2A68A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic rifabutin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a68A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a68A01
5C3EC 2R7ZC 1IW7A 5TMFA 1Y1WK 4OIRA 3RZOK 4LK0A 1Y1WC 3RZOC 2A6EA 4X6AK 4G7HA 1TWCK 5D4DA 5FJ8K 4A3IK 4A3LK 4X6AC 3S15K 1TWCC 4XSZA 4A3IC 4A3LC 2PPBA 3S15C 5IP7K 4LK1A 3H0GK 2A6HA 4LLGA 4KMUA 4YFKA 5IP7C 1TWFK 2Y0SD 3H0GC 4KN7A 3I4NK 4BBSK 1TWFC 3I4NC 3HKZD 4BBSC 2WAQD 2YU9K 4A3BK 4OIPA 2R92K 4NOIA 2YU9C 3PO2C 5C44K 2R92C 3M3YK 4A3MC 1SMYA 4OIOA 5C44C 4A3EK 1SFOK 4C3JC 3M3YC 5M3FK 2JA6K 4A93K 1YNJA 4A3EC 1SFOC 2A68A 2PMZD 3S2DC 2O5JA 4A93C 4A3KK 3GTJK 4MEXA 5IYBK 4A3KC 2PA8L 2B63K 2CW0A 3GTJC 3S1RK 5IYBC 5IYCK 3GTOK 3S17K 2B63C 2R93K 1XPPA 4AYBD 5IYCC 3GTOC 2NVXK 3S17C 3S1NK 2R93C 3CQZK 5C4JK 2NVXC 1I6HK 4YFXA 3CQZC 5C4JC 3I4MK 1R9TK 4BXXK 3S14K 4C3HK 4Q4ZA 3I4MC 1R9TC 4BXXC 4QJVA 4C3HC 1I3QK 3GTMK 2R7ZK 1I3QC 3GTMC 1I50K 4QIWD 4C3IK 4JK1A 4YG2A 3HOXK 3PO3K 4G7OA 4C3IC 3GTGK 1I50C 3PO3C 2NVTK 3HOXC 3GTGC 3DXJA 3EQLA 2NVTC 4A3BC 4BY1K 5TMCA 5C4XK 4BY1C 4MEYA 4Q5SA 5C4XC 3M4OK 2JA6C 4Y52K 3M4OC 1Y1VK 3RZDK 3S16K 4Y52C 1Y1VC 5M3MK 3RZDC 3S16C 1ZYRA 2JA8K 5IP9K 1I6VA 2WB1D 3HOYK 4QJVB 5IP9C 4YFNA 5M5YK 3S1RC 4BBRK 4A3CK 3S1QK 3HOYC 3WODA 4A3CC 4XSXA 2Y0SL 4BBRC 3S1NC 4BY7K 1BDFA 1I6HC 3HKZL 4BY7C 2WAQL 2E2IK 1K83K 2NVYK 3HOWK 2E2IC 3S14C 1K83C 2NVQK 2NVYC 3HOWC 1TWAK 3HOVK 3HOVC 4A3GK 1TWAC 4G7ZA 3GTKK 4OIQA 4A3GC 3GTKC 2PMZL 3HOZK 4XLNA 3HOZC 4GZYA 4LJZA 2BE5A 4AYBL 4A3FK 2JA5K 2O5IA 4A3FC 2JA5C 2E2JK 4A3DK 4KN4A 2E2JC 4A3DC 2VUMK 3HOUK 1TWHK 2JA8C 2PA8D 4XLPA 2VUMC 3H3VD 4ZH4A 3HOUC 1TWHC 1TWGK 3S1QC 2A69A 5FLMK 4QIWL 1TWGC 4A3JK 5FLMC 2JA7K 5M5XK 4A3JC 3FKIK 2JA7C 3S2HK 3FKIC 4C2MK 4Y7NK 3GTQK 3PO2K 1WCMK 4OINA 3S2HC 4C2MC 4Y7NC 3GTQC 4MQ9A 3K7AK 4A3MK 1WCMC 2NVQC 4C3JK 3GTPK 2WB1L 3K7AC 5IYDK 3S2DK 1YNNA 3GTPC 5IYDC 1HQMA 3S1MK 3GTLK 2E2HK 5M5WK 3S1MC 5C3EK 3GTLC 2E2HC 3H3VL
chains in the Genus database with same CATH superfamily
3GSIA 1IW7A 3GTOA 3AD7C 2KWAA 4LOWA 2ZUFA 4OIRA 3L4KA 1TWCK 5D4DA 3DLLS 1J6VA 4KATA 1TWCC 5IOQA 1R9TA 2E2IA 4LK1A 3H0GK 1TWFK 4KB4A 3H0GC 4WF9S 4KN7A 1TWFC 2R92K 1WQFA 4WFBS 1WOSA 5CJ9A 2R92C 4IOCS 4A3MC 2JA6K 4A3EK 1SFOK 4PAAA 4A3EC 1SFOC 2A68A 2O5JA 5TJ3A 4KDDA 4GFQA 2RGRA 2B63K 3S1RK 4KMAA 3S17K 2B63C 2R93K 1XPPA 2NVXK 3S1NK 3S17C 2R93C 3CQZK 2NVXC 1F7UA 4YFXA 3CQZC 5JVGS 1O2FB 3I4MK 1PJ5A 3I4MC 4QJVA 1USMA 1DCPA 3GTQA 5L46A 3PO3K 3PO3C 1VLOA 1O2BA 3DXJA 4A3BC 5C4XK 1YX2A 2ZUEA 5C4XC 2JA5A 1WIHA 1Y1VK 3LAJA 5M3MK 1Y1VC 2JA8K 1PJ6A 4A3CK 4YFNA 1C0AA 5IOSA 3L4JA 4A3CC 4WJ3M 3FKIA 3S14C 1XZPA 3HOVK 1TWAK 2V6SA 3HOVC 4A3GK 1TWAC 1XXBA 4A3GC 1XZQB 3ERED 4GZYA 3IPJA 2O5IA 2L5NA 4DDQA 1Y1WA 1ZXOA 3T01A 4XLPA 1DCOA 1TWGK 5FLMK 1TWGC 5FLMC 2JA7K 1EI6A 5M5XK 2ZJQS 2JA7C 3G4AA 4PABA 3PO2K 1WCMK 1JQWA 1WCMC 1ZVUA 1EFWA 1DD5A 2WB1L 1YNNA 1FEUA 1O2AA 3S1MK 4P5AA 2E2HK 3S1MC 3GTJA 2E2HC 3QX3A 4FM9A 5TMFA 3GEHA 3OREA 3AD8C 5FJ8K 4A3IK 1IL2A 1F93A 3ADAC 4XSZA 4A3IC 2A6HA 4LLGA 4KMUA 4YFKA 3AH5A 1I50A 4GTAA 3PIPS 2YU9K 3A8KA 4OIPA 4IO9S 2YU9C 2EBBA 3Q3QA 4BLAA 4C3JC 2GSUA 1J6WA 4FZBA 3AQOA 3AQPA 3GTOK 3NUHA 4AYBD 3GTOC 1USOA 2CFAA 1I6HK 3PIOS 1ZBSA 1WSVA 3BP3A 1R9TK 3T02A 1R9TC 4RMFA 1WORA 3GTMK 1O24A 3GTMC 4AH6A 4JK1A 4G7OA 3GTGK 3N3YA 3OPFA 3GTGC 3EQLA 3GTLA 5TMCA 1YCLA 2L3UA 4Q5SA 3M4OK 2JA6C 4Y52K 3M4OC 1WSRA 3S16K 1IE0A 2Y3PA 3VA7A 4Y52C 3S16C 1JOEA 2VUMA 3S1QK 1TWCA 4QJVB 5IORA 5M5YK 3S1RC 1F7VA 2XCOA 3S1NC 3H0GA 2V6TA 4G0VA 1O25A 2JH3A 3CAGA 5DM7S 3HOWK 1VJEA 2NVQK 3HOWC 5HL8A 1GE9A 3HXAA 1AB4A 3A8JA 3GTPA 4WILA 4XLNA 2R7ZA 2BE5A 3S0XA 4AYBL 2JA5K 3BP8C 2JA5C 4GT9A 4A3DK 4KN4A 2GSOA 4A3DC 4GTFA 3HOUK 1BGWA 2PHCB 1XZPB 2JA8C 2PA8D 4M1XA 3HOUC 3SZZA 4ZH4A 2GAHC 4GTLA 3GEEA 2GAGC 3FKIK 3S2HK 3FKIC 4Y7NK 3S2HC 4Y7NC 3K7AK 3K7AC 3S2DK 1BJTA 1HQMA 5C3EK 3H3VL 3GIRA 5C3EC 3SZYA 3TFIA 1X31C 1Y1WK 4KAWX 4G0UA 4LK0A 1Y1WC 2A6EA 3S15K 4IOAS 3S15C 2FQOA 4WFAS 1I3QA 1TWAA 2Y0SD 3I4NK 3G4CA 3I4NC 5IOTA 4BKWA 4NOIA 3PO2C 3N0CA 3M3YK 4GTEA 3M3YC 5M3FK 4WFNS 3GTJK 5IYBK 1VRQC 2PA8L 4KARA 3GTJC 1WOOA 5IYBC 4J3NA 5IYCK 2ZJPS 5IYCC 5HQHA 5C4JK 5C4JC 4BXXK 4C3HK 4KMHA 1WQGA 4BXXC 1K83A 2NVYA 4C3HC 4C45A 4C3IK 1I50K 4YG2A 3GTKA 4C3IC 1I50C 5JFEA 4G0WA 4GTDA 1EH1A 2FQTA 3BUEA 1EQRA 1HI9A 3CF5S 2CFAB 3LYWA 1RU0A 2D6FC 1ZYRA 1I6VA 4WCES 1O29A 1TWHA 4BBRK 3FHZA 4XSXA 2Y0SL 4BBRC 1I6HC 2E2IK 1BS2A 2P8TA 2E2IC 3A8IA 1KQ4A 4O2DA 3TFJA 2KQ1A 3HOZK 3HOZC 1XXAA 1IBAA 1J6XA 3OEPA 4KM9A 1ISEA 3GDZA 2XCQA 1O28A 2VUMK 2VUMC 3H3VD 3S1QC 3GTMA 1TWFA 4LR2A 1IS1A 3GTQK 3GTGA 3GTQC 4MQ9A 4A3MK 2R92A 2NVQC 3GTPK 3MMLB 3T00A 5IYDK 3AD9C 3GTPC 2JA6A 5IYDC 2XCRB 1SFOA 5M5WK 2R7ZK 2R7ZC 4KASA 2B63A 2R93A 3RZOK 2KPUA 2NVXA 2V6UA 1B4BA 3CQZA 4WJ4A 3RZOC 4X6AK 4G7HA 1O27A 1J98A 1L0WA 4X6AC 1EK8A 1UV7A 4A3LK 4A3LC 2PPBA 1IQ0A 5IP7K 1ZQ1C 5IP7C 4BBSK 3HKZD 4BBSC 2WAQD 4A3BK 4P9SA 5C44K 1SMYA 4OIOA 5C44C 2KXYA 4A93K 1YNJA 3S2DC 2PMZD 5EGHA 4A3KK 4A93C 1Y1VA 4MEXA 3N0BA 4A3KC 2CW0A 5EGEA 1V5VA 5HL7S 1WQHA 1G51A 3S14K 4GTBA 3GEIA 4Q4ZA 1I3QK 1I3QC 4QIWD 3HOXK 1B4AA 2RH6A 2NVTK 3HOXC 1XXCA 2NVTC 4BY1K 4U67S 4BY1C 4MEYA 3RZDK 4BLBA 1XZQA 2P5MA 3RZDC 5IP9K 3JSTA 1F9NA 5E68A 2WB1D 3HOYK 5IP9C 4KC6A 3HOYC 3WODA 5DM6S 1VGXA 1TWGA 4KMDA 4BY7K 5JVOA 1BDFA 3HKZL 4BY7C 1JVIA 2WAQL 2JA7A 1K83K 3FOFA 1PJ7A 2NVYK 1K83C 2NVYC 2W7VA 1WOPA 1WCMA 3GTKK 4G7ZA 2ZFZA 4OIQA 3GTKC 2PMZL 2ZJRS 3TTGA 5CHPA 4LJZA 2E2HA 2GSNA 4XCHA 4A3FK 1O26A 1VH2A 4A3FC 2E2JK 2E2JC 1DCHA 1TWHK 1TWHC 2A69A 5JVHS 4QIWL 4A3JK 3LPXA 4P5BA 1INNA 3FOEA 4A3JC 4KM8A 3V4GA 4C2MK 4OINA 4LQYA 4C2MC 3LAPA 2YU9A 4KB2A 4C3JK 4ILDA 3GTLK 3TFHA 3GTLC 4GTCA
chains in the Genus database with same CATH topology
5C3EC 2R7ZC 1IW7A 5TMFA 1Y1WK 4OIRA 3RZOK 4LK0A 1Y1WC 3RZOC 2A6EA 4X6AK 4G7HA 1TWCK 5D4DA 5FJ8K 4A3IK 4A3LK 4X6AC 3S15K 1TWCC 4XSZA 4A3IC 4A3LC 2PPBA 3S15C 5IP7K 4LK1A 3H0GK 2A6HA 4LLGA 4KMUA 4YFKA 5IP7C 1TWFK 2Y0SD 3H0GC 4KN7A 3I4NK 4BBSK 1TWFC 3I4NC 3HKZD 4BBSC 2WAQD 2YU9K 4A3BK 4OIPA 2R92K 4NOIA 2YU9C 3PO2C 5C44K 2R92C 3M3YK 4A3MC 1SMYA 4OIOA 5C44C 4A3EK 1SFOK 4C3JC 3M3YC 5M3FK 2JA6K 4A93K 1YNJA 4A3EC 1SFOC 2A68A 2PMZD 3S2DC 2O5JA 4A93C 4A3KK 3GTJK 4MEXA 5IYBK 4A3KC 2PA8L 2B63K 2CW0A 3GTJC 3S1RK 5IYBC 5IYCK 3GTOK 3S17K 2B63C 2R93K 1XPPA 4AYBD 5IYCC 3GTOC 2NVXK 3S17C 3S1NK 2R93C 3CQZK 5C4JK 2NVXC 1I6HK 4YFXA 3CQZC 5C4JC 3I4MK 1R9TK 4BXXK 3S14K 4C3HK 4Q4ZA 3I4MC 1R9TC 4BXXC 4QJVA 4C3HC 1I3QK 3GTMK 2R7ZK 1I3QC 3GTMC 1I50K 4QIWD 4C3IK 4JK1A 4YG2A 3HOXK 3PO3K 4G7OA 4C3IC 3GTGK 1I50C 3PO3C 2NVTK 3HOXC 3GTGC 3DXJA 3EQLA 2NVTC 4A3BC 4BY1K 5TMCA 5C4XK 4BY1C 4MEYA 4Q5SA 5C4XC 3M4OK 2JA6C 4Y52K 3M4OC 1Y1VK 3RZDK 3S16K 4Y52C 1Y1VC 5M3MK 3RZDC 3S16C 1ZYRA 2JA8K 5IP9K 1I6VA 2WB1D 3HOYK 4QJVB 5IP9C 4YFNA 5M5YK 3S1RC 4BBRK 4A3CK 3S1QK 3HOYC 3WODA 4A3CC 4XSXA 2Y0SL 4BBRC 3S1NC 4BY7K 1BDFA 1I6HC 3HKZL 4BY7C 2WAQL 2E2IK 1K83K 2NVYK 3HOWK 2E2IC 3S14C 1K83C 2NVQK 2NVYC 3HOWC 1TWAK 3HOVK 3HOVC 4A3GK 1TWAC 4G7ZA 3GTKK 4OIQA 4A3GC 3GTKC 2PMZL 3HOZK 4XLNA 3HOZC 4GZYA 4LJZA 2BE5A 4AYBL 4A3FK 2JA5K 2O5IA 4A3FC 2JA5C 2E2JK 4A3DK 4KN4A 2E2JC 4A3DC 2VUMK 3HOUK 1TWHK 2JA8C 2PA8D 4XLPA 2VUMC 3H3VD 4ZH4A 3HOUC 1TWHC 1TWGK 3S1QC 2A69A 5FLMK 4QIWL 1TWGC 4A3JK 5FLMC 2JA7K 5M5XK 4A3JC 3FKIK 2JA7C 3S2HK 3FKIC 4C2MK 4Y7NK 3GTQK 3PO2K 1WCMK 4OINA 3S2HC 4C2MC 4Y7NC 3GTQC 4MQ9A 3K7AK 4A3MK 1WCMC 2NVQC 4C3JK 3GTPK 2WB1L 3K7AC 5IYDK 3S2DK 1YNNA 3GTPC 5IYDC 1HQMA 3S1MK 3GTLK 2E2HK 5M5WK 3S1MC 5C3EK 3GTLC 2E2HC 3H3VL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E C;  2R7Z C;  1IW7 A;  5TMF A;  1Y1W K;  4OIR A;  3RZO K;  4LK0 A;  1Y1W C;  3RZO C;  2A6E A;  4X6A K;  4G7H A;  1TWC K;  5D4D A;  5FJ8 K;  4A3I K;  4A3L K;  4X6A C;  3S15 K;  1TWC C;  4XSZ A;  4A3I C;  4A3L C;  2PPB A;  3S15 C;  5IP7 K;  4LK1 A;  3H0G K;  2A6H A;  4LLG A;  4KMU A;  4YFK A;  5IP7 C;  1TWF K;  2Y0S D;  3H0G C;  4KN7 A;  3I4N K;  4BBS K;  1TWF C;  3I4N C;  3HKZ D;  4BBS C;  2WAQ D;  2YU9 K;  4A3B K;  4OIP A;  2R92 K;  4NOI A;  2YU9 C;  3PO2 C;  5C44 K;  2R92 C;  3M3Y K;  4A3M C;  1SMY A;  4OIO A;  5C44 C;  4A3E K;  1SFO K;  4C3J C;  3M3Y C;  5M3F K;  2JA6 K;  4A93 K;  1YNJ A;  4A3E C;  1SFO C;  2A68 A;  2PMZ D;  3S2D C;  2O5J A;  4A93 C;  4A3K K;  3GTJ K;  4MEX A;  5IYB K;  4A3K C;  2PA8 L;  2B63 K;  2CW0 A;  3GTJ C;  3S1R K;  5IYB C;  5IYC K;  3GTO K;  3S17 K;  2B63 C;  2R93 K;  1XPP A;  4AYB D;  5IYC C;  3GTO C;  2NVX K;  3S17 C;  3S1N K;  2R93 C;  3CQZ K;  5C4J K;  2NVX C;  1I6H K;  4YFX A;  3CQZ C;  5C4J C;  3I4M K;  1R9T K;  4BXX K;  3S14 K;  4C3H K;  4Q4Z A;  3I4M C;  1R9T C;  4BXX C;  4QJV A;  4C3H C;  1I3Q K;  3GTM K;  2R7Z K;  1I3Q C;  3GTM C;  1I50 K;  4QIW D;  4C3I K;  4JK1 A;  4YG2 A;  3HOX K;  3PO3 K;  4G7O A;  4C3I C;  3GTG K;  1I50 C;  3PO3 C;  2NVT K;  3HOX C;  3GTG C;  3DXJ A;  3EQL A;  2NVT C;  4A3B C;  4BY1 K;  5TMC A;  5C4X K;  4BY1 C;  4MEY A;  4Q5S A;  5C4X C;  3M4O K;  2JA6 C;  4Y52 K;  3M4O C;  1Y1V K;  3RZD K;  3S16 K;  4Y52 C;  1Y1V C;  5M3M K;  3RZD C;  3S16 C;  1ZYR A;  2JA8 K;  5IP9 K;  1I6V A;  2WB1 D;  3HOY K;  4QJV B;  5IP9 C;  4YFN A;  5M5Y K;  3S1R C;  4BBR K;  4A3C K;  3S1Q K;  3HOY C;  3WOD A;  4A3C C;  4XSX A;  2Y0S L;  4BBR C;  3S1N C;  4BY7 K;  1BDF A;  1I6H C;  3HKZ L;  4BY7 C;  2WAQ L;  2E2I K;  1K83 K;  2NVY K;  3HOW K;  2E2I C;  3S14 C;  1K83 C;  2NVQ K;  2NVY C;  3HOW C;  1TWA K;  3HOV K;  3HOV C;  4A3G K;  1TWA C;  4G7Z A;  3GTK K;  4OIQ A;  4A3G C;  3GTK C;  2PMZ L;  3HOZ K;  4XLN A;  3HOZ C;  4GZY A;  4LJZ A;  2BE5 A;  4AYB L;  4A3F K;  2JA5 K;  2O5I A;  4A3F C;  2JA5 C;  2E2J K;  4A3D K;  4KN4 A;  2E2J C;  4A3D C;  2VUM K;  3HOU K;  1TWH K;  2JA8 C;  2PA8 D;  4XLP A;  2VUM C;  3H3V D;  4ZH4 A;  3HOU C;  1TWH C;  1TWG K;  3S1Q C;  2A69 A;  5FLM K;  4QIW L;  1TWG C;  4A3J K;  5FLM C;  2JA7 K;  5M5X K;  4A3J C;  3FKI K;  2JA7 C;  3S2H K;  3FKI C;  4C2M K;  4Y7N K;  3GTQ K;  3PO2 K;  1WCM K;  4OIN A;  3S2H C;  4C2M C;  4Y7N C;  3GTQ C;  4MQ9 A;  3K7A K;  4A3M K;  1WCM C;  2NVQ C;  4C3J K;  3GTP K;  2WB1 L;  3K7A C;  5IYD K;  3S2D K;  1YNN A;  3GTP C;  5IYD C;  1HQM A;  3S1M K;  3GTL K;  2E2H K;  5M5W K;  3S1M C;  5C3E K;  3GTL C;  2E2H C;  3H3V L; 
#chains in the Genus database with same CATH topology
 3GSI A;  1IW7 A;  3GTO A;  3AD7 C;  2KWA A;  4LOW A;  2ZUF A;  4OIR A;  3L4K A;  1TWC K;  5D4D A;  3DLL S;  1J6V A;  4KAT A;  1TWC C;  5IOQ A;  1R9T A;  2E2I A;  4LK1 A;  3H0G K;  1TWF K;  4KB4 A;  3H0G C;  4WF9 S;  4KN7 A;  1TWF C;  2R92 K;  1WQF A;  4WFB S;  1WOS A;  5CJ9 A;  2R92 C;  4IOC S;  4A3M C;  2JA6 K;  4A3E K;  1SFO K;  4PAA A;  4A3E C;  1SFO C;  2A68 A;  2O5J A;  5TJ3 A;  4KDD A;  4GFQ A;  2RGR A;  2B63 K;  3S1R K;  4KMA A;  3S17 K;  2B63 C;  2R93 K;  1XPP A;  2NVX K;  3S1N K;  3S17 C;  2R93 C;  3CQZ K;  2NVX C;  1F7U A;  4YFX A;  3CQZ C;  5JVG S;  1O2F B;  3I4M K;  1PJ5 A;  3I4M C;  4QJV A;  1USM A;  1DCP A;  3GTQ A;  5L46 A;  3PO3 K;  3PO3 C;  1VLO A;  1O2B A;  3DXJ A;  4A3B C;  5C4X K;  1YX2 A;  2ZUE A;  5C4X C;  2JA5 A;  1WIH A;  1Y1V K;  3LAJ A;  5M3M K;  1Y1V C;  2JA8 K;  1PJ6 A;  4A3C K;  4YFN A;  1C0A A;  5IOS A;  3L4J A;  4A3C C;  4WJ3 M;  3FKI A;  3S14 C;  1XZP A;  3HOV K;  1TWA K;  2V6S A;  3HOV C;  4A3G K;  1TWA C;  1XXB A;  4A3G C;  1XZQ B;  3ERE D;  4GZY A;  3IPJ A;  2O5I A;  2L5N A;  4DDQ A;  1Y1W A;  1ZXO A;  3T01 A;  4XLP A;  1DCO A;  1TWG K;  5FLM K;  1TWG C;  5FLM C;  2JA7 K;  1EI6 A;  5M5X K;  2ZJQ S;  2JA7 C;  3G4A A;  4PAB A;  3PO2 K;  1WCM K;  1JQW A;  1WCM C;  1ZVU A;  1EFW A;  1DD5 A;  2WB1 L;  1YNN A;  1FEU A;  1O2A A;  3S1M K;  4P5A A;  2E2H K;  3S1M C;  3GTJ A;  2E2H C;  3QX3 A;  4FM9 A;  5TMF A;  3GEH A;  3ORE A;  3AD8 C;  5FJ8 K;  4A3I K;  1IL2 A;  1F93 A;  3ADA C;  4XSZ A;  4A3I C;  2A6H A;  4LLG A;  4KMU A;  4YFK A;  3AH5 A;  1I50 A;  4GTA A;  3PIP S;  2YU9 K;  3A8K A;  4OIP A;  4IO9 S;  2YU9 C;  2EBB A;  3Q3Q A;  4BLA A;  4C3J C;  2GSU A;  1J6W A;  4FZB A;  3AQO A;  3AQP A;  3GTO K;  3NUH A;  4AYB D;  3GTO C;  1USO A;  2CFA A;  1I6H K;  3PIO S;  1ZBS A;  1WSV A;  3BP3 A;  1R9T K;  3T02 A;  1R9T C;  4RMF A;  1WOR A;  3GTM K;  1O24 A;  3GTM C;  4AH6 A;  4JK1 A;  4G7O A;  3GTG K;  3N3Y A;  3OPF A;  3GTG C;  3EQL A;  3GTL A;  5TMC A;  1YCL A;  2L3U A;  4Q5S A;  3M4O K;  2JA6 C;  4Y52 K;  3M4O C;  1WSR A;  3S16 K;  1IE0 A;  2Y3P A;  3VA7 A;  4Y52 C;  3S16 C;  1JOE A;  2VUM A;  3S1Q K;  1TWC A;  4QJV B;  5IOR A;  5M5Y K;  3S1R C;  1F7V A;  2XCO A;  3S1N C;  3H0G A;  2V6T A;  4G0V A;  1O25 A;  2JH3 A;  3CAG A;  5DM7 S;  3HOW K;  1VJE A;  2NVQ K;  3HOW C;  5HL8 A;  1GE9 A;  3HXA A;  1AB4 A;  3A8J A;  3GTP A;  4WIL A;  4XLN A;  2R7Z A;  2BE5 A;  3S0X A;  4AYB L;  2JA5 K;  3BP8 C;  2JA5 C;  4GT9 A;  4A3D K;  4KN4 A;  2GSO A;  4A3D C;  4GTF A;  3HOU K;  1BGW A;  2PHC B;  1XZP B;  2JA8 C;  2PA8 D;  4M1X A;  3HOU C;  3SZZ A;  4ZH4 A;  2GAH C;  4GTL A;  3GEE A;  2GAG C;  3FKI K;  3S2H K;  3FKI C;  4Y7N K;  3S2H C;  4Y7N C;  3K7A K;  3K7A C;  3S2D K;  1BJT A;  1HQM A;  5C3E K;  3H3V L;  3GIR A;  5C3E C;  3SZY A;  3TFI A;  1X31 C;  1Y1W K;  4KAW X;  4G0U A;  4LK0 A;  1Y1W C;  2A6E A;  3S15 K;  4IOA S;  3S15 C;  2FQO A;  4WFA S;  1I3Q A;  1TWA A;  2Y0S D;  3I4N K;  3G4C A;  3I4N C;  5IOT A;  4BKW A;  4NOI A;  3PO2 C;  3N0C A;  3M3Y K;  4GTE A;  3M3Y C;  5M3F K;  4WFN S;  3GTJ K;  5IYB K;  1VRQ C;  2PA8 L;  4KAR A;  3GTJ C;  1WOO A;  5IYB C;  4J3N A;  5IYC K;  2ZJP S;  5IYC C;  5HQH A;  5C4J K;  5C4J C;  4BXX K;  4C3H K;  4KMH A;  1WQG A;  4BXX C;  1K83 A;  2NVY A;  4C3H C;  4C45 A;  4C3I K;  1I50 K;  4YG2 A;  3GTK A;  4C3I C;  1I50 C;  5JFE A;  4G0W A;  4GTD A;  1EH1 A;  2FQT A;  3BUE A;  1EQR A;  1HI9 A;  3CF5 S;  2CFA B;  3LYW A;  1RU0 A;  2D6F C;  1ZYR A;  1I6V A;  4WCE S;  1O29 A;  1TWH A;  4BBR K;  3FHZ A;  4XSX A;  2Y0S L;  4BBR C;  1I6H C;  2E2I K;  1BS2 A;  2P8T A;  2E2I C;  3A8I A;  1KQ4 A;  4O2D A;  3TFJ A;  2KQ1 A;  3HOZ K;  3HOZ C;  1XXA A;  1IBA A;  1J6X A;  3OEP A;  4KM9 A;  1ISE A;  3GDZ A;  2XCQ A;  1O28 A;  2VUM K;  2VUM C;  3H3V D;  3S1Q C;  3GTM A;  1TWF A;  4LR2 A;  1IS1 A;  3GTQ K;  3GTG A;  3GTQ C;  4MQ9 A;  4A3M K;  2R92 A;  2NVQ C;  3GTP K;  3MML B;  3T00 A;  5IYD K;  3AD9 C;  3GTP C;  2JA6 A;  5IYD C;  2XCR B;  1SFO A;  5M5W K;  2R7Z K;  2R7Z C;  4KAS A;  2B63 A;  2R93 A;  3RZO K;  2KPU A;  2NVX A;  2V6U A;  1B4B A;  3CQZ A;  4WJ4 A;  3RZO C;  4X6A K;  4G7H A;  1O27 A;  1J98 A;  1L0W A;  4X6A C;  1EK8 A;  1UV7 A;  4A3L K;  4A3L C;  2PPB A;  1IQ0 A;  5IP7 K;  1ZQ1 C;  5IP7 C;  4BBS K;  3HKZ D;  4BBS C;  2WAQ D;  4A3B K;  4P9S A;  5C44 K;  1SMY A;  4OIO A;  5C44 C;  2KXY A;  4A93 K;  1YNJ A;  3S2D C;  2PMZ D;  5EGH A;  4A3K K;  4A93 C;  1Y1V A;  4MEX A;  3N0B A;  4A3K C;  2CW0 A;  5EGE A;  1V5V A;  5HL7 S;  1WQH A;  1G51 A;  3S14 K;  4GTB A;  3GEI A;  4Q4Z A;  1I3Q K;  1I3Q C;  4QIW D;  3HOX K;  1B4A A;  2RH6 A;  2NVT K;  3HOX C;  1XXC A;  2NVT C;  4BY1 K;  4U67 S;  4BY1 C;  4MEY A;  3RZD K;  4BLB A;  1XZQ A;  2P5M A;  3RZD C;  5IP9 K;  3JST A;  1F9N A;  5E68 A;  2WB1 D;  3HOY K;  5IP9 C;  4KC6 A;  3HOY C;  3WOD A;  5DM6 S;  1VGX A;  1TWG A;  4KMD A;  4BY7 K;  5JVO A;  1BDF A;  3HKZ L;  4BY7 C;  1JVI A;  2WAQ L;  2JA7 A;  1K83 K;  3FOF A;  1PJ7 A;  2NVY K;  1K83 C;  2NVY C;  2W7V A;  1WOP A;  1WCM A;  3GTK K;  4G7Z A;  2ZFZ A;  4OIQ A;  3GTK C;  2PMZ L;  2ZJR S;  3TTG A;  5CHP A;  4LJZ A;  2E2H A;  2GSN A;  4XCH A;  4A3F K;  1O26 A;  1VH2 A;  4A3F C;  2E2J K;  2E2J C;  1DCH A;  1TWH K;  1TWH C;  2A69 A;  5JVH S;  4QIW L;  4A3J K;  3LPX A;  4P5B A;  1INN A;  3FOE A;  4A3J C;  4KM8 A;  3V4G A;  4C2M K;  4OIN A;  4LQY A;  4C2M C;  3LAP A;  2YU9 A;  4KB2 A;  4C3J K;  4ILD A;  3GTL K;  3TFH A;  3GTL C;  4GTC A; 
#chains in the Genus database with same CATH homology
 5C3E C;  2R7Z C;  1IW7 A;  5TMF A;  1Y1W K;  4OIR A;  3RZO K;  4LK0 A;  1Y1W C;  3RZO C;  2A6E A;  4X6A K;  4G7H A;  1TWC K;  5D4D A;  5FJ8 K;  4A3I K;  4A3L K;  4X6A C;  3S15 K;  1TWC C;  4XSZ A;  4A3I C;  4A3L C;  2PPB A;  3S15 C;  5IP7 K;  4LK1 A;  3H0G K;  2A6H A;  4LLG A;  4KMU A;  4YFK A;  5IP7 C;  1TWF K;  2Y0S D;  3H0G C;  4KN7 A;  3I4N K;  4BBS K;  1TWF C;  3I4N C;  3HKZ D;  4BBS C;  2WAQ D;  2YU9 K;  4A3B K;  4OIP A;  2R92 K;  4NOI A;  2YU9 C;  3PO2 C;  5C44 K;  2R92 C;  3M3Y K;  4A3M C;  1SMY A;  4OIO A;  5C44 C;  4A3E K;  1SFO K;  4C3J C;  3M3Y C;  5M3F K;  2JA6 K;  4A93 K;  1YNJ A;  4A3E C;  1SFO C;  2A68 A;  2PMZ D;  3S2D C;  2O5J A;  4A93 C;  4A3K K;  3GTJ K;  4MEX A;  5IYB K;  4A3K C;  2PA8 L;  2B63 K;  2CW0 A;  3GTJ C;  3S1R K;  5IYB C;  5IYC K;  3GTO K;  3S17 K;  2B63 C;  2R93 K;  1XPP A;  4AYB D;  5IYC C;  3GTO C;  2NVX K;  3S17 C;  3S1N K;  2R93 C;  3CQZ K;  5C4J K;  2NVX C;  1I6H K;  4YFX A;  3CQZ C;  5C4J C;  3I4M K;  1R9T K;  4BXX K;  3S14 K;  4C3H K;  4Q4Z A;  3I4M C;  1R9T C;  4BXX C;  4QJV A;  4C3H C;  1I3Q K;  3GTM K;  2R7Z K;  1I3Q C;  3GTM C;  1I50 K;  4QIW D;  4C3I K;  4JK1 A;  4YG2 A;  3HOX K;  3PO3 K;  4G7O A;  4C3I C;  3GTG K;  1I50 C;  3PO3 C;  2NVT K;  3HOX C;  3GTG C;  3DXJ A;  3EQL A;  2NVT C;  4A3B C;  4BY1 K;  5TMC A;  5C4X K;  4BY1 C;  4MEY A;  4Q5S A;  5C4X C;  3M4O K;  2JA6 C;  4Y52 K;  3M4O C;  1Y1V K;  3RZD K;  3S16 K;  4Y52 C;  1Y1V C;  5M3M K;  3RZD C;  3S16 C;  1ZYR A;  2JA8 K;  5IP9 K;  1I6V A;  2WB1 D;  3HOY K;  4QJV B;  5IP9 C;  4YFN A;  5M5Y K;  3S1R C;  4BBR K;  4A3C K;  3S1Q K;  3HOY C;  3WOD A;  4A3C C;  4XSX A;  2Y0S L;  4BBR C;  3S1N C;  4BY7 K;  1BDF A;  1I6H C;  3HKZ L;  4BY7 C;  2WAQ L;  2E2I K;  1K83 K;  2NVY K;  3HOW K;  2E2I C;  3S14 C;  1K83 C;  2NVQ K;  2NVY C;  3HOW C;  1TWA K;  3HOV K;  3HOV C;  4A3G K;  1TWA C;  4G7Z A;  3GTK K;  4OIQ A;  4A3G C;  3GTK C;  2PMZ L;  3HOZ K;  4XLN A;  3HOZ C;  4GZY A;  4LJZ A;  2BE5 A;  4AYB L;  4A3F K;  2JA5 K;  2O5I A;  4A3F C;  2JA5 C;  2E2J K;  4A3D K;  4KN4 A;  2E2J C;  4A3D C;  2VUM K;  3HOU K;  1TWH K;  2JA8 C;  2PA8 D;  4XLP A;  2VUM C;  3H3V D;  4ZH4 A;  3HOU C;  1TWH C;  1TWG K;  3S1Q C;  2A69 A;  5FLM K;  4QIW L;  1TWG C;  4A3J K;  5FLM C;  2JA7 K;  5M5X K;  4A3J C;  3FKI K;  2JA7 C;  3S2H K;  3FKI C;  4C2M K;  4Y7N K;  3GTQ K;  3PO2 K;  1WCM K;  4OIN A;  3S2H C;  4C2M C;  4Y7N C;  3GTQ C;  4MQ9 A;  3K7A K;  4A3M K;  1WCM C;  2NVQ C;  4C3J K;  3GTP K;  2WB1 L;  3K7A C;  5IYD K;  3S2D K;  1YNN A;  3GTP C;  5IYD C;  1HQM A;  3S1M K;  3GTL K;  2E2H K;  5M5W K;  3S1M C;  5C3E K;  3GTL C;  2E2H C;  3H3V L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...