2A68A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic rifabutin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a68A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a68A01
2PA8D 1I6HK 5IYBC 5TMFA 4BBSK 5C3EK 2JA6C 4MQ9A 3CQZC 1R9TC 4A3BC 3GTJK 4A93C 5FLMK 3GTPK 4YG2A 3S1QK 3S15K 4A3CK 2R92K 3PO3K 4A3DC 2E2JC 4C3JK 1TWCK 5M3MK 4C2MK 4Y52C 1I3QC 2BE5A 2WAQD 1HQMA 2JA7C 2R7ZC 2A69A 3FKIK 5IP7K 1WCMK 3H3VL 5C44C 1XPPA 1SFOK 2VUMK 3HOWK 3RZDK 3HKZD 1I6VA 4OIRA 4XLPA 2PMZL 1I50C 1ZYRA 2YU9K 4BBRC 4BY7K 5TMCA 4A3JC 1TWAK 4A3MC 3HOZK 5IYDC 2E2IK 3I4NK 1K83K 4OIOA 4Q4ZA 3GTLK 2A6HA 2WAQL 4QIWD 4LLGA 5IYBK 3S17C 4A3KC 2JA6K 3CQZK 1R9TK 4A3BK 4A3IC 4A93K 3S1NC 4A3GC 4XLNA 3HKZL 4OIPA 1Y1VC 3M3YC 3HOUC 2E2JK 4A3DK 2O5IA 3H0GC 2NVXC 3HOYC 1TWHC 3S2HC 1YNJA 4Y7NC 3PO2C 3RZOC 4A3FC 4Y52K 1I3QK 5C4JC 2R7ZK 4G7HA 4LK0A 2JA7K 4G7ZA 1TWGC 5C44K 2Y0SD 4XSZA 3GTGC 5M5YK 1IW7A 3EQLA 4AYBD 4ZH4A 2PA8L 2NVQC 4YFKA 2WB1D 5IP9C 1I50K 3GTMC 2R93C 4BBRK 4QJVA 4A3JK 3WODA 3GTKC 4A3MK 3DXJA 1SMYA 3GTQC 3S14C 5IYDK 3M4OC 4MEYA 5M5WK 3S17K 5FJ8K 4A3KK 1Y1WC 2Y0SL 5M5XK 3S16C 4A3IK 4LK1A 3S1NK 3S2DC 4A3GK 3S1MC 3K7AC 3I4MC 4C3HC 1Y1VK 3HOUK 3M3YK 3H0GK 4A3EC 2E2HC 2WB1L 2NVXK 4YFNA 3S1RC 2JA8C 1TWHK 4QJVB 3HOYK 3S2HK 4Y7NK 2JA5C 3PO2K 4A3FK 3RZOK 5C4JK 5D4DA 5M3FK 4BXXC 2NVYC 2PPBA 5IYCC 1TWGK 2NVTC 3GTGK 4A3LC 4LJZA 2NVQK 4QIWL 5IP9K 4X6AC 3GTMK 2R93K 5C4XC 3GTKK 3GTQK 4C3IC 3S14K 3GTOC 3M4OK 4Q5SA 3HOVC 1YNNA 2B63C 3HOXC 1Y1WK 2A68A 2O5JA 4KMUA 3S16K 3S2DK 4XSXA 3S1MK 3K7AK 3I4MK 1TWFC 4C3HK 4G7OA 4BY1C 4AYBL 4A3EK 2E2HK 3S1RK 2JA8K 1I6HC 2CW0A 2PMZD 4BBSC 2JA5K 5C3EC 2A6EA 4GZYA 3GTPC 3GTJC 3S1QC 4BXXK 5FLMC 2NVYK 5IYCK 3S15C 2NVTK 4A3CC 2R92C 3PO3C 4C3JC 4OIQA 4A3LK 1TWCC 4NOIA 4C2MC 4X6AK 5C4XK 3FKIC 5IP7C 1WCMC 4KN7A 4YFXA 1BDFA 4KN4A 1SFOC 2VUMC 4C3IK 3HOWC 3GTOK 3RZDC 4OINA 3HOVK 2B63K 4JK1A 3HOXK 2YU9C 4BY7C 1TWAC 4MEXA 3HOZC 1TWFK 2E2IC 3I4NC 1K83C 4BY1K 3H3VD 3GTLC
chains in the Genus database with same CATH superfamily
2PA8D 1WQGA 2RGRA 5C3EK 4MQ9A 4A3BC 3GTJK 3GTPK 4A93C 5FLMK 4XCHA 3PO3K 1C0AA 2GSOA 1VJEA 2BE5A 1XXBA 2R7ZC 3FKIK 2E2IA 1USOA 1WCMK 4WFNS 1XPPA 2VUMK 5IOTA 3RZDK 5CJ9A 1ZYRA 3FOEA 4BBRC 4KDDA 2KWAA 1ZVUA 4A3KC 4A3BK 4A93K 3S1NC 4A3GC 4XLNA 2L3UA 5DM6S 3HOUC 3H0GC 4FM9A 3S2HC 3BP3A 1DCHA 3S0XA 1J6XA 1BGWA 2R7ZK 4G7HA 3LPXA 1WSRA 2ZJRS 1WOOA 4WFAS 4YFKA 1VRQC 4IOCS 2R93C 4BBRK 1Y1VA 4QJVA 3GTKC 1F93A 4C45A 3DXJA 1JOEA 1JQWA 1TWHA 1O24A 2FQOA 3A8JA 4KMDA 5FJ8K 4A3KK 3S1NK 4A3GK 3S2DC 3S1MC 4C3HC 3HOUK 3H0GK 2E2HC 2JA8C 3S2HK 3GTMA 3GTOA 2KQ1A 3VA7A 4BXXC 4GTDA 5EGHA 5JFEA 4A3LC 1EH1A 1TWFA 1INNA 1KQ4A 2R93K 1PJ6A 3GTKK 1JVIA 5L46A 1WOPA 4KC6A 3S2DK 2ZFZA 3S1MK 3CAGA 4C3HK 3FKIA 4IO9S 2XCOA 2E2HK 2ZJPS 2JA8K 2VUMA 2PMZD 3AD9C 2A6EA 3JSTA 4BXXK 1O28A 4A3CC 2R92C 1O27A 4KASA 4GTFA 4A3LK 2RH6A 4KM9A 2ZJQS 1J98A 1DCOA 3HOWC 3LYWA 5HQHA 4OINA 1BS2A 2R7ZA 1TWCA 3GTLC 5IYBC 5TMFA 1SFOA 1XZPA 4A3CK 2R92K 2GAHC 4A3DC 2YU9A 5M3MK 1TWAA 4O2DA 2CFAB 1I3QC 1HQMA 3HOWK 2PHCB 3HKZD 1R9TA 3H0GA 4G0WA 4WJ4A 5JVHS 4LQYA 1AB4A 4OIOA 3GTLK 2GAGC 4QIWD 5IYBK 3AQPA 1DD5A 4AH6A 3HKZL 4A3DK 1WOSA 3GTKA 1XZQB 2NVXC 3TFHA 1L0WA 1I50A 3ERED 4PABA 1O25A 1I3QK 4G7ZA 2Y0SD 3GTGC 1IW7A 1VH2A 2V6UA 2PA8L 2NVQC 2E2HA 3GSIA 2XCRB 1WORA 3S14C 1WQHA 4KMAA 2XCQA 5M5WK 1FEUA 1IS1A 1TWGA 2Y0SL 4LK1A 3K7AC 3I4MC 4WF9S 3OEPA 2NVXK 4YFNA 3S1RC 3Q3QA 2JA5C 3T00A 5D4DA 3GTQA 2NVYC 2PPBA 3GTGK 3NUHA 4P5BA 4DDQA 4IOAS 1Y1WA 2NVQK 4X6AC 5C4XC 4GTBA 3S14K 2R92A 3HOVC 2GSNA 3HOXC 3TFIA 1WQFA 2O5JA 1EI6A 3GDZA 1PJ7A 3K7AK 3I4MK 1EQRA 4BY1C 2D6FC 3S1RK 3T02A 2CW0A 2JA5K 2P8TA 3N3YA 2NVYK 4KATA 1X31C 2GSUA 4OIQA 3OREA 2B63A 4KB4A 3GTLA 4X6AK 5C4XK 5IP7C 3AH5A 3HOVK 3GTJA 3GTPA 1O29A 4JK1A 3HOXK 3L4JA 4BY7C 4BKWA 4GTCA 1BJTA 4U67S 3HOZC 3AD7C 2E2IC 3I4NC 4LR2A 3LAJA 4BY1K 3H3VD 1F7VA 1O2FB 1WCMA 3BUEA 4YG2A 5E68A 4J3NA 2E2JC 3GEIA 1YCLA 1RU0A 3LAPA 4WFBS 4Y52C 2WAQD 1HI9A 5IP7K 1G51A 3GEEA 4KAWX 3H3VL 5C44C 2ZUEA 4G0UA 4BLBA 2PMZL 4BY7K 5TMCA 4A3JC 2EBBA 5JVGS 3HOZK 1XXCA 2E2IK 3I4NK 2A6HA 2WAQL 4LLGA 3G4CA 1Y1VC 2E2JK 2O5IA 3HOYC 1TWHC 1YNJA 4Y7NC 3PO2C 3RZOC 4Y52K 4LK0A 2Y3PA 5C44K 1UV7A 4AYBD 4ZH4A 2WB1D 5IP9C 3GTMC 3PIPS 4A3JK 2KXYA 2JA5A 1SMYA 1ZQ1C 2NVYA 3M4OC 4KB2A 4GFQA 5M5XK 1Y1VK 1VGXA 2WB1L 3HOYK 1TWHK 3HXAA 4QJVB 2R93A 4P5AA 4Y7NK 3PO2K 3RZOK 1IL2A 4PAAA 3PIOS 4LJZA 4GTAA 2JH3A 4QIWL 5IP9K 5HL8A 3GTMK 4C3IC 1J6WA 3TFJA 3M4OK 4Q5SA 3A8IA 1YNNA 3N0CA 3IPJA 4WCES 1ZBSA 5DM7S 1B4BA 2FQTA 4WILA 4XSXA 5IORA 1I6HC 4BLAA 4BBSC 4GZYA 3S1QC 3S15C 5TJ3A 4C3JC 2KPUA 1TWCC 3DLLS 4NOIA 4C2MC 3L4KA 1IBAA 3AQOA 4KN7A 4YFXA 3G4AA 4KN4A 1SFOC 4C3IK 1WSVA 2YU9C 1TWAC 4MEXA 3A8KA 4M1XA 2CFAA 3QX3A 1K83C 4LOWA 5JVOA 1I6HK 4BBSK 5IOSA 1ISEA 2JA6C 3CQZC 1R9TC 3S1QK 3S15K 3CF5S 3AD8C 4C3JK 1TWCK 4C2MK 5EGEA 3MMLB 2JA7C 2A69A 1EK8A 1SFOK 4ILDA 1I6VA 4OIRA 1XZQA 4XLPA 1XZPB 1I50C 2YU9K 4GT9A 1TWAK 5CHPA 4G0VA 4A3MC 5IYDC 1K83K 4Q4ZA 1I3QA 1WIHA 1USMA 3S17C 2JA6K 3CQZK 1R9TK 4A3IC 1XXAA 3GIRA 4OIPA 3M3YC 1IQ0A 2V6TA 4A3FC 3N0BA 1F7UA 5C4JC 2JA7K 1TWGC 4XSZA 5M5YK 3EQLA 1EFWA 2V6SA 1ZXOA 3BP8C 1J6VA 1I50K 4GTEA 3SZZA 3WODA 4A3MK 2NVXA 3ADAC 5IYDK 3GTQC 3SZYA 4MEYA 4GTLA 1B4AA 1PJ5A 3S17K 1Y1WC 3GTGA 3S16C 4A3IK 1DCPA 3M3YK 4KM8A 4A3EC 1YX2A 1O2BA 4A3FK 5C4JK 5IYCC 1TWGK 2NVTC 1VLOA 4RMFA 1O2AA 1GE9A 3GTQK 4WJ3M 3GTOC 1F9NA 3FOFA 2B63C 1Y1WK 2A68A 3S16K 4KMUA 2W7VA 1TWFC 4G7OA 4A3EK 4AYBL 5C3EC 5HL7S 3GTPC 3GTJC 5FLMC 4FZBA 5IYCK 2NVTK 3PO3C 1O26A 1K83A 1V5VA 3T01A 2ZUFA 3FKIC 4KARA 1WCMC 2JA6A 1BDFA 2P5MA 3CQZA 2VUMC 3GTOK 3RZDC 3GEHA 3V4GA 4KMHA 1IE0A 2B63K 3TTGA 4P9SA 3OPFA 5IOQA 3FHZA 1TWFK 2JA7A 2L5NA 5M3FK
chains in the Genus database with same CATH topology
2PA8D 1I6HK 5IYBC 5TMFA 4BBSK 5C3EK 2JA6C 4MQ9A 3CQZC 1R9TC 4A3BC 3GTJK 4A93C 5FLMK 3GTPK 4YG2A 3S1QK 3S15K 4A3CK 2R92K 3PO3K 4A3DC 2E2JC 4C3JK 1TWCK 5M3MK 4C2MK 4Y52C 1I3QC 2BE5A 2WAQD 1HQMA 2JA7C 2R7ZC 2A69A 3FKIK 5IP7K 1WCMK 3H3VL 5C44C 1XPPA 1SFOK 2VUMK 3HOWK 3RZDK 3HKZD 1I6VA 4OIRA 4XLPA 2PMZL 1I50C 1ZYRA 2YU9K 4BBRC 4BY7K 5TMCA 4A3JC 1TWAK 4A3MC 3HOZK 5IYDC 2E2IK 3I4NK 1K83K 4OIOA 4Q4ZA 3GTLK 2A6HA 2WAQL 4QIWD 4LLGA 5IYBK 3S17C 4A3KC 2JA6K 3CQZK 1R9TK 4A3BK 4A3IC 4A93K 3S1NC 4A3GC 4XLNA 3HKZL 4OIPA 1Y1VC 3M3YC 3HOUC 2E2JK 4A3DK 2O5IA 3H0GC 2NVXC 3HOYC 1TWHC 3S2HC 1YNJA 4Y7NC 3PO2C 3RZOC 4A3FC 4Y52K 1I3QK 5C4JC 2R7ZK 4G7HA 4LK0A 2JA7K 4G7ZA 1TWGC 5C44K 2Y0SD 4XSZA 3GTGC 5M5YK 1IW7A 3EQLA 4AYBD 4ZH4A 2PA8L 2NVQC 4YFKA 2WB1D 5IP9C 1I50K 3GTMC 2R93C 4BBRK 4QJVA 4A3JK 3WODA 3GTKC 4A3MK 3DXJA 1SMYA 3GTQC 3S14C 5IYDK 3M4OC 4MEYA 5M5WK 3S17K 5FJ8K 4A3KK 1Y1WC 2Y0SL 5M5XK 3S16C 4A3IK 4LK1A 3S1NK 3S2DC 4A3GK 3S1MC 3K7AC 3I4MC 4C3HC 1Y1VK 3HOUK 3M3YK 3H0GK 4A3EC 2E2HC 2WB1L 2NVXK 4YFNA 3S1RC 2JA8C 1TWHK 4QJVB 3HOYK 3S2HK 4Y7NK 2JA5C 3PO2K 4A3FK 3RZOK 5C4JK 5D4DA 5M3FK 4BXXC 2NVYC 2PPBA 5IYCC 1TWGK 2NVTC 3GTGK 4A3LC 4LJZA 2NVQK 4QIWL 5IP9K 4X6AC 3GTMK 2R93K 5C4XC 3GTKK 3GTQK 4C3IC 3S14K 3GTOC 3M4OK 4Q5SA 3HOVC 1YNNA 2B63C 3HOXC 1Y1WK 2A68A 2O5JA 4KMUA 3S16K 3S2DK 4XSXA 3S1MK 3K7AK 3I4MK 1TWFC 4C3HK 4G7OA 4BY1C 4AYBL 4A3EK 2E2HK 3S1RK 2JA8K 1I6HC 2CW0A 2PMZD 4BBSC 2JA5K 5C3EC 2A6EA 4GZYA 3GTPC 3GTJC 3S1QC 4BXXK 5FLMC 2NVYK 5IYCK 3S15C 2NVTK 4A3CC 2R92C 3PO3C 4C3JC 4OIQA 4A3LK 1TWCC 4NOIA 4C2MC 4X6AK 5C4XK 3FKIC 5IP7C 1WCMC 4KN7A 4YFXA 1BDFA 4KN4A 1SFOC 2VUMC 4C3IK 3HOWC 3GTOK 3RZDC 4OINA 3HOVK 2B63K 4JK1A 3HOXK 2YU9C 4BY7C 1TWAC 4MEXA 3HOZC 1TWFK 2E2IC 3I4NC 1K83C 4BY1K 3H3VD 3GTLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PA8 D;  1I6H K;  5IYB C;  5TMF A;  4BBS K;  5C3E K;  2JA6 C;  4MQ9 A;  3CQZ C;  1R9T C;  4A3B C;  3GTJ K;  4A93 C;  5FLM K;  3GTP K;  4YG2 A;  3S1Q K;  3S15 K;  4A3C K;  2R92 K;  3PO3 K;  4A3D C;  2E2J C;  4C3J K;  1TWC K;  5M3M K;  4C2M K;  4Y52 C;  1I3Q C;  2BE5 A;  2WAQ D;  1HQM A;  2JA7 C;  2R7Z C;  2A69 A;  3FKI K;  5IP7 K;  1WCM K;  3H3V L;  5C44 C;  1XPP A;  1SFO K;  2VUM K;  3HOW K;  3RZD K;  3HKZ D;  1I6V A;  4OIR A;  4XLP A;  2PMZ L;  1I50 C;  1ZYR A;  2YU9 K;  4BBR C;  4BY7 K;  5TMC A;  4A3J C;  1TWA K;  4A3M C;  3HOZ K;  5IYD C;  2E2I K;  3I4N K;  1K83 K;  4OIO A;  4Q4Z A;  3GTL K;  2A6H A;  2WAQ L;  4QIW D;  4LLG A;  5IYB K;  3S17 C;  4A3K C;  2JA6 K;  3CQZ K;  1R9T K;  4A3B K;  4A3I C;  4A93 K;  3S1N C;  4A3G C;  4XLN A;  3HKZ L;  4OIP A;  1Y1V C;  3M3Y C;  3HOU C;  2E2J K;  4A3D K;  2O5I A;  3H0G C;  2NVX C;  3HOY C;  1TWH C;  3S2H C;  1YNJ A;  4Y7N C;  3PO2 C;  3RZO C;  4A3F C;  4Y52 K;  1I3Q K;  5C4J C;  2R7Z K;  4G7H A;  4LK0 A;  2JA7 K;  4G7Z A;  1TWG C;  5C44 K;  2Y0S D;  4XSZ A;  3GTG C;  5M5Y K;  1IW7 A;  3EQL A;  4AYB D;  4ZH4 A;  2PA8 L;  2NVQ C;  4YFK A;  2WB1 D;  5IP9 C;  1I50 K;  3GTM C;  2R93 C;  4BBR K;  4QJV A;  4A3J K;  3WOD A;  3GTK C;  4A3M K;  3DXJ A;  1SMY A;  3GTQ C;  3S14 C;  5IYD K;  3M4O C;  4MEY A;  5M5W K;  3S17 K;  5FJ8 K;  4A3K K;  1Y1W C;  2Y0S L;  5M5X K;  3S16 C;  4A3I K;  4LK1 A;  3S1N K;  3S2D C;  4A3G K;  3S1M C;  3K7A C;  3I4M C;  4C3H C;  1Y1V K;  3HOU K;  3M3Y K;  3H0G K;  4A3E C;  2E2H C;  2WB1 L;  2NVX K;  4YFN A;  3S1R C;  2JA8 C;  1TWH K;  4QJV B;  3HOY K;  3S2H K;  4Y7N K;  2JA5 C;  3PO2 K;  4A3F K;  3RZO K;  5C4J K;  5D4D A;  5M3F K;  4BXX C;  2NVY C;  2PPB A;  5IYC C;  1TWG K;  2NVT C;  3GTG K;  4A3L C;  4LJZ A;  2NVQ K;  4QIW L;  5IP9 K;  4X6A C;  3GTM K;  2R93 K;  5C4X C;  3GTK K;  3GTQ K;  4C3I C;  3S14 K;  3GTO C;  3M4O K;  4Q5S A;  3HOV C;  1YNN A;  2B63 C;  3HOX C;  1Y1W K;  2A68 A;  2O5J A;  4KMU A;  3S16 K;  3S2D K;  4XSX A;  3S1M K;  3K7A K;  3I4M K;  1TWF C;  4C3H K;  4G7O A;  4BY1 C;  4AYB L;  4A3E K;  2E2H K;  3S1R K;  2JA8 K;  1I6H C;  2CW0 A;  2PMZ D;  4BBS C;  2JA5 K;  5C3E C;  2A6E A;  4GZY A;  3GTP C;  3GTJ C;  3S1Q C;  4BXX K;  5FLM C;  2NVY K;  5IYC K;  3S15 C;  2NVT K;  4A3C C;  2R92 C;  3PO3 C;  4C3J C;  4OIQ A;  4A3L K;  1TWC C;  4NOI A;  4C2M C;  4X6A K;  5C4X K;  3FKI C;  5IP7 C;  1WCM C;  4KN7 A;  4YFX A;  1BDF A;  4KN4 A;  1SFO C;  2VUM C;  4C3I K;  3HOW C;  3GTO K;  3RZD C;  4OIN A;  3HOV K;  2B63 K;  4JK1 A;  3HOX K;  2YU9 C;  4BY7 C;  1TWA C;  4MEX A;  3HOZ C;  1TWF K;  2E2I C;  3I4N C;  1K83 C;  4BY1 K;  3H3V D;  3GTL C; 
#chains in the Genus database with same CATH topology
 2PA8 D;  1WQG A;  2RGR A;  5C3E K;  4MQ9 A;  4A3B C;  3GTJ K;  3GTP K;  4A93 C;  5FLM K;  4XCH A;  3PO3 K;  1C0A A;  2GSO A;  1VJE A;  2BE5 A;  1XXB A;  2R7Z C;  3FKI K;  2E2I A;  1USO A;  1WCM K;  4WFN S;  1XPP A;  2VUM K;  5IOT A;  3RZD K;  5CJ9 A;  1ZYR A;  3FOE A;  4BBR C;  4KDD A;  2KWA A;  1ZVU A;  4A3K C;  4A3B K;  4A93 K;  3S1N C;  4A3G C;  4XLN A;  2L3U A;  5DM6 S;  3HOU C;  3H0G C;  4FM9 A;  3S2H C;  3BP3 A;  1DCH A;  3S0X A;  1J6X A;  1BGW A;  2R7Z K;  4G7H A;  3LPX A;  1WSR A;  2ZJR S;  1WOO A;  4WFA S;  4YFK A;  1VRQ C;  4IOC S;  2R93 C;  4BBR K;  1Y1V A;  4QJV A;  3GTK C;  1F93 A;  4C45 A;  3DXJ A;  1JOE A;  1JQW A;  1TWH A;  1O24 A;  2FQO A;  3A8J A;  4KMD A;  5FJ8 K;  4A3K K;  3S1N K;  4A3G K;  3S2D C;  3S1M C;  4C3H C;  3HOU K;  3H0G K;  2E2H C;  2JA8 C;  3S2H K;  3GTM A;  3GTO A;  2KQ1 A;  3VA7 A;  4BXX C;  4GTD A;  5EGH A;  5JFE A;  4A3L C;  1EH1 A;  1TWF A;  1INN A;  1KQ4 A;  2R93 K;  1PJ6 A;  3GTK K;  1JVI A;  5L46 A;  1WOP A;  4KC6 A;  3S2D K;  2ZFZ A;  3S1M K;  3CAG A;  4C3H K;  3FKI A;  4IO9 S;  2XCO A;  2E2H K;  2ZJP S;  2JA8 K;  2VUM A;  2PMZ D;  3AD9 C;  2A6E A;  3JST A;  4BXX K;  1O28 A;  4A3C C;  2R92 C;  1O27 A;  4KAS A;  4GTF A;  4A3L K;  2RH6 A;  4KM9 A;  2ZJQ S;  1J98 A;  1DCO A;  3HOW C;  3LYW A;  5HQH A;  4OIN A;  1BS2 A;  2R7Z A;  1TWC A;  3GTL C;  5IYB C;  5TMF A;  1SFO A;  1XZP A;  4A3C K;  2R92 K;  2GAH C;  4A3D C;  2YU9 A;  5M3M K;  1TWA A;  4O2D A;  2CFA B;  1I3Q C;  1HQM A;  3HOW K;  2PHC B;  3HKZ D;  1R9T A;  3H0G A;  4G0W A;  4WJ4 A;  5JVH S;  4LQY A;  1AB4 A;  4OIO A;  3GTL K;  2GAG C;  4QIW D;  5IYB K;  3AQP A;  1DD5 A;  4AH6 A;  3HKZ L;  4A3D K;  1WOS A;  3GTK A;  1XZQ B;  2NVX C;  3TFH A;  1L0W A;  1I50 A;  3ERE D;  4PAB A;  1O25 A;  1I3Q K;  4G7Z A;  2Y0S D;  3GTG C;  1IW7 A;  1VH2 A;  2V6U A;  2PA8 L;  2NVQ C;  2E2H A;  3GSI A;  2XCR B;  1WOR A;  3S14 C;  1WQH A;  4KMA A;  2XCQ A;  5M5W K;  1FEU A;  1IS1 A;  1TWG A;  2Y0S L;  4LK1 A;  3K7A C;  3I4M C;  4WF9 S;  3OEP A;  2NVX K;  4YFN A;  3S1R C;  3Q3Q A;  2JA5 C;  3T00 A;  5D4D A;  3GTQ A;  2NVY C;  2PPB A;  3GTG K;  3NUH A;  4P5B A;  4DDQ A;  4IOA S;  1Y1W A;  2NVQ K;  4X6A C;  5C4X C;  4GTB A;  3S14 K;  2R92 A;  3HOV C;  2GSN A;  3HOX C;  3TFI A;  1WQF A;  2O5J A;  1EI6 A;  3GDZ A;  1PJ7 A;  3K7A K;  3I4M K;  1EQR A;  4BY1 C;  2D6F C;  3S1R K;  3T02 A;  2CW0 A;  2JA5 K;  2P8T A;  3N3Y A;  2NVY K;  4KAT A;  1X31 C;  2GSU A;  4OIQ A;  3ORE A;  2B63 A;  4KB4 A;  3GTL A;  4X6A K;  5C4X K;  5IP7 C;  3AH5 A;  3HOV K;  3GTJ A;  3GTP A;  1O29 A;  4JK1 A;  3HOX K;  3L4J A;  4BY7 C;  4BKW A;  4GTC A;  1BJT A;  4U67 S;  3HOZ C;  3AD7 C;  2E2I C;  3I4N C;  4LR2 A;  3LAJ A;  4BY1 K;  3H3V D;  1F7V A;  1O2F B;  1WCM A;  3BUE A;  4YG2 A;  5E68 A;  4J3N A;  2E2J C;  3GEI A;  1YCL A;  1RU0 A;  3LAP A;  4WFB S;  4Y52 C;  2WAQ D;  1HI9 A;  5IP7 K;  1G51 A;  3GEE A;  4KAW X;  3H3V L;  5C44 C;  2ZUE A;  4G0U A;  4BLB A;  2PMZ L;  4BY7 K;  5TMC A;  4A3J C;  2EBB A;  5JVG S;  3HOZ K;  1XXC A;  2E2I K;  3I4N K;  2A6H A;  2WAQ L;  4LLG A;  3G4C A;  1Y1V C;  2E2J K;  2O5I A;  3HOY C;  1TWH C;  1YNJ A;  4Y7N C;  3PO2 C;  3RZO C;  4Y52 K;  4LK0 A;  2Y3P A;  5C44 K;  1UV7 A;  4AYB D;  4ZH4 A;  2WB1 D;  5IP9 C;  3GTM C;  3PIP S;  4A3J K;  2KXY A;  2JA5 A;  1SMY A;  1ZQ1 C;  2NVY A;  3M4O C;  4KB2 A;  4GFQ A;  5M5X K;  1Y1V K;  1VGX A;  2WB1 L;  3HOY K;  1TWH K;  3HXA A;  4QJV B;  2R93 A;  4P5A A;  4Y7N K;  3PO2 K;  3RZO K;  1IL2 A;  4PAA A;  3PIO S;  4LJZ A;  4GTA A;  2JH3 A;  4QIW L;  5IP9 K;  5HL8 A;  3GTM K;  4C3I C;  1J6W A;  3TFJ A;  3M4O K;  4Q5S A;  3A8I A;  1YNN A;  3N0C A;  3IPJ A;  4WCE S;  1ZBS A;  5DM7 S;  1B4B A;  2FQT A;  4WIL A;  4XSX A;  5IOR A;  1I6H C;  4BLA A;  4BBS C;  4GZY A;  3S1Q C;  3S15 C;  5TJ3 A;  4C3J C;  2KPU A;  1TWC C;  3DLL S;  4NOI A;  4C2M C;  3L4K A;  1IBA A;  3AQO A;  4KN7 A;  4YFX A;  3G4A A;  4KN4 A;  1SFO C;  4C3I K;  1WSV A;  2YU9 C;  1TWA C;  4MEX A;  3A8K A;  4M1X A;  2CFA A;  3QX3 A;  1K83 C;  4LOW A;  5JVO A;  1I6H K;  4BBS K;  5IOS A;  1ISE A;  2JA6 C;  3CQZ C;  1R9T C;  3S1Q K;  3S15 K;  3CF5 S;  3AD8 C;  4C3J K;  1TWC K;  4C2M K;  5EGE A;  3MML B;  2JA7 C;  2A69 A;  1EK8 A;  1SFO K;  4ILD A;  1I6V A;  4OIR A;  1XZQ A;  4XLP A;  1XZP B;  1I50 C;  2YU9 K;  4GT9 A;  1TWA K;  5CHP A;  4G0V A;  4A3M C;  5IYD C;  1K83 K;  4Q4Z A;  1I3Q A;  1WIH A;  1USM A;  3S17 C;  2JA6 K;  3CQZ K;  1R9T K;  4A3I C;  1XXA A;  3GIR A;  4OIP A;  3M3Y C;  1IQ0 A;  2V6T A;  4A3F C;  3N0B A;  1F7U A;  5C4J C;  2JA7 K;  1TWG C;  4XSZ A;  5M5Y K;  3EQL A;  1EFW A;  2V6S A;  1ZXO A;  3BP8 C;  1J6V A;  1I50 K;  4GTE A;  3SZZ A;  3WOD A;  4A3M K;  2NVX A;  3ADA C;  5IYD K;  3GTQ C;  3SZY A;  4MEY A;  4GTL A;  1B4A A;  1PJ5 A;  3S17 K;  1Y1W C;  3GTG A;  3S16 C;  4A3I K;  1DCP A;  3M3Y K;  4KM8 A;  4A3E C;  1YX2 A;  1O2B A;  4A3F K;  5C4J K;  5IYC C;  1TWG K;  2NVT C;  1VLO A;  4RMF A;  1O2A A;  1GE9 A;  3GTQ K;  4WJ3 M;  3GTO C;  1F9N A;  3FOF A;  2B63 C;  1Y1W K;  2A68 A;  3S16 K;  4KMU A;  2W7V A;  1TWF C;  4G7O A;  4A3E K;  4AYB L;  5C3E C;  5HL7 S;  3GTP C;  3GTJ C;  5FLM C;  4FZB A;  5IYC K;  2NVT K;  3PO3 C;  1O26 A;  1K83 A;  1V5V A;  3T01 A;  2ZUF A;  3FKI C;  4KAR A;  1WCM C;  2JA6 A;  1BDF A;  2P5M A;  3CQZ A;  2VUM C;  3GTO K;  3RZD C;  3GEH A;  3V4G A;  4KMH A;  1IE0 A;  2B63 K;  3TTG A;  4P9S A;  3OPF A;  5IOQ A;  3FHZ A;  1TWF K;  2JA7 A;  2L5N A;  5M3F K; 
#chains in the Genus database with same CATH homology
 2PA8 D;  1I6H K;  5IYB C;  5TMF A;  4BBS K;  5C3E K;  2JA6 C;  4MQ9 A;  3CQZ C;  1R9T C;  4A3B C;  3GTJ K;  4A93 C;  5FLM K;  3GTP K;  4YG2 A;  3S1Q K;  3S15 K;  4A3C K;  2R92 K;  3PO3 K;  4A3D C;  2E2J C;  4C3J K;  1TWC K;  5M3M K;  4C2M K;  4Y52 C;  1I3Q C;  2BE5 A;  2WAQ D;  1HQM A;  2JA7 C;  2R7Z C;  2A69 A;  3FKI K;  5IP7 K;  1WCM K;  3H3V L;  5C44 C;  1XPP A;  1SFO K;  2VUM K;  3HOW K;  3RZD K;  3HKZ D;  1I6V A;  4OIR A;  4XLP A;  2PMZ L;  1I50 C;  1ZYR A;  2YU9 K;  4BBR C;  4BY7 K;  5TMC A;  4A3J C;  1TWA K;  4A3M C;  3HOZ K;  5IYD C;  2E2I K;  3I4N K;  1K83 K;  4OIO A;  4Q4Z A;  3GTL K;  2A6H A;  2WAQ L;  4QIW D;  4LLG A;  5IYB K;  3S17 C;  4A3K C;  2JA6 K;  3CQZ K;  1R9T K;  4A3B K;  4A3I C;  4A93 K;  3S1N C;  4A3G C;  4XLN A;  3HKZ L;  4OIP A;  1Y1V C;  3M3Y C;  3HOU C;  2E2J K;  4A3D K;  2O5I A;  3H0G C;  2NVX C;  3HOY C;  1TWH C;  3S2H C;  1YNJ A;  4Y7N C;  3PO2 C;  3RZO C;  4A3F C;  4Y52 K;  1I3Q K;  5C4J C;  2R7Z K;  4G7H A;  4LK0 A;  2JA7 K;  4G7Z A;  1TWG C;  5C44 K;  2Y0S D;  4XSZ A;  3GTG C;  5M5Y K;  1IW7 A;  3EQL A;  4AYB D;  4ZH4 A;  2PA8 L;  2NVQ C;  4YFK A;  2WB1 D;  5IP9 C;  1I50 K;  3GTM C;  2R93 C;  4BBR K;  4QJV A;  4A3J K;  3WOD A;  3GTK C;  4A3M K;  3DXJ A;  1SMY A;  3GTQ C;  3S14 C;  5IYD K;  3M4O C;  4MEY A;  5M5W K;  3S17 K;  5FJ8 K;  4A3K K;  1Y1W C;  2Y0S L;  5M5X K;  3S16 C;  4A3I K;  4LK1 A;  3S1N K;  3S2D C;  4A3G K;  3S1M C;  3K7A C;  3I4M C;  4C3H C;  1Y1V K;  3HOU K;  3M3Y K;  3H0G K;  4A3E C;  2E2H C;  2WB1 L;  2NVX K;  4YFN A;  3S1R C;  2JA8 C;  1TWH K;  4QJV B;  3HOY K;  3S2H K;  4Y7N K;  2JA5 C;  3PO2 K;  4A3F K;  3RZO K;  5C4J K;  5D4D A;  5M3F K;  4BXX C;  2NVY C;  2PPB A;  5IYC C;  1TWG K;  2NVT C;  3GTG K;  4A3L C;  4LJZ A;  2NVQ K;  4QIW L;  5IP9 K;  4X6A C;  3GTM K;  2R93 K;  5C4X C;  3GTK K;  3GTQ K;  4C3I C;  3S14 K;  3GTO C;  3M4O K;  4Q5S A;  3HOV C;  1YNN A;  2B63 C;  3HOX C;  1Y1W K;  2A68 A;  2O5J A;  4KMU A;  3S16 K;  3S2D K;  4XSX A;  3S1M K;  3K7A K;  3I4M K;  1TWF C;  4C3H K;  4G7O A;  4BY1 C;  4AYB L;  4A3E K;  2E2H K;  3S1R K;  2JA8 K;  1I6H C;  2CW0 A;  2PMZ D;  4BBS C;  2JA5 K;  5C3E C;  2A6E A;  4GZY A;  3GTP C;  3GTJ C;  3S1Q C;  4BXX K;  5FLM C;  2NVY K;  5IYC K;  3S15 C;  2NVT K;  4A3C C;  2R92 C;  3PO3 C;  4C3J C;  4OIQ A;  4A3L K;  1TWC C;  4NOI A;  4C2M C;  4X6A K;  5C4X K;  3FKI C;  5IP7 C;  1WCM C;  4KN7 A;  4YFX A;  1BDF A;  4KN4 A;  1SFO C;  2VUM C;  4C3I K;  3HOW C;  3GTO K;  3RZD C;  4OIN A;  3HOV K;  2B63 K;  4JK1 A;  3HOX K;  2YU9 C;  4BY7 C;  1TWA C;  4MEX A;  3HOZ C;  1TWF K;  2E2I C;  3I4N C;  1K83 C;  4BY1 K;  3H3V D;  3GTL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...