2A6CA

Crystal structure of a putative transcriptional regulator (ne_1354) from nitrosomonas europaea at 1.90 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
IHHHHHHMKMRSQLLIVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKIDLFSLESLIDMITSIGLKVEINIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of (np_841403.1) from NITROSOMONAS EUROPAEA at 1.90 A resolution
rcsb
source organism Nitrosomonas europaea
molecule tags Transcription
molecule keywords Helix-turn-helix motif
total genus 20
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13744 HTH_37 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2a6cA00
1PRAA 2IU7A 1RZRA 3JXCL 1RPEL 1PRUA 4I6RA 4FN3A 2BNMA 2EBYA 2LYJA 4X4CA 1GT0C 2HSGA 2PUFA 2BNNA 2CSFA 2CROA 3OP9A 4PU3C 2LYRA 4Z5CA 4X4BA 2WIUB 2PUAA 1UXDA 3QF3A 4Y42A 3QQ6A 4PU4C 3ZKCA 1IC8A 2OR1L 2PUGA 1XWRA 3QYXA 3EUSA 3FYAA 3FMYA 2R1JL 1LLIA 1RZSA 4Z5HA 3ZHIA 3F6WA 1DW9A 2AXVA 2LYSA 3G7DA 2LYPA 3LISA 3OQMA 3OQNA 3U3WA 1QQAA 2PUCA 4YG4A 4YG7B 2PUBA 1EFAA 1VPWA 4JQDA 3BDNA 2AXUA 2ICPA 1YSEA 2EF8A 2GRLA 2MQKA 2PIJA 3JXDL 2KEIA 1QP0A 1ZZBA 1OSLA 3IVPA 3TRBA 1ZPQA 1RIOA 1S7EA 1LMB3 3DNVB 3SCFA 3G5GA 4YARA 3UFDA 2XSDC 1QP4A 1JH9A 2XI8A 2HINA 2IVGA 2A6CA 4GQMA 1CQTA 2B5AA 1ZS4A 3F51A 1R63A 4X4IA 2D5VA 1ZZ8A 5K98B 1LQCA 1DWKA 4J1WA 2LYQA 1BDIA 3CROL 3GN5B 4PU8A 1Y7YA 3BS3A 4X4DA 1ZVVA 2LYKA 3PXPA 1CJGA 5A7LA 2KZ8A 1NEQA 3SCHA 3VK0A 3HZIB 4PU7A 2LYLA 2JCGA 3GN5A 4X4GA 1SQ8A 2IVQA 2BJCA 2FJRA 4I6TA 1L1MA 3KXAA 1POUA 2XJ3A 3KZ3A 4J1XA 4Z5DA 3JXBC 2JVLA 3LFPA 3D1NI 1E3OC 3L1PA 3CECA 1WH6A 2EWTA 4X4EA 4IWRA 3B7HA 1LCDA 4X4FA 4IVZA 1ADRA 1WH8A 4GHJA 2R63A 4I6UA 1OCTC 2MEZA 1JFSA 2H8RA 3BD1A 1ZZ9A 1ZZ6A 2PPXA 2O49A 1Y9QA 2AUWA 2GZUA 2AXZA 1QPZA 2GRMA 2AW6A 2O38A 1WIZA 2XCJA 1LCCA 2O4AA 2KPJA 4O8BA 4I8TA 1HF0A 4FBIA 3RZZA 3QWGA 1X2LA 4Z58A 1QQBA 3MLFA 1JWLA 4IA8A 1NERA 4JCYA 1ZUGA 2IUOA 2IVBA 4NDWA 2XIUA 1ZZ7A 3CLCA 1BDHA 1R69A 3H5TA 2KEJA 1QP7A 1RZRD 3OMTA 3R1FA 4YBAA 3SCGA 1JFTA 1WETA 1ZAYA 1UXCA 4OB4A 1PERL 3FYMA 2L8NA 2PUDA 2AWIA 2L49A 1UTXA 1O4XA 1ZZCA 3GBFA 2OFYA 2PUEA 3ZHMA 2BNOA 4MCTA 3S8QA 1AU7A 4JCXA 4Z59A 1PRVA 4X4HA 3KJXA 1PNRA 1X57A 2KEKA 4MCXA 2WUSR 1B0NA 2PE5A 2IV1A 2LCVA 4YG1A 3F52A 3O9XA 4F8DA 3OQOA 2ICTA
chains in the Genus database with same CATH superfamily
2LNMA 3VWSA 4I6RA 2BNMA 1GT0C 4X4BA 3QF3A 1IC8A 3ZKCA 3EUSA 1DW9A 2AXVA 3G7DA 3LISA 3LQXA 4YG7B 1VPWA 4JQDA 2YBDA 2AXUA 2PIJA 3JXDL 2KEIA 1OSLA 1U2ZA 3TRBA 3DNVB 5DTMA 4GQMA 2B5AA 3DM5A 1DWKA 3GN5B 4PU8A 2HFZA 2LYKA 1CJGA 2KZ8A 3SCHA 3NDBB 3GN5A 3MEJA 2FJRA 4I6TA 2XJ3A 4J1XA 3GUUA 2JVLA 3LFPA 5GAHi 4IVZA 1ADRA 3PE5A 3TEPA 1ZZ9A 3NXHA 1WIZA 1LCCA 3NZLA 5DRTA 4DE9A 4Z58A 3KL4A 1ZUGA 4NDWA 4EKIA 2XIUA 2MXDA 3H5TA 2KEJA 1QP7A 3OWQA 3ME5A 4YBAA 1WETA 2LLWA 3FYMA 2AWIA 2JQEA 1UTXA 1ZZCA 3GBFA 2OFYA 1PRVA 3KJXA 3OKZA 2FFHA 1B0NA 2PXVA 3O9XA 1PRAA 2IU7A 1RZRA 4OBMA 4FN3A 2EBYA 3QOXA 2HSGA 2CSFA 3A9XA 2CROA 4Z5CA 2WIUB 3GZCA 3A9YA 3QYXA 3FMYA 2R1JL 1LLIA 3OQMA 1DULA 4YG4A 2MQKA 2GRLA 2ODRD 4EQZA 3UFDA 2XSDC 2XI8A 2HINA 4DE8A 3A9ZA 3F51A 1R63A 3UWPA 1ZZ8A 4J1WA 2LYQA 1ZVVA 5A7LA 3QOWA 3VK0A 3HZIB 2PXBA 2IVQA 2BJCA 1L1MA 3KXAA 1POUA 3KZ3A 3L1PA 3B7HA 4GHJA 4I6UA 1JFSA 4EK9A 1Y9QA 2GZUA 2AW6A 2O38A 2XCJA 3GZDA 2KPJA 3ZPXA 3SR4A 4WVLA 1X2LA 3NROA 5DTRA 3MLFA 2IUOA 2L1PA 1RZRD 3OMTA 3SCGA 5DTQA 1ZAYA 1UXCA 2L49A 2PUEA 3ZHMA 2BNOA 3S8QA 4Z59A 4X4HA 1X57A 4Q2JA 2PXLA 2IV1A 2LCVA 3OQOA 4F8DA 2ICTA 1RPEL 3JXCL 4X4CA 2M4HA 2PUAA 4ER7A 1UXDA 4Y42A 4PU4C 1QZXA 2PUGA 2PXFA 1RZSA 4Z5HA 3ZHIA 1QQAA 2LYPA 2PUCA 1EFAA 3R09A 1YSEA 1QP0A 2HCNA 1MFQC 1ZPQA 1RIOA 3SCFA 1QP4A 2IVGA 1CQTA 2VEOA 4X4IA 5K98B 1LQCA 4ER0A 4X4DA 3BS3A 2LYLA 1QPZA 3D1NI 4IWRA 2XXQA 2PXPA 4X4EA 4X4FA 1WH8A 1OCTC 3TFLA 2H8RA 2PPXA 2O49A 2AUWA 2AXZA 2PXTA 2HCSA 2V3CC 2O4AA 4O8BA 4FBIA 3RZZA 2XXAA 1QQBA 1JWLA 1NERA 3TELA 4JCYA 1ZZ7A 3CLCA 3R1FA 1QB2A 1PERL 2PUDA 3SX0A 1O4XA 4MCTA 4ER6A 2KEKA 2PXEA 2WUSR 1NW3A 4YG1A 3F52A 2PXKA 1PRUA 2LLVA 2LYJA 3M9LA 2PUFA 2BNNA 3OP9A 4PU3C 2LYRA 3QQ6A 2OR1L 1XWRA 3FYAA 2PXUA 3F6WA 4EZIA 3U3WA 2LYSA 3OQNA 5JUWA 2XXPA 2PUBA 3BDNA 5GAGi 2ICPA 2EF8A 1ZZBA 5DSXA 3IVPA 1LMB3 1S7EA 3G5GA 4YARA 1JH9A 2A6CA 1ZS4A 2D5VA 4HRAA 1BDIA 3CROL 1Y7YA 4EKGA 3PXPA 2PXDA 1NEQA 4PU7A 2J7UA 2JCGA 4X4GA 1SQ8A 1E3OC 4Z5DA 3JXBC 3CECA 1WH6A 2EWTA 1LCDA 2R63A 5DRYA 1HQ1A 2MEZA 3BD1A 3QFIA 1ZZ6A 4ER3A 2GRMA 3GZDC 4I8TA 4ER5A 1HF0A 3QWGA 4IA8A 2J7WA 2IVBA 1BDHA 1R69A 1JFTA 3G0TA 4OB4A 2L8NA 1AU7A 5DT2A 4JCXA 1PNRA 4MCXA 2PE5A 2PXQA
chains in the Genus database with same CATH topology
1PRAA 2IU7A 1RZRA 3JXCL 1RPEL 1PRUA 4I6RA 4FN3A 2BNMA 2EBYA 2LYJA 4X4CA 1GT0C 2HSGA 2PUFA 2BNNA 2CSFA 2CROA 3OP9A 4PU3C 2LYRA 4Z5CA 4X4BA 2WIUB 2PUAA 1UXDA 3QF3A 4Y42A 3QQ6A 4PU4C 3ZKCA 1IC8A 2OR1L 2PUGA 1XWRA 3QYXA 3EUSA 3FYAA 3FMYA 2R1JL 1LLIA 1RZSA 4Z5HA 3ZHIA 3F6WA 1DW9A 2AXVA 2LYSA 3G7DA 2LYPA 3LISA 3OQMA 3OQNA 3U3WA 1QQAA 2PUCA 4YG4A 4YG7B 2PUBA 1EFAA 1VPWA 4JQDA 3BDNA 2AXUA 2ICPA 1YSEA 2EF8A 2GRLA 2MQKA 2PIJA 3JXDL 2KEIA 1QP0A 1ZZBA 1OSLA 3IVPA 3TRBA 1ZPQA 1RIOA 1S7EA 1LMB3 3DNVB 3SCFA 3G5GA 4YARA 3UFDA 2XSDC 1QP4A 1JH9A 2XI8A 2HINA 2IVGA 2A6CA 4GQMA 1CQTA 2B5AA 1ZS4A 3F51A 1R63A 4X4IA 2D5VA 1ZZ8A 5K98B 1LQCA 1DWKA 4J1WA 2LYQA 1BDIA 3CROL 3GN5B 4PU8A 1Y7YA 3BS3A 4X4DA 1ZVVA 2LYKA 3PXPA 1CJGA 5A7LA 2KZ8A 1NEQA 3SCHA 3VK0A 3HZIB 4PU7A 2LYLA 2JCGA 3GN5A 4X4GA 1SQ8A 2IVQA 2BJCA 2FJRA 4I6TA 1L1MA 3KXAA 1POUA 2XJ3A 3KZ3A 4J1XA 4Z5DA 3JXBC 2JVLA 3LFPA 3D1NI 1E3OC 3L1PA 3CECA 1WH6A 2EWTA 4X4EA 4IWRA 3B7HA 1LCDA 4X4FA 4IVZA 1ADRA 1WH8A 4GHJA 2R63A 4I6UA 1OCTC 2MEZA 1JFSA 2H8RA 3BD1A 1ZZ9A 1ZZ6A 2PPXA 2O49A 1Y9QA 2AUWA 2GZUA 2AXZA 1QPZA 2GRMA 2AW6A 2O38A 1WIZA 2XCJA 1LCCA 2O4AA 2KPJA 4O8BA 4I8TA 1HF0A 4FBIA 3RZZA 3QWGA 1X2LA 4Z58A 1QQBA 3MLFA 1JWLA 4IA8A 1NERA 4JCYA 1ZUGA 2IUOA 2IVBA 4NDWA 2XIUA 1ZZ7A 3CLCA 1BDHA 1R69A 3H5TA 2KEJA 1QP7A 1RZRD 3OMTA 3R1FA 4YBAA 3SCGA 1JFTA 1WETA 1ZAYA 1UXCA 4OB4A 1PERL 3FYMA 2L8NA 2PUDA 2AWIA 2L49A 1UTXA 1O4XA 1ZZCA 3GBFA 2OFYA 2PUEA 3ZHMA 2BNOA 4MCTA 3S8QA 1AU7A 4JCXA 4Z59A 1PRVA 4X4HA 3KJXA 1PNRA 1X57A 2KEKA 4MCXA 2WUSR 1B0NA 2PE5A 2IV1A 2LCVA 4YG1A 3F52A 3O9XA 4F8DA 3OQOA 2ICTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRA A;  2IU7 A;  1RZR A;  3JXC L;  1RPE L;  1PRU A;  4I6R A;  4FN3 A;  2BNM A;  2EBY A;  2LYJ A;  4X4C A;  1GT0 C;  2HSG A;  2PUF A;  2BNN A;  2CSF A;  2CRO A;  3OP9 A;  4PU3 C;  2LYR A;  4Z5C A;  4X4B A;  2WIU B;  2PUA A;  1UXD A;  3QF3 A;  4Y42 A;  3QQ6 A;  4PU4 C;  3ZKC A;  1IC8 A;  2OR1 L;  2PUG A;  1XWR A;  3QYX A;  3EUS A;  3FYA A;  3FMY A;  2R1J L;  1LLI A;  1RZS A;  4Z5H A;  3ZHI A;  3F6W A;  1DW9 A;  2AXV A;  2LYS A;  3G7D A;  2LYP A;  3LIS A;  3OQM A;  3OQN A;  3U3W A;  1QQA A;  2PUC A;  4YG4 A;  4YG7 B;  2PUB A;  1EFA A;  1VPW A;  4JQD A;  3BDN A;  2AXU A;  2ICP A;  1YSE A;  2EF8 A;  2GRL A;  2MQK A;  2PIJ A;  3JXD L;  2KEI A;  1QP0 A;  1ZZB A;  1OSL A;  3IVP A;  3TRB A;  1ZPQ A;  1RIO A;  1S7E A;  1LMB 3;  3DNV B;  3SCF A;  3G5G A;  4YAR A;  3UFD A;  2XSD C;  1QP4 A;  1JH9 A;  2XI8 A;  2HIN A;  2IVG A;  2A6C A;  4GQM A;  1CQT A;  2B5A A;  1ZS4 A;  3F51 A;  1R63 A;  4X4I A;  2D5V A;  1ZZ8 A;  5K98 B;  1LQC A;  1DWK A;  4J1W A;  2LYQ A;  1BDI A;  3CRO L;  3GN5 B;  4PU8 A;  1Y7Y A;  3BS3 A;  4X4D A;  1ZVV A;  2LYK A;  3PXP A;  1CJG A;  5A7L A;  2KZ8 A;  1NEQ A;  3SCH A;  3VK0 A;  3HZI B;  4PU7 A;  2LYL A;  2JCG A;  3GN5 A;  4X4G A;  1SQ8 A;  2IVQ A;  2BJC A;  2FJR A;  4I6T A;  1L1M A;  3KXA A;  1POU A;  2XJ3 A;  3KZ3 A;  4J1X A;  4Z5D A;  3JXB C;  2JVL A;  3LFP A;  3D1N I;  1E3O C;  3L1P A;  3CEC A;  1WH6 A;  2EWT A;  4X4E A;  4IWR A;  3B7H A;  1LCD A;  4X4F A;  4IVZ A;  1ADR A;  1WH8 A;  4GHJ A;  2R63 A;  4I6U A;  1OCT C;  2MEZ A;  1JFS A;  2H8R A;  3BD1 A;  1ZZ9 A;  1ZZ6 A;  2PPX A;  2O49 A;  1Y9Q A;  2AUW A;  2GZU A;  2AXZ A;  1QPZ A;  2GRM A;  2AW6 A;  2O38 A;  1WIZ A;  2XCJ A;  1LCC A;  2O4A A;  2KPJ A;  4O8B A;  4I8T A;  1HF0 A;  4FBI A;  3RZZ A;  3QWG A;  1X2L A;  4Z58 A;  1QQB A;  3MLF A;  1JWL A;  4IA8 A;  1NER A;  4JCY A;  1ZUG A;  2IUO A;  2IVB A;  4NDW A;  2XIU A;  1ZZ7 A;  3CLC A;  1BDH A;  1R69 A;  3H5T A;  2KEJ A;  1QP7 A;  1RZR D;  3OMT A;  3R1F A;  4YBA A;  3SCG A;  1JFT A;  1WET A;  1ZAY A;  1UXC A;  4OB4 A;  1PER L;  3FYM A;  2L8N A;  2PUD A;  2AWI A;  2L49 A;  1UTX A;  1O4X A;  1ZZC A;  3GBF A;  2OFY A;  2PUE A;  3ZHM A;  2BNO A;  4MCT A;  3S8Q A;  1AU7 A;  4JCX A;  4Z59 A;  1PRV A;  4X4H A;  3KJX A;  1PNR A;  1X57 A;  2KEK A;  4MCX A;  2WUS R;  1B0N A;  2PE5 A;  2IV1 A;  2LCV A;  4YG1 A;  3F52 A;  3O9X A;  4F8D A;  3OQO A;  2ICT A; 
#chains in the Genus database with same CATH topology
 2LNM A;  3VWS A;  4I6R A;  2BNM A;  1GT0 C;  4X4B A;  3QF3 A;  1IC8 A;  3ZKC A;  3EUS A;  1DW9 A;  2AXV A;  3G7D A;  3LIS A;  3LQX A;  4YG7 B;  1VPW A;  4JQD A;  2YBD A;  2AXU A;  2PIJ A;  3JXD L;  2KEI A;  1OSL A;  1U2Z A;  3TRB A;  3DNV B;  5DTM A;  4GQM A;  2B5A A;  3DM5 A;  1DWK A;  3GN5 B;  4PU8 A;  2HFZ A;  2LYK A;  1CJG A;  2KZ8 A;  3SCH A;  3NDB B;  3GN5 A;  3MEJ A;  2FJR A;  4I6T A;  2XJ3 A;  4J1X A;  3GUU A;  2JVL A;  3LFP A;  5GAH i;  4IVZ A;  1ADR A;  3PE5 A;  3TEP A;  1ZZ9 A;  3NXH A;  1WIZ A;  1LCC A;  3NZL A;  5DRT A;  4DE9 A;  4Z58 A;  3KL4 A;  1ZUG A;  4NDW A;  4EKI A;  2XIU A;  2MXD A;  3H5T A;  2KEJ A;  1QP7 A;  3OWQ A;  3ME5 A;  4YBA A;  1WET A;  2LLW A;  3FYM A;  2AWI A;  2JQE A;  1UTX A;  1ZZC A;  3GBF A;  2OFY A;  1PRV A;  3KJX A;  3OKZ A;  2FFH A;  1B0N A;  2PXV A;  3O9X A;  1PRA A;  2IU7 A;  1RZR A;  4OBM A;  4FN3 A;  2EBY A;  3QOX A;  2HSG A;  2CSF A;  3A9X A;  2CRO A;  4Z5C A;  2WIU B;  3GZC A;  3A9Y A;  3QYX A;  3FMY A;  2R1J L;  1LLI A;  3OQM A;  1DUL A;  4YG4 A;  2MQK A;  2GRL A;  2ODR D;  4EQZ A;  3UFD A;  2XSD C;  2XI8 A;  2HIN A;  4DE8 A;  3A9Z A;  3F51 A;  1R63 A;  3UWP A;  1ZZ8 A;  4J1W A;  2LYQ A;  1ZVV A;  5A7L A;  3QOW A;  3VK0 A;  3HZI B;  2PXB A;  2IVQ A;  2BJC A;  1L1M A;  3KXA A;  1POU A;  3KZ3 A;  3L1P A;  3B7H A;  4GHJ A;  4I6U A;  1JFS A;  4EK9 A;  1Y9Q A;  2GZU A;  2AW6 A;  2O38 A;  2XCJ A;  3GZD A;  2KPJ A;  3ZPX A;  3SR4 A;  4WVL A;  1X2L A;  3NRO A;  5DTR A;  3MLF A;  2IUO A;  2L1P A;  1RZR D;  3OMT A;  3SCG A;  5DTQ A;  1ZAY A;  1UXC A;  2L49 A;  2PUE A;  3ZHM A;  2BNO A;  3S8Q A;  4Z59 A;  4X4H A;  1X57 A;  4Q2J A;  2PXL A;  2IV1 A;  2LCV A;  3OQO A;  4F8D A;  2ICT A;  1RPE L;  3JXC L;  4X4C A;  2M4H A;  2PUA A;  4ER7 A;  1UXD A;  4Y42 A;  4PU4 C;  1QZX A;  2PUG A;  2PXF A;  1RZS A;  4Z5H A;  3ZHI A;  1QQA A;  2LYP A;  2PUC A;  1EFA A;  3R09 A;  1YSE A;  1QP0 A;  2HCN A;  1MFQ C;  1ZPQ A;  1RIO A;  3SCF A;  1QP4 A;  2IVG A;  1CQT A;  2VEO A;  4X4I A;  5K98 B;  1LQC A;  4ER0 A;  4X4D A;  3BS3 A;  2LYL A;  1QPZ A;  3D1N I;  4IWR A;  2XXQ A;  2PXP A;  4X4E A;  4X4F A;  1WH8 A;  1OCT C;  3TFL A;  2H8R A;  2PPX A;  2O49 A;  2AUW A;  2AXZ A;  2PXT A;  2HCS A;  2V3C C;  2O4A A;  4O8B A;  4FBI A;  3RZZ A;  2XXA A;  1QQB A;  1JWL A;  1NER A;  3TEL A;  4JCY A;  1ZZ7 A;  3CLC A;  3R1F A;  1QB2 A;  1PER L;  2PUD A;  3SX0 A;  1O4X A;  4MCT A;  4ER6 A;  2KEK A;  2PXE A;  2WUS R;  1NW3 A;  4YG1 A;  3F52 A;  2PXK A;  1PRU A;  2LLV A;  2LYJ A;  3M9L A;  2PUF A;  2BNN A;  3OP9 A;  4PU3 C;  2LYR A;  3QQ6 A;  2OR1 L;  1XWR A;  3FYA A;  2PXU A;  3F6W A;  4EZI A;  3U3W A;  2LYS A;  3OQN A;  5JUW A;  2XXP A;  2PUB A;  3BDN A;  5GAG i;  2ICP A;  2EF8 A;  1ZZB A;  5DSX A;  3IVP A;  1LMB 3;  1S7E A;  3G5G A;  4YAR A;  1JH9 A;  2A6C A;  1ZS4 A;  2D5V A;  4HRA A;  1BDI A;  3CRO L;  1Y7Y A;  4EKG A;  3PXP A;  2PXD A;  1NEQ A;  4PU7 A;  2J7U A;  2JCG A;  4X4G A;  1SQ8 A;  1E3O C;  4Z5D A;  3JXB C;  3CEC A;  1WH6 A;  2EWT A;  1LCD A;  2R63 A;  5DRY A;  1HQ1 A;  2MEZ A;  3BD1 A;  3QFI A;  1ZZ6 A;  4ER3 A;  2GRM A;  3GZD C;  4I8T A;  4ER5 A;  1HF0 A;  3QWG A;  4IA8 A;  2J7W A;  2IVB A;  1BDH A;  1R69 A;  1JFT A;  3G0T A;  4OB4 A;  2L8N A;  1AU7 A;  5DT2 A;  4JCX A;  1PNR A;  4MCX A;  2PE5 A;  2PXQ A; 
#chains in the Genus database with same CATH homology
 1PRA A;  2IU7 A;  1RZR A;  3JXC L;  1RPE L;  1PRU A;  4I6R A;  4FN3 A;  2BNM A;  2EBY A;  2LYJ A;  4X4C A;  1GT0 C;  2HSG A;  2PUF A;  2BNN A;  2CSF A;  2CRO A;  3OP9 A;  4PU3 C;  2LYR A;  4Z5C A;  4X4B A;  2WIU B;  2PUA A;  1UXD A;  3QF3 A;  4Y42 A;  3QQ6 A;  4PU4 C;  3ZKC A;  1IC8 A;  2OR1 L;  2PUG A;  1XWR A;  3QYX A;  3EUS A;  3FYA A;  3FMY A;  2R1J L;  1LLI A;  1RZS A;  4Z5H A;  3ZHI A;  3F6W A;  1DW9 A;  2AXV A;  2LYS A;  3G7D A;  2LYP A;  3LIS A;  3OQM A;  3OQN A;  3U3W A;  1QQA A;  2PUC A;  4YG4 A;  4YG7 B;  2PUB A;  1EFA A;  1VPW A;  4JQD A;  3BDN A;  2AXU A;  2ICP A;  1YSE A;  2EF8 A;  2GRL A;  2MQK A;  2PIJ A;  3JXD L;  2KEI A;  1QP0 A;  1ZZB A;  1OSL A;  3IVP A;  3TRB A;  1ZPQ A;  1RIO A;  1S7E A;  1LMB 3;  3DNV B;  3SCF A;  3G5G A;  4YAR A;  3UFD A;  2XSD C;  1QP4 A;  1JH9 A;  2XI8 A;  2HIN A;  2IVG A;  2A6C A;  4GQM A;  1CQT A;  2B5A A;  1ZS4 A;  3F51 A;  1R63 A;  4X4I A;  2D5V A;  1ZZ8 A;  5K98 B;  1LQC A;  1DWK A;  4J1W A;  2LYQ A;  1BDI A;  3CRO L;  3GN5 B;  4PU8 A;  1Y7Y A;  3BS3 A;  4X4D A;  1ZVV A;  2LYK A;  3PXP A;  1CJG A;  5A7L A;  2KZ8 A;  1NEQ A;  3SCH A;  3VK0 A;  3HZI B;  4PU7 A;  2LYL A;  2JCG A;  3GN5 A;  4X4G A;  1SQ8 A;  2IVQ A;  2BJC A;  2FJR A;  4I6T A;  1L1M A;  3KXA A;  1POU A;  2XJ3 A;  3KZ3 A;  4J1X A;  4Z5D A;  3JXB C;  2JVL A;  3LFP A;  3D1N I;  1E3O C;  3L1P A;  3CEC A;  1WH6 A;  2EWT A;  4X4E A;  4IWR A;  3B7H A;  1LCD A;  4X4F A;  4IVZ A;  1ADR A;  1WH8 A;  4GHJ A;  2R63 A;  4I6U A;  1OCT C;  2MEZ A;  1JFS A;  2H8R A;  3BD1 A;  1ZZ9 A;  1ZZ6 A;  2PPX A;  2O49 A;  1Y9Q A;  2AUW A;  2GZU A;  2AXZ A;  1QPZ A;  2GRM A;  2AW6 A;  2O38 A;  1WIZ A;  2XCJ A;  1LCC A;  2O4A A;  2KPJ A;  4O8B A;  4I8T A;  1HF0 A;  4FBI A;  3RZZ A;  3QWG A;  1X2L A;  4Z58 A;  1QQB A;  3MLF A;  1JWL A;  4IA8 A;  1NER A;  4JCY A;  1ZUG A;  2IUO A;  2IVB A;  4NDW A;  2XIU A;  1ZZ7 A;  3CLC A;  1BDH A;  1R69 A;  3H5T A;  2KEJ A;  1QP7 A;  1RZR D;  3OMT A;  3R1F A;  4YBA A;  3SCG A;  1JFT A;  1WET A;  1ZAY A;  1UXC A;  4OB4 A;  1PER L;  3FYM A;  2L8N A;  2PUD A;  2AWI A;  2L49 A;  1UTX A;  1O4X A;  1ZZC A;  3GBF A;  2OFY A;  2PUE A;  3ZHM A;  2BNO A;  4MCT A;  3S8Q A;  1AU7 A;  4JCX A;  4Z59 A;  1PRV A;  4X4H A;  3KJX A;  1PNR A;  1X57 A;  2KEK A;  4MCX A;  2WUS R;  1B0N A;  2PE5 A;  2IV1 A;  2LCV A;  4YG1 A;  3F52 A;  3O9X A;  4F8D A;  3OQO A;  2ICT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...