA 3WW2A 2PN5A 4HFSA 2PAMA 4LR4A 4GALA 4Y1YA 4BM8A 3QACA 1HX6A 2RM23 1S0BA 3CNAA 5CU1A 2B45X 4BIFA 4QPGB 4KWKA 2WQ4A 5KXDA 2W08A 2BYVE 2ZX1A 4BHPA 4HL0A 3WUCA 3MDPA 4LE3A 3TB0A 4XPVA 4EN6B 1AL22 3D4KA 4TLFA 5K0UB 1PO12 1D4M3 5CFDB 4QXKA 1CVNA 4XQ4A 4AEKA 2OIIA 3RG0A 1CD3G 1VP6A 5BNQA 1GSLA 4N7UA 4DFSA 2PQQA 5I0SA 2YHJA 3AZVA 1CN1A 3AP9A 2R1BA 3ST7A 1OQEA 3RS6A 1W6MA 1GZ9A 1PGW2 4GH4C 4Y26A 4AFCA 2WSVA 4K1YA 2WFF1 1X8EA 1UMZA 4QPIB 2MEV1 2JICA 1G8WA 5BNNB 1HRI3 3AZXA 1ZBE1 1X50A 3NL1A 4JRAA 4AVAA 3A0NA 1ZZ8A 2WNUB 3PMSA 4LO6B 3RJ2X 1N1SA 3ZSJA 4YFWA 4G4FA 3WVJA 5JCTA 3OTFA 3URFA 3IWZA 1HQNA 5FQ0B 1K5MB 2WQZC 4QU2A 2ZGUA 2LTNA 3NV3A 2I74A 3ZYPA 3HD8B 1NG0A 4V1PA 2D3SA 1OA3A 4N53A 1T6GC 2LM3A 2XKOA 3OD4A 3W9AA 1VBE2 3AB0A 3BALA 1G9BA 1FNZA 1YJKA 2VUJA 3JU9A 1AR62 3I59B 4MZUA 1LEDA 3VKNA 2ILMA 2ETEA 3ELNA 1TQ5A 2YGLA 5BNOC 5IK8A 2ZJCA 1SQ4A 3TN92 2CGPA 1MS3A