2A68A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic rifabutin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a68A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a68A01
4XLNA 4A3EK 2WB1D 4NOIA 4XSZA 4C3JC 5C4XC 3S15C 5M3MK 4C2MC 2Y0SD 3S17C 4QJVB 2NVTK 2NVXK 1XPPA 4LK1A 4AYBL 4A3GK 4A3KC 5TMFA 4KN7A 3S1MC 4C3HK 4BY1C 4BXXK 1TWFC 4BY7C 1TWHK 1YNNA 4OIOA 3HOXK 5IYBK 3S14K 1Y1VC 3DXJA 3S2DK 5TMCA 4A3EC 2CW0A 3FKIC 2E2HK 3FKIK 3HOWK 4LJZA 3H3VL 4Y52C 2YU9C 5IYDC 3HOXC 4A3BC 3S1RK 1R9TK 2E2IC 4Y7NK 2A6EA 2R7ZC 4BXXC 4A3FK 3GTOK 3S1NK 4KN4A 4C3HC 3S1MK 3GTJK 2NVYC 4X6AC 3RZDK 1Y1WK 2E2JK 3K7AK 4A3BK 1I6VA 4G7HA 5D4DA 2R93C 3PO2C 3PO2K 3S2HC 4A3JC 3GTMC 5C3EC 4A3IC 1TWGK 3GTKC 2JA7K 4BBSK 4G7OA 1SMYA 3HOVC 2R92K 1TWCK 4A3CK 4KMUA 4A3LK 1TWHC 1TWFK 2Y0SL 3I4NC 5C4JK 4BY7K 2PA8L 3GTGK 3H0GC 1WCMK 4A3LC 2E2IK 2BE5A 3HOUC 5IYDK 5C4XK 3M3YC 2JA7C 1YNJA 4G7ZA 5C3EK 4MEYA 5FLMC 3GTPK 3I4MK 3CQZC 3S2DC 5IYCK 5M5YK 1K83K 3GTLK 4LK0A 1BDFA 4A93K 4OIPA 2WB1L 3HKZL 2WAQL 3H0GK 4BY1K 2JA6C 4OIRA 3GTGC 3S1NC 4Y7NC 4A3FC 1HQMA 2NVXC 3HOVK 3S15K 2O5JA 1TWGC 4OINA 3CQZK 4A3IK 4YFKA 1I6HC 3S1QK 3M3YK 2WAQD 2JA5K 2A6HA 3M4OK 2E2JC 1TWAC 1I3QK 4C3IK 5C44K 1WCMC 2VUMK 2E2HC 3PO3C 3GTQC 3WODA 5C44C 2PPBA 4QIWL 1ZYRA 3S1RC 1R9TC 2YU9K 4ZH4A 1IW7A 5FLMK 5FJ8K 4YFXA 5IP7K 3S14C 5M3FK 3K7AC 3HOUK 3HOYK 4YG2A 2B63C 5M5XK 3GTQK 2NVYK 4X6AK 1I50C 4MQ9A 4YFNA 2PMZL 4XSXA 4LLGA 4A3KK 3I4NK 2JA8C 3PO3K 1I3QC 2VUMC 2JA5C 2PA8D 3RZOC 4C3JK 2PMZD 3S1QC 3HOWC 4BBRC 4QIWD 2R93K 3GTPC 4OIQA 4A3MC 3I4MC 3S16K 4QJVA 1Y1VK 1Y1WC 3H3VD 4XLPA 3HOZK 1I50K 3HOZC 5C4JC 3GTOC 4A3GC 5M5WK 4JK1A 4C3IC 3HOYC 2R92C 2NVTC 3S17K 1K83C 4Y52K 4A3MK 2A69A 4Q5SA 4A3JK 3GTMK 1I6HK 4A3CC 2A68A 4BBRK 2NVQK 4GZYA 1SFOK 4MEXA 5IYBC 2O5IA 3HKZD 2JA8K 3GTJC 3EQLA 3RZDC 4Q4ZA 4A3DC 4A3DK 2JA6K 2R7ZK 2B63K 1TWAK 1TWCC 4C2MK 3M4OC 5IP7C 5IYCC 3GTLC 4A93C 4BBSC 3S16C 1SFOC 3GTKK 3S2HK 5IP9K 4AYBD 2NVQC 5IP9C 3RZOK
chains in the Genus database with same CATH superfamily
3GDZA 4XSZA 3CF5S 3MMLB 2Y0SD 1VJEA 1IE0A 2GSOA 1TWFA 3GTKA 5TMFA 3S1MC 4C3HK 1TWHK 1TWHA 2JH3A 3HOXK 3DXJA 5DM7S 5JVGS 1VGXA 5IORA 4J3NA 3H3VL 4Y52C 1DCHA 5IYDC 3HOXC 4A3BC 1DCPA 2E2IC 4A3FK 2A6EA 4KN4A 2NVYC 4A3BK 4G7HA 4FZBA 1PJ6A 4IOCS 4A3JC 3GTMC 1TWGK 1TWGA 2ZUEA 3GEEA 1XXCA 4KMUA 4A3LK 3AH5A 4FM9A 3T01A 1EK8A 4A3LC 2BE5A 3M3YC 3GTQA 4G7ZA 3GTPK 4MEYA 1HI9A 3N0BA 3FHZA 3GTLK 4A93K 1K83K 3HKZL 1BS2A 1GE9A 3GTGC 2RH6A 4A3FC 4BLBA 3HOVK 3S15K 4WFBS 2O5JA 4A3IK 1B4BA 4YFKA 2JA5A 1O28A 2GAGC 1TWAC 5IOTA 5CJ9A 3N0CA 3TTGA 2PPBA 3S1RC 2YU9K 4LQYA 4ZH4A 4GT9A 1ZBSA 1O2BA 1O25A 1O27A 1WQHA 1RU0A 5M3FK 1PJ7A 5M5XK 2NVXA 4MQ9A 2PMZL 2KPUA 3OPFA 3L4JA 1I3QC 2VUMC 2PA8D 3RZOC 3S1QC 1TWCA 4A3MC 3S16K 1Y1VK 1USOA 2RGRA 1BJTA 3H3VD 3HOZK 4A3GC 4C3IC 3HOYC 1I6HK 4A3JK 3GTMK 4GTLA 2NVQK 1O29A 3SZZA 1I50A 5DM6S 4P5AA 4Q4ZA 2JA6K 2W7VA 1SFOA 3M4OC 2CFAA 5IYCC 4BBSC 3FOFA 3S2HK 4AYBD 1IS1A 4C3JC 3S15C 4BLAA 4KM8A 5E68A 5JVOA 4KN7A 2R92A 4PAAA 1TWFC 4BY7C 1YNNA 4OIOA 5IYBK 1Y1VC 3H0GA 4A3EC 4WFNS 3FKIC 3FKIK 1XZQA 3HOWK 1ZQ1C 1F7VA 4P9SA 2ZJQS 3CQZA 3BP3A 4Y7NK 4BXXC 3GTOK 1J6XA 3S1NK 3PIOS 1G51A 4X6AC 1AB4A 4GTDA 3RZDK 4WJ4A 3N3YA 1Y1WK 2E2HA 5JVHS 5D4DA 2R93C 3S2HC 1IBAA 5C3EC 2JA7K 4BBSK 1SMYA 2Y3PA 3I4NC 5C4JK 2FQOA 1WSRA 2KQ1A 3H0GC 1WCMK 1WCMA 2E2IK 3HOUC 1XZPA 5IYDK 3ERED 5FLMC 4GTFA 2ZJPS 3AD7C 2JA6A 1BDFA 4OIPA 3OEPA 4KC6A 3A8KA 4G0VA 3S1NC 4GFQA 4Y7NC 1HQMA 2NVXC 4O2DA 4KASA 4PABA 2R93A 3GTMA 3CQZK 3LAJA 1VRQC 1I6HC 3M3YK 2WAQD 4C45A 2KWAA 5C44K 1UV7A 1V5VA 4KATA 1TWAA 5C44C 1ZYRA 3TFIA 1R9TC 4GTCA 5EGHA 5FLMK 1K83A 1WORA 5TJ3A 1YCLA 3HOUK 2B63C 1I3QA 2VUMA 2NVYK 1O2AA 4RMFA 3PO3K 3ADAC 4KM9A 1O2FB 2PMZD 4G0WA 4QIWD 2ZUFA 3I4MC 1WOPA 1Y1WC 1ISEA 3OREA 4XLPA 1BGWA 1I50K 4GTAA 2V6UA 3GTOC 1Y1WA 1J6VA 5M5WK 5L46A 4KB2A 4Q5SA 3HXAA 3VA7A 4BBRK 4GZYA 2B63A 3L4KA 3FKIA 3GTJC 2R7ZK 1TWCC 3GTJA 1WSVA 4M1XA 5IP7C 3GTLC 4A93C 3S16C 1SFOC 4GTBA 4A3CK 3BUEA 1O26A 4XLNA 4XCHA 4BKWA 2WB1D 4NOIA 4A3EK 5M3MK 3RZOK 3S17C 2NVTK 2NVXK 1XPPA 4AYBL 4P5BA 1F7UA 1JQWA 3S14K 3S2DK 1F9NA 2YU9A 1C0AA 2E2HK 3AD9C 2L3UA 2YU9C 3S1RK 1J6WA 4C3HC 3S1MK 2ZFZA 2KXYA 1KQ4A 4GTEA 3PO2K 5HQHA 4A3IC 4G7OA 3HOVC 3LPXA 2R92K 1TWCK 1TWHC 2Y0SL 3GTGK 4IOAS 5IOSA 1WOSA 1YNJA 1WQGA 4WF9S 1R9TA 3A8JA 3CQZC 1XZQB 5M5YK 5IOQA 4KMAA 2WB1L 1DD5A 4BY1K 4OIRA 5JFEA 1IQ0A 1EH1A 1TWGC 4OINA 1B4AA 1XXBA 2P8TA 4ILDA 5HL8A 2JA5K 3M4OK 1XXAA 1WCMC 4U67S 3PO3C 3WODA 4QIWL 3GSIA 4KB4A 3TFHA 3FOEA 5FJ8K 2PHCB 4YFXA 5IP7K 3S14C 1ZVUA 3K7AC 3AQPA 3HOYK 3T00A 3GTQK 4X6AK 2XCQA 1YX2A 4YFNA 1O24A 4LLGA 3G4CA 2JA8C 1VH2A 3GEHA 3HOWC 4BBRC 3GTPC 5HL7S 1USMA 4JK1A 2R92C 1ZXOA 4Y52K 2A69A 1WQFA 2A68A 3GIRA 4MEXA 2O5IA 4WCES 3EQLA 4A3DC 4A3DK 3BP8C 3NUHA 2B63K 1TWAK 3GTPA 3GTKK 2E2HC 2NVQC 5IP9C 2EBBA 5C4XC 4C2MC 4QJVB 3GTOA 4LK1A 4A3GK 4A3KC 1Y1VA 4BY1C 4BXXK 1INNA 3QX3A 4AH6A 4KDDA 5TMCA 3TFJA 2CW0A 4LJZA 1R9TK 2ZJRS 3G4AA 3AQOA 2R7ZC 4G0UA 3GTJK 2E2IA 1IL2A 2R7ZA 2E2JK 3K7AK 3GTGA 1I6VA 5EGEA 3PO2C 3GTKC 1TWFK 1JVIA 4BY7K 2PA8L 2GSUA 2P5MA 5C4XK 2JA7C 5C3EK 3I4MK 4LOWA 1EFWA 3Q3QA 3S2DC 5IYCK 4LK0A 2XCOA 3CAGA 2WAQL 2D6FC 3H0GK 2JA6C 3A8IA 3JSTA 4WJ3M 3S1QK 2FQTA 2A6HA 2E2JC 1I3QK 4C3IK 2VUMK 4KARA 1DCOA 3GTQC 4LR2A 2JA7A 3LYWA 2L5NA 1IW7A 3T02A 3V4GA 4YG2A 3IPJA 1I50C 4XSXA 3I4NK 4A3KK 1XZPB 2CFAB 2JA5C 4C3JK 4KMHA 2R93K 3GTLA 4OIQA 1EI6A 4QJVA 4KMDA 1WIHA 1EQRA 3DLLS 2GSNA 3LAPA 2V6SA 3GEIA 3HOZC 3AD8C 5C4JC 1PJ5A 2NVTC 3S17K 4WILA 1K83C 1L0WA 4WFAS 4A3MK 4DDQA 1FEUA 4A3CC 1SFOK 5IYBC 1JOEA 4KAWX 3HKZD 5CHPA 1VLOA 2JA8K 3RZDC 2V6TA 3PIPS 4IO9S 3S0XA 1WOOA 1F93A 4C2MK 1X31C 2NVYA 1J98A 3SZYA 2XCRB 5IP9K 2GAHC
chains in the Genus database with same CATH topology
4XLNA 4A3EK 2WB1D 4NOIA 4XSZA 4C3JC 5C4XC 3S15C 5M3MK 4C2MC 2Y0SD 3S17C 4QJVB 2NVTK 2NVXK 1XPPA 4LK1A 4AYBL 4A3GK 4A3KC 5TMFA 4KN7A 3S1MC 4C3HK 4BY1C 4BXXK 1TWFC 4BY7C 1TWHK 1YNNA 4OIOA 3HOXK 5IYBK 3S14K 1Y1VC 3DXJA 3S2DK 5TMCA 4A3EC 2CW0A 3FKIC 2E2HK 3FKIK 3HOWK 4LJZA 3H3VL 4Y52C 2YU9C 5IYDC 3HOXC 4A3BC 3S1RK 1R9TK 2E2IC 4Y7NK 2A6EA 2R7ZC 4BXXC 4A3FK 3GTOK 3S1NK 4KN4A 4C3HC 3S1MK 3GTJK 2NVYC 4X6AC 3RZDK 1Y1WK 2E2JK 3K7AK 4A3BK 1I6VA 4G7HA 5D4DA 2R93C 3PO2C 3PO2K 3S2HC 4A3JC 3GTMC 5C3EC 4A3IC 1TWGK 3GTKC 2JA7K 4BBSK 4G7OA 1SMYA 3HOVC 2R92K 1TWCK 4A3CK 4KMUA 4A3LK 1TWHC 1TWFK 2Y0SL 3I4NC 5C4JK 4BY7K 2PA8L 3GTGK 3H0GC 1WCMK 4A3LC 2E2IK 2BE5A 3HOUC 5IYDK 5C4XK 3M3YC 2JA7C 1YNJA 4G7ZA 5C3EK 4MEYA 5FLMC 3GTPK 3I4MK 3CQZC 3S2DC 5IYCK 5M5YK 1K83K 3GTLK 4LK0A 1BDFA 4A93K 4OIPA 2WB1L 3HKZL 2WAQL 3H0GK 4BY1K 2JA6C 4OIRA 3GTGC 3S1NC 4Y7NC 4A3FC 1HQMA 2NVXC 3HOVK 3S15K 2O5JA 1TWGC 4OINA 3CQZK 4A3IK 4YFKA 1I6HC 3S1QK 3M3YK 2WAQD 2JA5K 2A6HA 3M4OK 2E2JC 1TWAC 1I3QK 4C3IK 5C44K 1WCMC 2VUMK 2E2HC 3PO3C 3GTQC 3WODA 5C44C 2PPBA 4QIWL 1ZYRA 3S1RC 1R9TC 2YU9K 4ZH4A 1IW7A 5FLMK 5FJ8K 4YFXA 5IP7K 3S14C 5M3FK 3K7AC 3HOUK 3HOYK 4YG2A 2B63C 5M5XK 3GTQK 2NVYK 4X6AK 1I50C 4MQ9A 4YFNA 2PMZL 4XSXA 4LLGA 4A3KK 3I4NK 2JA8C 3PO3K 1I3QC 2VUMC 2JA5C 2PA8D 3RZOC 4C3JK 2PMZD 3S1QC 3HOWC 4BBRC 4QIWD 2R93K 3GTPC 4OIQA 4A3MC 3I4MC 3S16K 4QJVA 1Y1VK 1Y1WC 3H3VD 4XLPA 3HOZK 1I50K 3HOZC 5C4JC 3GTOC 4A3GC 5M5WK 4JK1A 4C3IC 3HOYC 2R92C 2NVTC 3S17K 1K83C 4Y52K 4A3MK 2A69A 4Q5SA 4A3JK 3GTMK 1I6HK 4A3CC 2A68A 4BBRK 2NVQK 4GZYA 1SFOK 4MEXA 5IYBC 2O5IA 3HKZD 2JA8K 3GTJC 3EQLA 3RZDC 4Q4ZA 4A3DC 4A3DK 2JA6K 2R7ZK 2B63K 1TWAK 1TWCC 4C2MK 3M4OC 5IP7C 5IYCC 3GTLC 4A93C 4BBSC 3S16C 1SFOC 3GTKK 3S2HK 5IP9K 4AYBD 2NVQC 5IP9C 3RZOK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLN A;  4A3E K;  2WB1 D;  4NOI A;  4XSZ A;  4C3J C;  5C4X C;  3S15 C;  5M3M K;  4C2M C;  2Y0S D;  3S17 C;  4QJV B;  2NVT K;  2NVX K;  1XPP A;  4LK1 A;  4AYB L;  4A3G K;  4A3K C;  5TMF A;  4KN7 A;  3S1M C;  4C3H K;  4BY1 C;  4BXX K;  1TWF C;  4BY7 C;  1TWH K;  1YNN A;  4OIO A;  3HOX K;  5IYB K;  3S14 K;  1Y1V C;  3DXJ A;  3S2D K;  5TMC A;  4A3E C;  2CW0 A;  3FKI C;  2E2H K;  3FKI K;  3HOW K;  4LJZ A;  3H3V L;  4Y52 C;  2YU9 C;  5IYD C;  3HOX C;  4A3B C;  3S1R K;  1R9T K;  2E2I C;  4Y7N K;  2A6E A;  2R7Z C;  4BXX C;  4A3F K;  3GTO K;  3S1N K;  4KN4 A;  4C3H C;  3S1M K;  3GTJ K;  2NVY C;  4X6A C;  3RZD K;  1Y1W K;  2E2J K;  3K7A K;  4A3B K;  1I6V A;  4G7H A;  5D4D A;  2R93 C;  3PO2 C;  3PO2 K;  3S2H C;  4A3J C;  3GTM C;  5C3E C;  4A3I C;  1TWG K;  3GTK C;  2JA7 K;  4BBS K;  4G7O A;  1SMY A;  3HOV C;  2R92 K;  1TWC K;  4A3C K;  4KMU A;  4A3L K;  1TWH C;  1TWF K;  2Y0S L;  3I4N C;  5C4J K;  4BY7 K;  2PA8 L;  3GTG K;  3H0G C;  1WCM K;  4A3L C;  2E2I K;  2BE5 A;  3HOU C;  5IYD K;  5C4X K;  3M3Y C;  2JA7 C;  1YNJ A;  4G7Z A;  5C3E K;  4MEY A;  5FLM C;  3GTP K;  3I4M K;  3CQZ C;  3S2D C;  5IYC K;  5M5Y K;  1K83 K;  3GTL K;  4LK0 A;  1BDF A;  4A93 K;  4OIP A;  2WB1 L;  3HKZ L;  2WAQ L;  3H0G K;  4BY1 K;  2JA6 C;  4OIR A;  3GTG C;  3S1N C;  4Y7N C;  4A3F C;  1HQM A;  2NVX C;  3HOV K;  3S15 K;  2O5J A;  1TWG C;  4OIN A;  3CQZ K;  4A3I K;  4YFK A;  1I6H C;  3S1Q K;  3M3Y K;  2WAQ D;  2JA5 K;  2A6H A;  3M4O K;  2E2J C;  1TWA C;  1I3Q K;  4C3I K;  5C44 K;  1WCM C;  2VUM K;  2E2H C;  3PO3 C;  3GTQ C;  3WOD A;  5C44 C;  2PPB A;  4QIW L;  1ZYR A;  3S1R C;  1R9T C;  2YU9 K;  4ZH4 A;  1IW7 A;  5FLM K;  5FJ8 K;  4YFX A;  5IP7 K;  3S14 C;  5M3F K;  3K7A C;  3HOU K;  3HOY K;  4YG2 A;  2B63 C;  5M5X K;  3GTQ K;  2NVY K;  4X6A K;  1I50 C;  4MQ9 A;  4YFN A;  2PMZ L;  4XSX A;  4LLG A;  4A3K K;  3I4N K;  2JA8 C;  3PO3 K;  1I3Q C;  2VUM C;  2JA5 C;  2PA8 D;  3RZO C;  4C3J K;  2PMZ D;  3S1Q C;  3HOW C;  4BBR C;  4QIW D;  2R93 K;  3GTP C;  4OIQ A;  4A3M C;  3I4M C;  3S16 K;  4QJV A;  1Y1V K;  1Y1W C;  3H3V D;  4XLP A;  3HOZ K;  1I50 K;  3HOZ C;  5C4J C;  3GTO C;  4A3G C;  5M5W K;  4JK1 A;  4C3I C;  3HOY C;  2R92 C;  2NVT C;  3S17 K;  1K83 C;  4Y52 K;  4A3M K;  2A69 A;  4Q5S A;  4A3J K;  3GTM K;  1I6H K;  4A3C C;  2A68 A;  4BBR K;  2NVQ K;  4GZY A;  1SFO K;  4MEX A;  5IYB C;  2O5I A;  3HKZ D;  2JA8 K;  3GTJ C;  3EQL A;  3RZD C;  4Q4Z A;  4A3D C;  4A3D K;  2JA6 K;  2R7Z K;  2B63 K;  1TWA K;  1TWC C;  4C2M K;  3M4O C;  5IP7 C;  5IYC C;  3GTL C;  4A93 C;  4BBS C;  3S16 C;  1SFO C;  3GTK K;  3S2H K;  5IP9 K;  4AYB D;  2NVQ C;  5IP9 C;  3RZO K; 
#chains in the Genus database with same CATH topology
 3GDZ A;  4XSZ A;  3CF5 S;  3MML B;  2Y0S D;  1VJE A;  1IE0 A;  2GSO A;  1TWF A;  3GTK A;  5TMF A;  3S1M C;  4C3H K;  1TWH K;  1TWH A;  2JH3 A;  3HOX K;  3DXJ A;  5DM7 S;  5JVG S;  1VGX A;  5IOR A;  4J3N A;  3H3V L;  4Y52 C;  1DCH A;  5IYD C;  3HOX C;  4A3B C;  1DCP A;  2E2I C;  4A3F K;  2A6E A;  4KN4 A;  2NVY C;  4A3B K;  4G7H A;  4FZB A;  1PJ6 A;  4IOC S;  4A3J C;  3GTM C;  1TWG K;  1TWG A;  2ZUE A;  3GEE A;  1XXC A;  4KMU A;  4A3L K;  3AH5 A;  4FM9 A;  3T01 A;  1EK8 A;  4A3L C;  2BE5 A;  3M3Y C;  3GTQ A;  4G7Z A;  3GTP K;  4MEY A;  1HI9 A;  3N0B A;  3FHZ A;  3GTL K;  4A93 K;  1K83 K;  3HKZ L;  1BS2 A;  1GE9 A;  3GTG C;  2RH6 A;  4A3F C;  4BLB A;  3HOV K;  3S15 K;  4WFB S;  2O5J A;  4A3I K;  1B4B A;  4YFK A;  2JA5 A;  1O28 A;  2GAG C;  1TWA C;  5IOT A;  5CJ9 A;  3N0C A;  3TTG A;  2PPB A;  3S1R C;  2YU9 K;  4LQY A;  4ZH4 A;  4GT9 A;  1ZBS A;  1O2B A;  1O25 A;  1O27 A;  1WQH A;  1RU0 A;  5M3F K;  1PJ7 A;  5M5X K;  2NVX A;  4MQ9 A;  2PMZ L;  2KPU A;  3OPF A;  3L4J A;  1I3Q C;  2VUM C;  2PA8 D;  3RZO C;  3S1Q C;  1TWC A;  4A3M C;  3S16 K;  1Y1V K;  1USO A;  2RGR A;  1BJT A;  3H3V D;  3HOZ K;  4A3G C;  4C3I C;  3HOY C;  1I6H K;  4A3J K;  3GTM K;  4GTL A;  2NVQ K;  1O29 A;  3SZZ A;  1I50 A;  5DM6 S;  4P5A A;  4Q4Z A;  2JA6 K;  2W7V A;  1SFO A;  3M4O C;  2CFA A;  5IYC C;  4BBS C;  3FOF A;  3S2H K;  4AYB D;  1IS1 A;  4C3J C;  3S15 C;  4BLA A;  4KM8 A;  5E68 A;  5JVO A;  4KN7 A;  2R92 A;  4PAA A;  1TWF C;  4BY7 C;  1YNN A;  4OIO A;  5IYB K;  1Y1V C;  3H0G A;  4A3E C;  4WFN S;  3FKI C;  3FKI K;  1XZQ A;  3HOW K;  1ZQ1 C;  1F7V A;  4P9S A;  2ZJQ S;  3CQZ A;  3BP3 A;  4Y7N K;  4BXX C;  3GTO K;  1J6X A;  3S1N K;  3PIO S;  1G51 A;  4X6A C;  1AB4 A;  4GTD A;  3RZD K;  4WJ4 A;  3N3Y A;  1Y1W K;  2E2H A;  5JVH S;  5D4D A;  2R93 C;  3S2H C;  1IBA A;  5C3E C;  2JA7 K;  4BBS K;  1SMY A;  2Y3P A;  3I4N C;  5C4J K;  2FQO A;  1WSR A;  2KQ1 A;  3H0G C;  1WCM K;  1WCM A;  2E2I K;  3HOU C;  1XZP A;  5IYD K;  3ERE D;  5FLM C;  4GTF A;  2ZJP S;  3AD7 C;  2JA6 A;  1BDF A;  4OIP A;  3OEP A;  4KC6 A;  3A8K A;  4G0V A;  3S1N C;  4GFQ A;  4Y7N C;  1HQM A;  2NVX C;  4O2D A;  4KAS A;  4PAB A;  2R93 A;  3GTM A;  3CQZ K;  3LAJ A;  1VRQ C;  1I6H C;  3M3Y K;  2WAQ D;  4C45 A;  2KWA A;  5C44 K;  1UV7 A;  1V5V A;  4KAT A;  1TWA A;  5C44 C;  1ZYR A;  3TFI A;  1R9T C;  4GTC A;  5EGH A;  5FLM K;  1K83 A;  1WOR A;  5TJ3 A;  1YCL A;  3HOU K;  2B63 C;  1I3Q A;  2VUM A;  2NVY K;  1O2A A;  4RMF A;  3PO3 K;  3ADA C;  4KM9 A;  1O2F B;  2PMZ D;  4G0W A;  4QIW D;  2ZUF A;  3I4M C;  1WOP A;  1Y1W C;  1ISE A;  3ORE A;  4XLP A;  1BGW A;  1I50 K;  4GTA A;  2V6U A;  3GTO C;  1Y1W A;  1J6V A;  5M5W K;  5L46 A;  4KB2 A;  4Q5S A;  3HXA A;  3VA7 A;  4BBR K;  4GZY A;  2B63 A;  3L4K A;  3FKI A;  3GTJ C;  2R7Z K;  1TWC C;  3GTJ A;  1WSV A;  4M1X A;  5IP7 C;  3GTL C;  4A93 C;  3S16 C;  1SFO C;  4GTB A;  4A3C K;  3BUE A;  1O26 A;  4XLN A;  4XCH A;  4BKW A;  2WB1 D;  4NOI A;  4A3E K;  5M3M K;  3RZO K;  3S17 C;  2NVT K;  2NVX K;  1XPP A;  4AYB L;  4P5B A;  1F7U A;  1JQW A;  3S14 K;  3S2D K;  1F9N A;  2YU9 A;  1C0A A;  2E2H K;  3AD9 C;  2L3U A;  2YU9 C;  3S1R K;  1J6W A;  4C3H C;  3S1M K;  2ZFZ A;  2KXY A;  1KQ4 A;  4GTE A;  3PO2 K;  5HQH A;  4A3I C;  4G7O A;  3HOV C;  3LPX A;  2R92 K;  1TWC K;  1TWH C;  2Y0S L;  3GTG K;  4IOA S;  5IOS A;  1WOS A;  1YNJ A;  1WQG A;  4WF9 S;  1R9T A;  3A8J A;  3CQZ C;  1XZQ B;  5M5Y K;  5IOQ A;  4KMA A;  2WB1 L;  1DD5 A;  4BY1 K;  4OIR A;  5JFE A;  1IQ0 A;  1EH1 A;  1TWG C;  4OIN A;  1B4A A;  1XXB A;  2P8T A;  4ILD A;  5HL8 A;  2JA5 K;  3M4O K;  1XXA A;  1WCM C;  4U67 S;  3PO3 C;  3WOD A;  4QIW L;  3GSI A;  4KB4 A;  3TFH A;  3FOE A;  5FJ8 K;  2PHC B;  4YFX A;  5IP7 K;  3S14 C;  1ZVU A;  3K7A C;  3AQP A;  3HOY K;  3T00 A;  3GTQ K;  4X6A K;  2XCQ A;  1YX2 A;  4YFN A;  1O24 A;  4LLG A;  3G4C A;  2JA8 C;  1VH2 A;  3GEH A;  3HOW C;  4BBR C;  3GTP C;  5HL7 S;  1USM A;  4JK1 A;  2R92 C;  1ZXO A;  4Y52 K;  2A69 A;  1WQF A;  2A68 A;  3GIR A;  4MEX A;  2O5I A;  4WCE S;  3EQL A;  4A3D C;  4A3D K;  3BP8 C;  3NUH A;  2B63 K;  1TWA K;  3GTP A;  3GTK K;  2E2H C;  2NVQ C;  5IP9 C;  2EBB A;  5C4X C;  4C2M C;  4QJV B;  3GTO A;  4LK1 A;  4A3G K;  4A3K C;  1Y1V A;  4BY1 C;  4BXX K;  1INN A;  3QX3 A;  4AH6 A;  4KDD A;  5TMC A;  3TFJ A;  2CW0 A;  4LJZ A;  1R9T K;  2ZJR S;  3G4A A;  3AQO A;  2R7Z C;  4G0U A;  3GTJ K;  2E2I A;  1IL2 A;  2R7Z A;  2E2J K;  3K7A K;  3GTG A;  1I6V A;  5EGE A;  3PO2 C;  3GTK C;  1TWF K;  1JVI A;  4BY7 K;  2PA8 L;  2GSU A;  2P5M A;  5C4X K;  2JA7 C;  5C3E K;  3I4M K;  4LOW A;  1EFW A;  3Q3Q A;  3S2D C;  5IYC K;  4LK0 A;  2XCO A;  3CAG A;  2WAQ L;  2D6F C;  3H0G K;  2JA6 C;  3A8I A;  3JST A;  4WJ3 M;  3S1Q K;  2FQT A;  2A6H A;  2E2J C;  1I3Q K;  4C3I K;  2VUM K;  4KAR A;  1DCO A;  3GTQ C;  4LR2 A;  2JA7 A;  3LYW A;  2L5N A;  1IW7 A;  3T02 A;  3V4G A;  4YG2 A;  3IPJ A;  1I50 C;  4XSX A;  3I4N K;  4A3K K;  1XZP B;  2CFA B;  2JA5 C;  4C3J K;  4KMH A;  2R93 K;  3GTL A;  4OIQ A;  1EI6 A;  4QJV A;  4KMD A;  1WIH A;  1EQR A;  3DLL S;  2GSN A;  3LAP A;  2V6S A;  3GEI A;  3HOZ C;  3AD8 C;  5C4J C;  1PJ5 A;  2NVT C;  3S17 K;  4WIL A;  1K83 C;  1L0W A;  4WFA S;  4A3M K;  4DDQ A;  1FEU A;  4A3C C;  1SFO K;  5IYB C;  1JOE A;  4KAW X;  3HKZ D;  5CHP A;  1VLO A;  2JA8 K;  3RZD C;  2V6T A;  3PIP S;  4IO9 S;  3S0X A;  1WOO A;  1F93 A;  4C2M K;  1X31 C;  2NVY A;  1J98 A;  3SZY A;  2XCR B;  5IP9 K;  2GAH C; 
#chains in the Genus database with same CATH homology
 4XLN A;  4A3E K;  2WB1 D;  4NOI A;  4XSZ A;  4C3J C;  5C4X C;  3S15 C;  5M3M K;  4C2M C;  2Y0S D;  3S17 C;  4QJV B;  2NVT K;  2NVX K;  1XPP A;  4LK1 A;  4AYB L;  4A3G K;  4A3K C;  5TMF A;  4KN7 A;  3S1M C;  4C3H K;  4BY1 C;  4BXX K;  1TWF C;  4BY7 C;  1TWH K;  1YNN A;  4OIO A;  3HOX K;  5IYB K;  3S14 K;  1Y1V C;  3DXJ A;  3S2D K;  5TMC A;  4A3E C;  2CW0 A;  3FKI C;  2E2H K;  3FKI K;  3HOW K;  4LJZ A;  3H3V L;  4Y52 C;  2YU9 C;  5IYD C;  3HOX C;  4A3B C;  3S1R K;  1R9T K;  2E2I C;  4Y7N K;  2A6E A;  2R7Z C;  4BXX C;  4A3F K;  3GTO K;  3S1N K;  4KN4 A;  4C3H C;  3S1M K;  3GTJ K;  2NVY C;  4X6A C;  3RZD K;  1Y1W K;  2E2J K;  3K7A K;  4A3B K;  1I6V A;  4G7H A;  5D4D A;  2R93 C;  3PO2 C;  3PO2 K;  3S2H C;  4A3J C;  3GTM C;  5C3E C;  4A3I C;  1TWG K;  3GTK C;  2JA7 K;  4BBS K;  4G7O A;  1SMY A;  3HOV C;  2R92 K;  1TWC K;  4A3C K;  4KMU A;  4A3L K;  1TWH C;  1TWF K;  2Y0S L;  3I4N C;  5C4J K;  4BY7 K;  2PA8 L;  3GTG K;  3H0G C;  1WCM K;  4A3L C;  2E2I K;  2BE5 A;  3HOU C;  5IYD K;  5C4X K;  3M3Y C;  2JA7 C;  1YNJ A;  4G7Z A;  5C3E K;  4MEY A;  5FLM C;  3GTP K;  3I4M K;  3CQZ C;  3S2D C;  5IYC K;  5M5Y K;  1K83 K;  3GTL K;  4LK0 A;  1BDF A;  4A93 K;  4OIP A;  2WB1 L;  3HKZ L;  2WAQ L;  3H0G K;  4BY1 K;  2JA6 C;  4OIR A;  3GTG C;  3S1N C;  4Y7N C;  4A3F C;  1HQM A;  2NVX C;  3HOV K;  3S15 K;  2O5J A;  1TWG C;  4OIN A;  3CQZ K;  4A3I K;  4YFK A;  1I6H C;  3S1Q K;  3M3Y K;  2WAQ D;  2JA5 K;  2A6H A;  3M4O K;  2E2J C;  1TWA C;  1I3Q K;  4C3I K;  5C44 K;  1WCM C;  2VUM K;  2E2H C;  3PO3 C;  3GTQ C;  3WOD A;  5C44 C;  2PPB A;  4QIW L;  1ZYR A;  3S1R C;  1R9T C;  2YU9 K;  4ZH4 A;  1IW7 A;  5FLM K;  5FJ8 K;  4YFX A;  5IP7 K;  3S14 C;  5M3F K;  3K7A C;  3HOU K;  3HOY K;  4YG2 A;  2B63 C;  5M5X K;  3GTQ K;  2NVY K;  4X6A K;  1I50 C;  4MQ9 A;  4YFN A;  2PMZ L;  4XSX A;  4LLG A;  4A3K K;  3I4N K;  2JA8 C;  3PO3 K;  1I3Q C;  2VUM C;  2JA5 C;  2PA8 D;  3RZO C;  4C3J K;  2PMZ D;  3S1Q C;  3HOW C;  4BBR C;  4QIW D;  2R93 K;  3GTP C;  4OIQ A;  4A3M C;  3I4M C;  3S16 K;  4QJV A;  1Y1V K;  1Y1W C;  3H3V D;  4XLP A;  3HOZ K;  1I50 K;  3HOZ C;  5C4J C;  3GTO C;  4A3G C;  5M5W K;  4JK1 A;  4C3I C;  3HOY C;  2R92 C;  2NVT C;  3S17 K;  1K83 C;  4Y52 K;  4A3M K;  2A69 A;  4Q5S A;  4A3J K;  3GTM K;  1I6H K;  4A3C C;  2A68 A;  4BBR K;  2NVQ K;  4GZY A;  1SFO K;  4MEX A;  5IYB C;  2O5I A;  3HKZ D;  2JA8 K;  3GTJ C;  3EQL A;  3RZD C;  4Q4Z A;  4A3D C;  4A3D K;  2JA6 K;  2R7Z K;  2B63 K;  1TWA K;  1TWC C;  4C2M K;  3M4O C;  5IP7 C;  5IYC C;  3GTL C;  4A93 C;  4BBS C;  3S16 C;  1SFO C;  3GTK K;  3S2H K;  5IP9 K;  4AYB D;  2NVQ C;  5IP9 C;  3RZO K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...