2A6DB

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide rlliadppspre
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
219
Chain Sequence
EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSVYYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Germline antibody 36-65 Fab light chain
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
total genus 39
structure length 219
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dB02
1JF5A 1JUFA 4I4WB 1QBLH 1TLKA 2A6DA 4L3EE 4P2RE 1J9CT 8CGTA 4PREB 2VR4A 1IEAB 3QDGB 3IVKA 2DQCL 5JXEC 4UT6H 4HIEA 1AD0B 3MFGB 3NMEA 5IB4B 1UB6B 1VCAA 4JRXB 4L5FH 5T3ZL 2B7DT 4QRPD 5A2KH 3KLHC 3KPRD 2IPKB 3L5IA 3QJFA 1K3ZA 3RDTC 4OV5A 3QHZL 4UTAH 2R15A 4P46D 4WO4B 3TNNB 3DGCR 3CUPA 3GJFB 5JHDD 1OGAD 5JO5A 1EJ6A 3SQBA 3VD9A 1BVKA 1A7NL 4HS3A 3VXQB 5IW1A 3C8KB 5GPRA 4ZUUA 3FO0H 3DX7A 3F58L 4I3RL 5J1AA 4ZFZB 4P49A 1RZIA 4ZTOL 3UTTE 1UM4L 4E0RA 2W65B 2C3HA 4GAJL 4PRPB 2QQNH 3AM8A 3HR5B 4HEME 5EBMB 4PIRF 4EN3B 5E5MB 2APXA 4G5ZH 2HJKB 2R8SL 4DK3A 4HGMA 2UV3A 4FMKA 2AK4D 3U4EB 1UJ3C 4JPKL 3DRTA 4P2CG 5D7JB 4FQIL 1CLYL 4GRLB 1HKLH 1YZZA 1CYGA 1A7QH 5HHNA 1KJVA 1QSFB 2H32A 4YHNA 3SDCA 3X3GL 4J7RA 1A6ZB 4JHAH 1S9VB 3OR7B 1MIML 4IHOA 1MFCL 1HE7A 4F3FB 1WIPA 4S10A 1OARH 4NKDB 4Q6YA 4Q9QL 4L9DA 1BJ8A 1GGUA 2DBLL 1YYML 4J6RL 4GW1A 4R90H 4MSWA 5F7DA 4P9ML 4I5BB 4AL8L 1XF3A 4LPWA 1RZ8B 3SJVA 4BELD 1KLFA 4Y4HB 5JTWA 3MSPA 3H8NA 3BAEL 4OD1L 1W72H 4MXQC 4FZEL 3BP4A 5HHVH 3DBXA 2Y36L 5C0CA 3FQRB 4XPFL 3WNMA 4GW4B 5T33L 3HNVH 3OXSA 5J57B 3MOQA 4BFEA 1DVFA 2P8MB 2EYSB 4QRUB 4WI2A 5DJZA 1NC2D 3G6JB 3O6LH 4RISH 2VL5A 3HI5L 3MODH 3W11C 3NPSC 1JJUA 4WDIA 1YPZF 5IV2A 3RWDB 1IT9H 1IM3A 3GSUB 1Y6MR 4MS8D 2BVQA 3DROB 2VXSH 4U31A 3V6OC 4N8VB 3IFPB 5JOFB 4NGHL 5L6YH 1F8TL 2P1YA 5JXAL 1KCKA 5FHBH 1U92A 1LQSR 1QHPA 5FO9A 1WIOA 2HVKA 4Y16D 4LSVH 5JW4N 4X4ME 1XGQB 4MWFA 1R3KA 3QWOB 3J8F7 2E7LC 4PY7A 3O45B 3DVFA 4X9BA 3LY6A 4NO0B 5CZKA 4JDVA 2IH1A 4LNRB 5JXED 5EORH 3BN9C 2FBOJ 4WUUE 1MFEH 3KLHD 1CN4A 1E28A 2HT3C 4WENB 1DBBH 1K8DB 4XMLH 3RDTD 1MCEA 5HHQA 2CUMA 1JPGB 2JJUA 4GQ9H 3ISWA 4QHUB 3T4AA 4JQXC 3HUJA 8FABA 5EO9A 1OSPL 4Y1AD 3ZYZA 4XNXL 2PXYC 1MAKA 4NQED 1J1XL 2EC9U 4RWYH 3WDJA 4PJBF 3VFMA 5DD6B 4WEMB 4PJ9B 3FHAA 2FJGB 4YIQB 5HPOA 1NMBL 5L0QB 4Y19E 3C09C 2OJZL 4NZDA 5C07D 4O5LL 1UEYA 1FN4A 3STLB 3D3VD 5EBGA 3V6FB 1M05A 2DD8L 4IS6A 3WS6A 4PBVC 5IT2H 2F53D 3RJDA 3VRJA 3CMOH 5KSUA 3SE8H 3FO9B 3O2DA 1ONQB 3NAAL 2MJWA 3VMOA 4OGZA 3R06A 1S7WB 1D5XB 4JKMA 4NPYA 5IBUG 5IESH 3VRIA 3KDMA 3OKDB 5FDWA 3QIWA 1NEZB 2P8LA 1AI1H 3P9LB 4E5XA 1G7PB 1T0NB 4ERSH 5DT1L 2ZKHH 3WFHB 4PJHF 3LV3B 3D1MC 3W0WB 4JREC 5ENWB 3VFGL 3L3GB 1WC7A 2J1KA 2QADC 3GI8H 2RFXA 5D6DC 3Q3GA 4NQVA 3GSWA 3FTGB 2B4CH 1RJZA 2F54D 1S3KH 3Q5YA 1RUQL 5GIRA 5EC1B 2R4SH 3MV11 3CDCA 3U0PB 2VNCA 4XCFH 2HLAA 3QPQC 1ADQH 4Z7UF 1DFBH 5KS9F 3D0LB 4MXQD 2MNUA 4QXWA 4PJFE 2Q8BL 1DDHB 3EO9H 3ULUC 5IM7B 5LG1A 3VWJB 1IGIL 1T7WA 3ULSA 1EEUA 4P23C 3RUGE 1IAIM 5BO1L 5E9DB 3K2MC 1JGEB 4JZOA 2W91A 4RGOL 4YDIL 3S96B 3NZHH 2RHEA 4XMPH 1LDSA 4I0PC 4WW2A 3MLRH 3W11D 5MEOA 3RZCA 4JFXB 4HZLB 4L4JA 5EU7C 5I6XC 2IBZY 3OPZH 1D6VH 2W9EH 4MZ2A 3O3BA 1A7OH 4L9LA 1U93B 3NIFE 2IPUK 4XT1C 1C08B 2VQ1B 5DD0H 5GGRA 1I3GH 3O9WC 4AEFA 1BBJA 1FZOA 3EYQC 3B5TA 1FNSH 4HIXH 3KJ6H 4GKSA 5KG9B 4OFYA 5D1XB 5DC4B 5MEQB 3CC5B 2WP3O 4JAMA 1L6ZA 2DQEL 4RMWA 3HG1E 1B0RB 1YEEH 5CJBA 3GSRA 2BNRA 4ODVL 4I2XB 1JGUL 4K3GA 3VWKC 4KPHH 1A6PA 1WTGT 5DEGB 3BN9D 4QGTA 3OJDA 4HH9A 2HT3D 2AABH 5I30L 4JVUA 1AH1A 1KTLA 1P9MC 2VLKA 4HPOL 3JTTB 5CJXC 3T2QA 1MI5E 2YA2A 2DJUA 5DK2B 1R24A 3SKNA 2GEEA 4EDWH 1HHIB 1T1WB 1BOGA 2LU4A 2PXYD 1T20A 1MWAA 3IAGC 3MBEA 3QNYB 4YDJA 4Y2OA 4ZPTA 2EO9A 1TTUA 3UO1L 3X3FL 4NQCB 1KCUL 1BF8A 4WI4A 4PGCB 3OKNB 4M93C 4ZAKA 5EWIL 4MJIE 4ZMAT 5I8KL 1TVHA 4PB0H 4KKBC 2B0SL 4E41E 1YEIL 2DIJA 3WS3A 4AG4H 1VERA 4PJ5B 1QR1A 4YHKH 1PY9A 1K4DB 3U2SA 1GHFL 4FFWC 3FT4A 5HD8C 3HMWH 4LU5H 3VXUB 1B4JL 3WN5B 5FYJL 5INCA 5CAYB 1HXYA 1LE9A 1IBGL 3O8XB 3PWNA 4FXGB 5CEXB 2NY4C 1KELH 2QADD 4TVPL 1UG9A 4OIBA 2Q7YA 5I17A 4FABH 4M9PA 4OAWA 3JWDL 5EIVA 5I18H 3NCCB 4ELKA 2IAMC 1DCLA 2BHZA 4G6FB 1RUML 2XXMB 3CFEB 3MOAL 4QF1B 5ESAB 1ETZB 1H3TA 5EU6D 1R3LB 3QPQD 4H25A 4NQXB 2A77L 3MRCB 1PG7L 1BP3B 1UCBL 2GT9B 3RNQB 4DKFL 4M5YL 3S5LG 2Z31C 3ZE1E 1G9NC 1BWWA 3IAQA 5HGHA 5IR1A 4QHNB 4B41A 5FCUL 3ULUD 2VQTA 3FFDB 4OF0A 1MLCA 4F7EA 1GZPB 4P23D 4ETQB 5C0IB 1X9QA 4NNPH 1CFTB 4IDJH 2JJTA 4NZRH 3WUWB 5JDSB 3G08A 3QQ3B 2YD8A 4FQLL 4CMMB 1CDUA 4I0PD 4NRYA 3C6LB 3SE9L 5F7NC 1A4KA 2HRLA 1HXMB 3BDXA 5GRJL 2NY3C 1RJYB 2ZCHL 1Q8MA 1RJLA 3BUYA 1JPSL 3PE9A 3QXVA 4QHKI 1U8OA 5KSBB 1H8SA 4OSUL 3UTPD 4FZ8H 1TZGH 4C4KT 1T5WA 3CSPA 3O9WD 2X6MA 4R7DB 4G8EB 3WJJA 3EYQD 2VDNL 5K9QI 2CDGA 4WHDA 1YN6B 4URTB 4V1DD 3C60A 4WI5A 4ZOBA 4K55A 3UJTL 5F96H 1QVOB 4HJJH 3DI2B 3T0WA 1J0HA 5HYJB 3TYFB 1KN4H 2BSSA 1I1FB 1IFHL 3SKJL 4LPCA 3FFCE 3EKCA 3MJGX 5GGSA 1JYNA 1AD9B 3F7YB 3AROA 3FCTB 5E03A 3VWKD 1CGUA 3TM6A 4L8SC 3GMOB 1ES0A 1MCBA 2QSCL 5BZDA 4LCWD 3WUZA 2Q86B 43C9A 3HPJA 4RX4A 3AU1B 2VIRB 4DUXA 4OD2A 3W39A 4P5KB 3S3PA 5DHXB 5GGTL 5DUBA 3KJ4C 3D2UB 2Q76A 3MLVL 1Z5LA 1ZEAH 2HKFL 4LAQH 5BQ7B 4DGIH 2FEDC 1LD9B 3FN0L 3REWA 3GHEH 1MJ8L 3OAUL 3U9UB 1P84K 4X6CA 4P46A 2A9NL 1Y18A 4FTVB 3BPNC 4HV8B 2CUHA 5EULV 1UB5A 2X4NA 5JHDA 3KPSA 1IM9B 1OGAA 4YHPB 3HI6L 3TBWA 2VLRE 1EHNA 4OJFH 4JB9L 3MLYH 4QHLB 5HHOB 1CF8L 1MCIA 4PRBA 1BPVA 3L3IB 4CW1B 3D18B 3ARYA 4KKBD 4PJCB 3QBTB 4XH2A 1RHHA 1QRND 5DDHA 2NX5B 4MNQE 2E27L 2WSKA 5HYQA 3GMNB 3WFBL 3CDGA 1F4YL 1FL5A 5E6IB 4HC1L 5H2BB 3H3PL 1JF1B 4FFWD 5HD8D 5TGBA 1AJ7L 1B2WH 4P3CH 1HKFA 4Q97A 4KUCF 3G6DH 3MMEB 2PW2B 4W68A 1XIWA 3GUTB 2NY4D 4D0CA 2XWBB 1T1YB 4QYOB 3VFVB 2AK4A 4DUVA 1ZGLM 5E8DH 3O4LD 3WKMH 1ZVHA 2Y6SC 2CRMA 4G42B 1GZQA 1MRCL 5BZWA 3HE6C 3G5XA 4M1GL 3BH8B 1FVCB 3IDJB 1BD2A 2XNAB 1NC4B 2IAMD 3GSVB 2PNDA 3DIFA 1INQA 2FL5A 2W38A 4K3JH 4XVJL 2YD3A 3TBYB 1I85A 4JFYB 2I07A 5F9DC 2V2TA 1ZLUK 4J8RA 2Z31D 4R4FL 2OR9L 2OP4H 2UZXB 3HE7B 3ORJA 4DGVL 5CP7A 4MJ5B 4D8PB 2BJMH 3OKLA 5IQ7H 5D7IA 2F8XC 4NQDB 1RFDH 4XNYL 1AQDB 5D1QC 4YNYB 3RPIA 2BC4B 4Q0XL 3R8BB 3D39A 4OZ4A 2SEBB 1OVZA 2NY3D 3RIFK 1HHHB 4XPTL 3MUJA 5FF6B 3RWFA 4MB4A 3UJJH 3P11L 2EYTB 3I50L 4YDKH 3S35H 4UT7L 1D9KC 3QFDA 3HAEB 4GXVH 4LRIA 4XX1G 3TVMC 4XAWH 2O5ZH 4JDZB 4PRHD 1M7XA 4MYWB 5F3BB 1X5XA 4MA7L 4BQBA 4E42A 4CN1A 1KNOB 3GSNH 4AZ8A 4KV5F 2G2RA 4MVBC 2CJUH 2X1PA 5AEAA 1WF5A 3SE4A 4D9LL 4QRSB 1RZJH 4XCCL 1PSKH 3JV5A 5C2BH 3BRGC 3MRRB 1W72A 3HC4H 3REVB 3PGCB 3B9KB 1BQHB 1EPFA 3C5JA 3L5XH 5HGDA 5IB5B 2GSIB 4NRXA 1S7UA 1SHMA 3OZ9L 4PRAB 3LQAL 1ITBB 4JFFB 3QUML 5D71L 4P5MB 2ADGB 3EFDL 1KTRL 1D5BA 5DQDH 3VG9B 5B39G 2C4FT 2DLTA 4PB9L 7FABL 2W0FB 5EN2B 4X9IA 5IW6A 6CGTA 2XN9E 4C58B 3W2DL 2DJSA 3TN0A 4HWUA 4ELMF 3EO1B 3H3KA 4FQ2H 5L88H 5IB3B 1IGFH 1HYRC 2OTWB 1FNGA 3MX0A 2DDQL 4KZDH 2VDOH 4O4YL 3TH3T 1F3DJ 3C08H 2EECA 4XPAH 3UYPA 3F6IA 1RUPL 5BVJB 4ZXBB 4NYLA 2I60L 4Z95H 1CQYA 1AGEB 1QOKA 3BPOB 3LB6C 3IDNA 4C56A 5HGBA 3CU7A 3PHOB 4UB0H 3HA0A 3CFBA 1FP5A 1DBML 3EOBA 1E27A 1Z0MA 4HWZB 4Y1AA 3VFNA 4NQEA 3ARDC 3ZYOA 4LLMA 5I1KL 1A0QL 3P4OB 4IRZH 3VXTB 1AGFA 2PF6A 1DANT 1JN6A 3KPQB 3LRSA 4U1NB 1ZAGA 3MYZA 1FFPB 1MRDL 3BZFA 4LCUB 3N50A 5F88B 2EEAA 1A14L 1FNAA 1NSNL 3D3VA 3VFSA 5LQBH 5BOZG 1JGDB 2IANE 2VDKL 1DP0A 4CMHB 2D0GA 5KVDL 3HC3H 4EVNB 1UJ3A 1X4YA 5GSRA 2Y6SD 3FB8A 3I75A 3LD8B 3JWOH 3HE6D 1CS6A 3UTSB 1F4AA 3BZDA 1FLTX 1YPZE 2C26A 2XV6B 3RL2A 5I1LB 3ARFC 3P4NA 1OAZL 1R3IH 3SCMA 2CKBB 4P2RD 4NJAL 2A83A 2VABB 4KI5F 1HHKB 4L3CA 3P77B 5C0EB 2X05A 4K3EH 4WHTB 3O41B 4OQTL 2A1WL 2BVOA 2F54A 2ZUQC 3SGKC 43CAB 5E2TH 5EUOA 1N59A 2CXGA 4MCYA 2BVPA 3BEVA 4OBRA 4GG6A 4E9LA 3PWPB 5BJTA 5D1QD 1R5IB 2VXVH 2IF7A 5E2WL 1BZ7A 1NBZB 3VA6A 1JV5A 5SWSE 3L5JA 1PKQB 1NGYB 3SDDB 1GSMA 2A9MH 5TE4H 4KROB 3U7WL 5GRZA 5JNYA 2XZCH 1CD9B 4HMEA 3EYOA 3H42H 2CR6A 2CD0A 1MCNA 3I9GL 3SHSA 5C0AE 1D9KD 2HRPH 2QQQA 2JK5A 5IQ9B 4KVNH 3BZ4B 2A6DB 1LK3L 1NAMH 4H8WL 4NC1C 4YDVB 5IB2A 1KIUA 2YD4A 4MVBD 4KDWA 1PQZA 2X1OA 4OGXH 4GRMA 4W70A 2JCCB 3BKYL 4HIEB 5E8EA 4L8CA 1JTOA 1T6WA 1P84J 5D8JL 1NCAL 1LE5A 1I75A 1RJCA 5BW7C 2UZYB 1ADQA 3MRHB 3V6OA 4R0LC 4F7PB 4PJBE 5CEYA 3QUYC 2VR5A 3GI9H 4Y2DD 5JO5B 1EO8H 1EMTH 5ISZA 2W07A 5EOCL 3VGBA 3BRDA 3LS5H 4PJAB 4ONFH 4DAGL 2JELL 3Q5OA 2D03L 4XC3L 4HS3B 4KJYB 2AK1H 5ADPH 3QNZA 2DQUH 5SWQA 1EFQA 2ICWB 2K7QA 4QHKJ 3V4PL 3V6BR 3RFZC 4NUGL 3IDGA 4E0RB 4QRQA 2ED7A 1P53A 2EKJA 1HIML 3R1GH 3NFNA 3WFCL 1N6VA 4Z7WB 4U05A 3IFLL 3G04B 1TZHB 2E7CA 4K23L 4YHYB 1FIGL 1KCVL 4PJHE 5H37H 3VGEA 3CH8A 4AEEA 2R29H 2PW1B 5DYOB 3MGOB 3OAYK 5F6IB 2XFXA 3LB6D 1A64A 3WIHH 3GJFK 4P2OA 4QOKD 3TV3H 4IRJC 5DJCB 3OKYA 3I3DA 5TH2B 3WE6A 1UKQA 3ZKSD 2H32B 1V8HA 1EZVX 1KTKE 4DQOH 3ARDD 4YLQT 4HUXB 2DMKA 4IHOB 4TNWK 4WWKB 5I1GL 4AJ0A 2XN9A 5KS9E 1PZUB 1SJHA 1VGKA 3SBWC 1CICB 1U6AH 2ICEA 4B0MM 1QLEL 5F7DB 1BBDH 2ZCKL 4FXKB 2FD6H 5ESQB 1G1YA 2YC1B 4TQEL 4JY5L 4BSWB 1NDMB 1FV1B 2NPLX 3ARGA 3BP4B 5C0BE 1BIIA 1RUKL 1G7JA 4BZ2L 4MAYC 3ARFD 1S7QB 1F3DH 3WSQH 5HHXH 4JN2A 1MCLA 1K6QH 1X44A 1NGQL 4M3JA 1DVFB 1URLA 1ERNA 4WUUD 3RBGA 4AT6B 2CDEA 4DN3H 4M43H 3K8MA 3Q6GL 3ELAT 3WBDA 3ULVF 3A6CH 3NA4A 3T0DA 3ZL4H 4DK6A 1FVDB 2C7UA 4OZHE 2HP4A 2DKSA 3ABZA 1V05A 1MFAL 3HZMA 4FS0A 1U92B 2R4RH 3WEXA 5FO9B 4CVZB 2VKWA 1FSKC 1QBMH 3MUZ1 4NZTH 4YE4H 4P23A 3NZ8A 2BFVL 4PV9B 5IVZA 1OM3H 4PUBL 3EGSB 4NHUB 2IWGA 4NBZB 5K33A 4X99A 2ARJB 3L1OL 4NRZB 4LGRB 2BY0A 1BQUA 3L7FA 1KN2H 1DE4B 1MY5A 5J6HA 4I0KA 2IH1B 4MXWH 4JZNA 4O9HH 4QRRE 2PN5A 1S7RA 3D85B 3DV4A 4XWGL 4N5EC 2GUOB 5DD5H 1A1MA 3WIFB 1FNLA 2NY7L 5HHQB 4NUJB 4JKPL 1NKOA 1I8KB 5EZJB 2NTFA 4A6YL 3ZTJH 4IJ3B 4O2EA 3T4AB 1KACB 3IDXL 3HUJB 4JO2L 8FABB 5EO9B 5J6GA 2EEDA 1J86A 2OS7A 5ANMB 1G9ML 2R69L 1LDPL 1XF4A 4KAQH 4OKDA 1N5YH 1KCRH 2YXFA 1I7UB 4DCQB 1SBSL 2Z93B 3FOLB 4Y5YC 5BVPL 3MRBA 1EAPB 2H3NA 2P5WA 1T6VN 1OAUL 3TJEH 3TCXA 2VTFA 4ODUB 3RRQA 4WIQA 3IF1A 2FR4A 2H26A 1FQ9C 2Y07H 4CVXB 1FN4B 3OKKA 5SV4A 4PJBA 1P9MA 1U8NB 1M05B 3UC0L 2VUOA 1ORQA 4NM4L 3VRJB 4MJ6A 5I8OH 1CVRA 3DVGA 4NPYB 1YJDH 1H5BB 2YKLH 2J88L 2ILLA 3VRIB 1UXSA 5DRWA 2EC8A 5DFVC 1T04A 1A22B 4IRJD 4JPIA 2OXGA 1JFQL 4U6HA 5CJ8A 4ZTPL 4OCSL 3QO1B 2WBJA 3RY5A 1EHXA 5TQ0L 3FKUS 5J1SC 1PG7X 4CVWA 4YHZL 2Q7NA 1Q0YH 2DM7A 3BDBA 4NZUL 3GSWB 5CMAA 1RU9H 3MV8E 1TIUA 3LKPA 4KY1H 3VDAA 3BRFA 5DRNA 5GIRB 5C0FA 1AY1L 3D48R 1ZT7A 3L9RA 3RL1A 3S37H 4JO4L 3PNWB 5CSGA 3QUZB 1KG0A 4H0HB 1VADB 3CFCL 5EUKA 3Q48A 2X70A 3K46A 3DNKA 1FVEB 1FYHB 1OGTB 2ZUTA 4M48H 4MAYD 2BHYA 4LLUA 3HG1D 4HK0A 3EBAA 1NLDL 1FPTH 4LSTL 5JLZA 5DRZB 4Z7UA 4HIJB 4U1SB 1I4FB 5EA0H 3MGTB 3G5YA 1OQXA 3EOAB 3DXAA 5C09E 2XY2A 3H9HA 4HKZA 4UV4H 1YEKL 4LHUA 3UTZB 1NDGA 1ZLUH 1NCBH 4OUUB 4S2SA 3GNMH 5KTEH 1MI5D 4HUUB 4NKOA 1G7MB 3T8XB 1U8IA 1M71A 1DN2A 3O3BB 2D31B 1VFUA 4KRPC 3TCLA 5KOVC 1CL7L 3U1SL 2LTQB 5ID0A 5GGRB 1BBJB 4XCEB 4KMTL 3TNMA 4YWGH 2APVA 3PHSA 4Q9RL 3ARUA 3DO7B 4LKCA 2X4PB 1IGCL 4G8FA 3MROB 3RU8L 4D0DA 4M5ZH 4UUJB 3HLAA 5J13B 4D9QE 4KJPC 4C83A 3SDYL 3SPVB 4Z8FH 4NFBA 2PR4L 5K9KA 3DWTA 4UV7L 5CBEA 4N5ED 3EOYG 4XB8A 2C3GA 3FT2A 2JB5H 4IOSD 4PRHA 5F7KC 5ERWA 3NFSH 1TQBB 3KLAB 1A7PL 1I7TB 4QTHA 4OCXL 1FGNL 4PGBA 3T0VA 1X5KA 5E7BA 2H8PA 2F5BH 1T20B 5E8NB 4NN6B 1KT2B 3LMJH 5JUEL 2VN7A 1G9NL 4HFUH 3C8HA 3C5ZC 4NN5B 4ZPVB 1J8HB 4ZPTB 1MCOH 4NO3A 1T22B 1CD1A 5B3NA 5HHMB 4CDGC 3QDJE 4ZAKB 5SV3A 4L8SA 5DUMH 3U4AA 2J3SA 5AG9A 4JO1H 4NO2A 5DHYA 3M17A 1LO5B 1P4IH 5DHVH 3IRPX 3RPKA 4U0QB 2X2YA 1DEDA 4UDTB 4BK4A 4JRYB 3GRWH 3GSNA 1C5DA 2YPLD 5KBNC 5CINH 1V3KA 4XP1H 2YK1L 2GK0B 3WS3B 2F74B 3ARBA 3ULVH 2NXYB 3FO1A 3LQZA 5DJAB 1CXEA 2VDPL 3VU2A 1S9XB 1JWSB 5DFVD 1MF2H 4YHIB 5CIPB 4R7NB 4QRTA 1HXYB 1UYWH 3TA3A 4JM4L 4RAVA 3BGAA 5IEHA 4EOWH 2FGWH 3L3KB 5ITFB 5I17B 1AFVL 1OAQH 2VITA 4DGYH 2AXGA 5CJQH 4GXUN 3KPLA 4KTDL 4ELKB 1CD0A 4OLZH 3T65B 4EBQL 1NANH 1T2XA 2F8OA 4L4TB 4TVSa 5CILL 1XZ0A 3S88L 1IAOA 4Y4KA 3FQWB 2Y06H 5HGHB 3MJ7A 2FX8H 3QQ9C 1CE1H 3S3JA 4JG1H 9CGTA 4YX2H 3O3UN 4LHQB 5I1HL 3SDAC 4LDEB 1CFVL 4F7CB 2V17H 5ACLA 3G08B 4LLYA 1A4KB 4KV5E 3A6BL 3HE6A 1J87A 2PO6B 5D70H 3CMGA 2A6KB 5F89A 2FSEA 3CJJA 1JYXA 3RWGB 1T5XA 2JE8A 3DO3A 4KRPD 3GB7A 4LEXL 3DETC 5I8CA 1FRGH 1DBKH 1YA5A 1V7NL 4WU5B 4LSPL 4YR6A 1HI6A 2CXKA 5CUSL 1H15B 3U46A 4WNQA 2AP2A 3IYLW 3OR6A 3S34L 3C60B 3MNWB 2VWEE 1FG2B 4N0UE 4GG8A 3FMGH 1A1OA 4WTZA 2GAZA 3JWNC 2VLRD 2VDRL 2EYRA 2BSSB 5F97E 2DQDL 2V2WA 4I1NB 5C0GB 5TPWL 5HYSA 2R2HA 4KJPD 1NEUA 5GGSB 5TDNA 2K7PA 3QFJE 4Z78B 5F93C 3ZKQD 2UY6A 4P3DA 4ELME 4MNQD 2OL3H 1I8MA 5BRZB 3W81A 4LVEA 4HWBL 2XQYK 1WICA 2VLLA 3U0WL 2B5IC 4DZBB 1HINL 3DV6A 3KWWA 3WXVL 4ZFOA 5JW3H 1FL6A 1FLRL 1V7ML 4APQA 4QRPB 3KPRB 4XC1H 1U58A 3TBVB 5DQ9B 1PX4A 3S4SB 3C5ZD 4XAKE 4P46B 3VD7A 4UNUA 1Y18B 4OLYH 1E4XL 4JDTH 1UB5B 2X4NB 5JHDB 1N0XL 1OGAB 4Y2DA 4CNIB 3ROOB 4ZUWB 5EBLB 5GJTH 3BSZH 5K59E 3QNXA 1IKNC 3CZJA 4GRWB 2YPKB 4EUPA 5GRUL 2Y1VA 4KGLA 4PTUB 4KTEL 3MFFB 1EGJH 5FXCH 4XH2B 1NFDB 1RHHB 2WIIA 1NAMA 2Z8SA 3GMPA 4Q6IC 2DYPD 1DQDL 3GKZA 3T1FA 4OCYL 3BI9X 4AEIH 1FL5B 2Q8AH 3BE1L 1FCGA 5TGBB 35C8H 3BEWA 3EJJX 3MGAA 5JQHC 1L7TH 4I18B 3GJFH 5C6PB 4FFZH 1U8LB 1KJ2B 4BQ6A 1KC5L 2JKXA 3VXME 1UQSB 1MHEA 25C8L 4TRPH 1U36A 2OTUB 1SM3L 2FIKA 4QOKA 2FL5B 1IC1A 1MRFH 5DJXA 4ETYA 3ARDA 1NCDL 2OJEA 4BSJA 2I07B 2V2TB 4JFDA 4AIOA 1C1EL 2IPTL 2P4AB 3LS4L 1FDLL 1W2KT 3WFEH 3QQ9D 4DTGH 3OJ2C 5I16B 4JRXD 5CP7B 3TGXA 5JHLL 3ARSA 3VH8B 4CJ0A 5IFJB 3SDAD 4HIIB 4IOFC 1T7ZA 5CCKL 2JTDA 4JJ5B 5JIIA 1P4BL 3RPIB 2J4WH 3BXNA 4OZ4B 1YEGL 4WEBL 3WIHA 2YRPA 2VXTL 1YEFL 3CFDA 4JFZL 3GMLA 2MFNA 3QT2A 3QFDB 4YBLB 1N2RB 4ZQKB 2HVJB 3VG0H 5IOPA 3DETD 1U91A 4PRIE 1BVZA 3B43A 4OTXL 4YFEA 1ZS8A 2GHWB 1NC2B 4U33A 4DVBB 3B5HA 2G2RB 3OTTA 5EIIA 3V5KA 5EZOH 5FK9A 2V7HB 1N8ZB 2DQGL 1QQDA 3DHJA 1GOHA 5D6CA 1JF6A 2AJYL 4KHTL 5I66B 3AS3A 3MRKA 1RUAH 1LGVA 3MRIB 4J3XA 5D9SA 3C5JB 1KOAA 2Z92A 1O5DT 1MJJA 5BV7L 4Y16B 1MCFA 1QSFD 3N1PC 5D2LE 2AJZA 4NRXB 1ZHLB 5B22A 4LSSL 1G9EA 1MCKA 4N0RA 1MNUL 2XKNB 4MQ7A 4CUCA 4IMKA 4UDUB 2APBA 4UIKL 3KYOB 1NLBL 2W59A 1D5BB 4JLRB 2CIIA 3OAZK 4IIQC 4N90D 3MRMA 4NQUA 4OZIF 2B1AH 4PRDB 4XP9L 5DGQA 3GFUA 4LIQL 5BW7A 4JQVC 3RDTB 1KPVA 3FAWA 3VW3L 1Z2KA 4R0LA 3EYVA 4X8JA 2C4XA 5DWUL 1JPST 3VWJC 2RB8A 3C9NA 4TSBL 5FUZH 1EBAA 1IGYB 2ENYA 3IJSB 4Y1AB 1B0WA 5ICXB 1QZ1A 3BFOA 4RGNE 5DEZA 4KHXL 4ZD3H 5CSZA 2FHCA 4LSUL 3TWCH 2A73A 2V7NA 4HWNA 1C7SA 5L9DH 1YNTA 2Y4SA 4JY6B 3VXSA 1NJ9A 4OT1H 4ALAL 2E6QA 1UVQA 3SKOA 1FNEB 1TVBA 3MLUL 2HKHL 1JN6B 3PQYB 4WW1A 4U6XA 4YK4B 3QRGL 4LVOC 4FQPA 2AV1B 2DM3A 5C07B 1S7VB 2FX7H 1WCBA 5B3JE 2Z8WC 3MNZB 5DJ0A 3D3VB 5SWSD 3MXVH 5IVXE 1FZJA 2F53B 1UENA 3AS0A 5ALBL 3LEXA 1SEBA 4NM8H 5GSRB 4W4OC 3FB8B 3HFML 3I75B 5C0AD 4UBDC 1KLGA 3U9PH 2WBKA 2DWEA 3JUZA 5I1CH 3OB8A 3RL2B 5JA9A 1D5MA 3RZWA 5C6WH 2D2OA 4P4KC 1CR9H 3NCMA 4IRJA 5GGVL 1WAAF 4X7TB 4BFIA 5CJOL 1CLZH 5GS0L 3C2AL 5F6HI 5KSBF 5I1EL 4KGJA 4K9EL 3L5HA 3OXRA 1YN7A 1CIUA 5AZEL 3DARA 3BO8A 3KXFE 2C1PB 4ISVA 1A7BA 1E6OL 3Q2CA 3BQUA 2BVOB 3U0TA 2F54B 1PZ5B 2IFGA 5MENB 4ZNEA 2KUTA 1HN1A 5D2NC 3SGEI 2J8UA 3SDXA 1YY8B 4GMTH 4MCYB 2C5DC 4GG6B 1TDQA 4IOFD 1LEGB 1KJ3H 3OKOB 1S9YA 1MREL 4TUKH 4L29A 4ODHL 2X1XR 3HMXL 3D6GA 3VXPB 1GYAA 3S97C 1RIHL 4YQXH 3MRGB 3UX9B 2FJFA 4KUZL 2EIZA 3X12A 2ATPA 5TDPA 1DANU 4DZ8B 5JQ6L 2GIYA 3T0EE 3VXRE 5F7LB 2Y5TB 3NPSB 3RWJA 1QSED 4Z18A 2FATL 1PKOA 4GRMB 4I48A 3HB3C 4U1KB 2D3VA 1JHLH 1BFVL 5TFSH 1DUZB 3F12B 3EDJA 3UROR 4P48A 4J3OC 5D96B 1I7ZA 2NNAA 5E08H 4HS8L 1J5OL 4G6KL 4XPHL 5B38B 1OF2A 3WN5C 1UWEH 4X4ZA 2R23A 5E1AA 1WT5A 1XAUA 2BNQE 3GSXA 3IXAB 4KTYA 4MGXA 1JMZA 4NJ9L 4ORZC 4PJCF 2D4DA 3B3IB 2H1PL 2O93L 4K8RH 4QRQB 4GSDH 1VGEL 3OL2A 4LL9A 1SMOA 3G6AA 2VLJE 5DS8B 2FH6A 4GKOA 1Z6JT 1QP1A 1B6DA 4P2QA 4F9LA 5C0BD 4X80L 1T03H 1G6RL 3HN3A 3UMTA 3EFFA 2DL9A 2P24A 3VWJD 1DQJA 2V5YA 5TF0A 3NABL 1G7LB 1XCTA 4WHYH 1LO4L 2X89A 2AV7A 1CXFA 1QBLL 1KIQB 1YYLL 4P4RA 1CLOH 2PXYB 3RGHA 1GGTA 2GSGA 1UC6A 5C9KA 3UZVB 4YZFF 1J88A 4OLUL 4JHWH 4JHZA 1VGKB 2Q6WB 3DMMA 1VFAB 2ADIA 3C09B 3TT1H 4UOW1 4ZOEA 5CZVH 4GBXC 4G8GE 5IHBA 1ZVYA 5FHAH 3MLSH 3CH1A 3BMVA 2FJHB 2ATKA 3CX5J 1D5ZA 1Q72H 2QBWA 5BS0D 2YPLA 3O2VH 1EEYB 2WNGA 3UYOD 1BIIB 4G8IA 1NCCH 3PHQB 4PJ7A 5DVNA 2XKSA 3E0GA 3RWEB 2D7NA 4UBDD 1FNHA 4QTIL 5T5NF 2C1OA 2I9LA 4XBGA 4OLVH 3QDGE 2D7TH 4P4KD 3MR9B 3IJHB 1VFMA 3K74B 1JPFB 4PJXA 3BGMA 2QADB 3LEYL 4G5ZL 4D9RD 4MA1B 3OBAA 4ZFFB 3GM0A 4S1RL 4XP6L 4MCZB 2O5XH 1EERB 32C2A 3BPCA 4S1QH 4RRPG 2ITCA 3UZQA 5EU6B 2C9AA 3GRWA 2GY7B 4KMQA 5CEZE 2P8PB 2HMIC 1H8NA 5I15H 3WHXB 4OI7A 1A7QL 1MCCA 1BEYH 3QI9C 5JOPE 4WGWB 5HJ3A 1JPTH 1IC5L 4JHAL 3O3AB 1DBAL 4P23B 2EDHA 1DUYB 5IVZB 5T3XH 3VXNB 1OARL 3V4VH 5BOPA 4OZFG 2XXCB 4PP2B 3KXFA 3ZDYF 3TZVA 4Z0XA 1A6WH 1N4XL 2X5PA 4R90L 3I6GA 4I0PB 5FEBA 5J6HB 1XCQB 5GGUB 2WMPA 3ZMRA 2F5AH 4K7FA 4OM0H 3RTQC 5I6XB 3HB3D 4WI8A 4WV1C 4LPXA 3TT3L 3P4LA 1KPUA 4EIZC 3MO1B 4LLWA 3R8QA 2QJDA 2XTJE 3D87B 3GJEA 4X8XA 4HMDA 2P5ED 1ZHNB 3JTSA 3I6LE 5HDBE 2W1NA 1AC6A 4R8WH 3O9WB 3WNKA 3EZ8A 5CP3H 3UYRH 1WWCA 2ITDB 4V1DB 1U3YA 5K93A 5T1LA 3O6LL 4RISL 4QEGA 1AGCB 2E9WA 4N8CH 2AERT 3DGGB 3AREA 3B9VA 5D7LA 5I2IA 3MRBB 4TSCH 2EE3A 2H3NB 3EYSL 3INUH 4DKEH 3FB7B 1Z3GL 4ZFGH 1A6AA 1BFOB 3VWKB 3IF1B 2FR4B 4NNYA 4WI3A 1ZGLP 4GT7A 3LVEA 4NCC2 4OZGE 3X11A 5FYLH 2UYLA 1Q9OA 4LCWB 1T4KB 3L3OB 3AAZB 1ORQB 3DX9A 5A40E 5F7EH 2AJVH 3HE7C 4IDLA 2YWZA 2H2SC 3GMRB 2VZVA 1RVFH 4AH2A 1A2YA 1JRHL 5IEKA 3GO1L 1JYVA 1ZXQA 2CR3A 3FQNA 2BCKA 5K9JH 2WUBL 4TNVF 5EORL 4U3CA 1LEIB 3H6JA 1MFEL 1RMFH 2VLJA 3MCLL 4QCIA 3W9DB 1DBBL 4JFPB 5CMAB 5EZIH 1JGVH 4BFGA 3EYFA 4OI9A 4M93B 2HFGH 5DD3H 2WBWB 3D69A 3UZEA 5C0JA 1HNGA 5HPMB 5ECJE 1OHQA 1J1PH 4GBXD 3RL1B 2OL3A 4GQ9L 4HAFA 4UQ2A 3O6FA 3RHWK 4NHCH 3CLFH 1QRNB 4S1DC 4X5XA 2DYPA 3HC0B 1ULVA 3TO4A 3ZDZE 5L2JB 3QEUA 4CRPA 4Z7OF 1GOGA 5TF1H 3PWLA 5C0RL 4YAQA 1RZKH 4WJ5B 4M00A 4IM8A 4D9QD 2LU3A 2M8XA 3GKWH 3QQ4A 4PTTA 1KCSL 2G5RA 2I9TB 3V4UH 5SX5K 1ZHBB 3LH2L 2ZOKA 5D72H 5FAAA 5HTSA 2NY4B 3CFJA 3NACH 5TE7L 3O4LB 4HUKB 3V95A 2UVFA 1GPOH 2EDKA 5GRYA 5F9OH 5DMIH 4OCWL 3U6RB 3KPPA 3O3EA 4YFDB 4S2SB 1H3WM 2ZCLH 2IAMB 4WVRA 1TPXC 4O2CA 5C08E 4HZAA 2C3VA 1EGJA 4LGPB 1MIEH 1CGXA 4I4WA 2HMID 1Z9SA 3IDMB 4Q2ZB 5IESL 4ZSOE 3BD3A 3MV9B 4PREA 3QI9D 5ID0B 2NY5H 2Z31B 2CGRH 3QDGA 4ERSL 4TN9A 2ZKHL 4XCYB 1AD0A 3JV6B 1EJOL 4XCNA 5IB4A 1UB6A 1QFWL 4JRXA 4PJAF 5KZCD 4MAUL 4M7KH 2IPKA 3QXUA 3BP6A 5F1IA 2AKRA 4XP5H 1S3KL 3NCEB 3TNNA 3GJFA 5IJVB 2R4SL 3HZKA 1DSFL 3QPXH 2CDFB 1F6AB 3MJ9L 4XCFL 5FGBC 3RTQD 3VXQA 3C8KA 4Z7WF 3NCJH 1ADQL 5CBEB 1DFBL 1JZ7A 4MDIB 4XNQA 3MV7E 5EPMB 4KQ3H 4ZFZA 3EO9L 1TJIL 4PRHB 3TBTB 5FYKD 1UWGH 4OCRH 4PRPA 1SJXA 3HR5A 3CFKB 4QTHB 5EBMA 3CPLB 1FJ1A 1JP5A 4EN3A 4Y5XC 5E5MA 5AUMB 2HJKA 4CGTA 1I9EA 5E2JA 1SJEA 1ZMYA 3MLRL 4PS4H 2W0LA 4HDIB 4ZOAA 4NO3B 3LD8C 4FQXC 2ICWJ 3OPZL 4D0BB 1F4WL 4F80A 1D6VL 1DLFH 2W9EL 1H3PH 1QSFA 2XA8L 2HWZL 4ODTH 4L8SB 5T1KD 3OAZH 3HAEH 1A6ZA 1S9VA 3OR7A 3QXWA 4I77L 1FNSL 4HBQA 4F3FA 2B2XL 4NKDA 4Q58C 5TJWK 3HE7D 3VGAC 2H2SD 1CQKA 3IGAB 2VXQH 4I5BA 1OTSC 1OP3H 1T80A 1RZ8A 4QRTB 4LMQI 1IC4H 4Y4HA 4OFIA 3PGFL 1M7DA 4KPHL 3BPNB 4RAVB 1NKRA 1HZHH 5I1IH 2VITB 3ILPB 2Q87A 2XRAL 4PJIE 3UXFA 3MV01 2DI7A 4R26H 2P8MA 2EYSA 1BLNB 1OL0A 3G6JA 1TNMA 2YPVH 4EDWL 4S1DD 1CXLA 1IAOB 4X98B 3QIBC 1YMHB 1P7QB 4U7KA 1UKTA 4HUWB 2VDLL 1TETH 3RWDA 4I2XE 4HIHA 3RA7L 4OUOA 5BCAA 5IJKC 3FN9A 5E99H 4P9HC 4BUHA 3DROA 2FNBA 3IFPA 3M8OH 4DN4H 1A7RL 3OJVC 3QFJD 3ZTNH 1JTTA 1UM6H 2AEIT 5DGRA 4CN6A 3P40A 4I3SH 4JFHE 2IEPA 2DQJL 1RURL 1IAII 1CWVA 3GHBL 1GC1C 3GMQB 3QHTC 4X6DB 1WWAX 3HE6B 4R96B 5CBAA 4JKWA 2DLIA 3QWOA 2BY2A 3DSNA 4M7JH 1T5XB 3GGWA 4P2RB 3O45A 5CJ5A 3PXHA 4YHKL 3GB7B 3FO2B 4NO0A 3CXDH 5GISL 2HJFB 4HJGA 3HMWL 4LNRA 1FE8H 3HUJF 3OR6B 5HHPB 1DQLH 4M7LL 4XAKD 3LOWA 4DEPC 4NOFA 2L7JA 3SOBH 1JPGA 3TP4A 2IQ9H 4FABL 3EYUL 5D1QB 5I18L 4QHUA 4NKIH 1DLHB 3ARXA 1U0QA 4KXZI 4RGNC 4PJ5E 1KENL 2HLFC 1GJIA 4PJEE 4OZIE 4M7ZC 5HYEA 1D9KB 2CKBH 2JB6B 4KJWC 3TVMB 5FB8B 3UTOA 1I8MB 3AGVA 3VXUE 4N5UA 5T3ZH 4PJ9A 1ODAA 2YRZA 4HULB 1YC7A 2FJGA 4YIQA 3N06B 3HZYB 1RZ7L 5MHSD 1LO3L 3DV6B 4NNPL 3V7AG 4IDJL 3STLA 1LHZA 3V6FA 1AXSB 4K94C 4A2LA 3QCUL 1ONQA 4JR9L 2DB8A 5IK3B 3VXMD 3DUSB 2A6IB 1D5XA 4FQXD 3MLWL 4ZTOH 1PEWA 4NOBA 1XGYH 3OKDA 3SE3C 1NEZA 1WLHA 4FZ8L 4G7VL 4GAJH 1UWXK 2EDLA 2HJLB 3QNXB 1KULA 4EUPB 3W0WA 1YMME 4JN1L 5ENWA 1R0AL 3L3GA 2LAGB 5A3IC 2WIIB 1NAMB 4RMRA 4JGUA 1W0VB 3FTGA 1HNFA 5F96L 4LVHC 3SGEH 1OTSD 2F9BT 1C16B 1FGVL 5IKCA 2BXYA 3L95B 3BEWB 2OX5A 1UXWB 1WBYB 4CL7A 2VOTA 2HYMA 3GBMH 2MCG1 1DDHA 3EHBC 4ORGB 1JWMB 1MIMH 3VWJA 4WW2F 2Z8VC 2QQLL 3UCRA 2GITA 5E9DA 4PRID 4RIRB 5I74C 1JGEA 2FIKB 4QOKB 5E00B 2DBLH 4MNGA 4J12A 1C5BL 3MRDA 4J6RH 3S96A 4UQ3B 2HFFB 4ZS7H 1NUGA 3ARDB 4P9MH 2OJEB 1C7TA 1OD7A 4FQHB 4TSAL 4DGIL 4AMKH 3O11B 4HZLA 3QIBD 5H35B 3BAEH 4H88H 4OD1H 3SEPA 2AXHA 4FZEH 5B8CC 4HLZG 4PJDB 4UTBL 3DECA 4N8PA 1IL1B 2E7BA 1LO2H 2YUVA 3BP5B 1BWMA 4OJFL 3LN5B 1OPGL 1JNJA 3MLYL 1C08A 2VQ1A 3BXNB 5BS0A 4X6FA 4W4OA 4TTGA 2BRRH 3LN9A 3JSSA 5KG9A 4UI2A 2O5YL 3HI5H 4R97C 4NC2B 1QG3A 4XVUC 5D1XA 5MEQA 3CFDB 3CC5A 3ARFB 3SGDH 5C9JB 1OSZB 2Y72A 5EB9A 1B0RA 4G7YL 1AO7D 1CDCA 3PL6C 4RFEB 5IBTL 3CVIH 4WUUB 2J7LA 1B2WL 4NGHH 5DFTA 1F8TH 1GGYA 5DEGA 5JXAH 2ZUQB 3G6DL 5D2NA 1WBZB 3LZFL 5D6CB 4HPYL 5HHOE 3J7HA 3UP1A 1GGIH 3FB5B 3MRFB 4KZEL 5DK2A 2NX5E 4K3JL 3P73B 4NN7C 3WLWC 4RGND 3HI1B 1HHIA 1T1WA 3BX7C 4XXCC 2NW3A 1ZHKA 2AJZB 2HLFD 5HI5C 4OLXH 3QNYA 2VB5A 4KJWD 1JCKA 3PABB 1EZVY 4OF8A 3ZHDA 4Y19B 1DN0A 5DTFB 4NQCA 2BXZA 3FONB 3RI5F 1WFNA 4PGCA 3OKNA 5GHWL 3RY6C 4OF6A 2GJZB 2DQTH 4M62H 1PG7W 4OIIH 1TXKA 4NQSB 5BXFA 1OSPH 4HX1B 2GY5A 2OQJB 1KPVB 4GKZB 4YZFE 2P42B 3UJJL 2P5EA 4R0LB 3Q6FB 4YDKL 3QUYB 1J1XH 5A16A 1I1YB 2WANA 1K4DA 2GI7A 3PDDA 1JZ6A 4XAWL 4HBCL 5DQJA 2ED9A 1CFNB 4HT1H 2BVTA 3WN5A 3GSNL 3UEZA 2OJZH 5TDOB 3O8XA 4P0DA 2CJUL 3SKMA 5BMFH 1D6EB 4O5LH 4H1LG 5A3ID 1YNTB 3DUUB 4JCLA 2DD8H 4NFDA 1RZJL 2VYRE 1PSKL 1UVQB 4MDJB 3VFUA 5ADOH 1TVBB 2CRIA 3L5WB 1RK1B 3IKCA 1FCCA 3KHQA 1R5WB 3NAAH 4WW1B 3HC4L 4V2CB 5ESAA 1ETZA 4O2FB 4XPGL 2LQRA 1R3LA 3RWHB 5DJ8B 5IFAL 1UZ8A 3L5XL 4PJFB 2YUXA 5GJSH 3RNQA 4F8TA 5D5ME 4D3CL 3V0AC 5DT1H 1A6UH 4QHNA 3QEQD 3EHBD 3RUGB 1MJ7H 3VFGH 3FFDA 1GZPA 1U9KA 4ETQA 5C0IA 1R3JB 1MCHA 2BVEA 1CFTA 1U8PA 4IRJB 4BFIB 1FBIH 3WUWA 5JDSA 3VXRD 2EIDA 5J1TC 1I8IA 3QQ3A 4N0YL 4CMMA 3OXRB 3F62A 3C6LA 4MXVF 3SGJA 1NCTA 2V5TA 3H9SE 4PJGA 1OAYH 1HXMA 3LIZH 4FQ2L 3QG7L 1RJYA 2XTJC 4QNPE 2XACC 2VDOL 4KZDL 3IXTA 4ZUVB 2Q8BH 3VGFA 1WAAA 3MRPB 4X7FC 4XPAL 1CDYA 2J8UB 3SDXB 3L3HB 4GBXA 5KSBA 4Z76B 3DRQA 3HS0A 1IGIH 1RV6X 1P7HL 3I84A 1W8OA 4LSQL 4JFFE 5BO1H 4Z95L 2XWTB 3ZDYE 2R39A 1TZIB 3O2DH 4R7DA 4G8EA 4LKXB 4RGOH 1AE6L 1U95B 1YN6A 3MLTB 1KIPB 5SX5H 4WU7B 4XVUD 4F7MA 1WWWX 1NPUA 1JNNH 4MAYB 5HYIA 3IDIB 4FFVC 3HG1B 5HYJA 3TYFA 2YD5A 4IRZL 2JJSC 3QCTL 1I1FA 1PGRB 4V2BA 3PL6D 1L6XA 5IROC 2V6HA 5F1NB 1AD9A 2YBRB 3F7YA 1G6RB 3FCTA 4QWWC 3RWJB 1N0LA 3GMOA 1TJGH 3HC3L 2FECI 5LAXB 2X4UB 1MI5B 4U6YB 4CDHA 3S98A 3AU1A 4OD3L 1NGXB 4X6CF 4P5KA 2D7QA 1FYTD 2NXYC 2DQEH 1W0YT 3NFPB 3D2UA 5DVMA 2NLJB 3WLWD 1LEKB 5BQ7A 2KQMA 5ICZA 4G80B 1FZMB 2PTVA 1FSKB 2OK0H 5HI5D 4ODVH 1HSBB 1JGUH 2FYYA 1KEML 4GRWF 3U9UA 5H8DA 4FTVA 4HV8A 2G9HB 1NFDF 1BJMA 1IM9A 5E2TL 1CU4L 4HPOH 1SQ2N 1FO0L 4YHPA 2G75A 4MJIB 5IR1B 3G5ZB 3DTXB 2IADB 1LNUB 1JI2A 1QPPA 3GEWB 4H26A 2WLZA 4LNVA 3RTQA 4X9FA 4WV1A 1EUTA 3L3IA 4CW1A 3C6SB 4LHJB 4AY0A 3UTSE 4PJCA 5IB1B 1HH9B 2D4FA 5TE4L 1QFOA 2HAZA 1FFOB 2ARJQ 2NX5A 2XZCL 1FG9C 4XVTH 3U48A 3GMNA 3WIIH 2HRPL 3EFFB 2H6PB 5EOTB 1ZA6B 5E6IA 4LK4A 1UM5L 2B1HH 3FQUB 3UO1H 1JF1A 3X3FH 5JR1H 4ZNCD 5EWIH 3STBA 5F21B 3ZSTA 2GSGB 4BK5A 2PW2A 4P2YA 3GUTA 2XWBA 1T1YA 4QYOA 4Y5YB 3E3QC 2BNUB 1KUMA 4UNVA 1YEIH 1N7ML 1FVCA 2PO6C 3IDJA 1MCDA 3BDYH 1PKQE 3GSVA 1MCPH 2F15A 5CEZD 3PWJA 4JFYA 1EMTL 1HHGB 3LS5L 5HGAB 1B4JH 3ZLQC 5FDYA 4JFED 4M9OA 1KSRA 3HE7A 3FQTA 5ADPL 1GCFA 4D8PA 4TVPH 2DQUL 2FLBT 5KSVA 1J12A 4XBGB 5FUCE 1KB9K 5E2VL 4NQDA 4DJMA 3JWDH 2EH7L 1AQDA 1DEEB 4YNYA 3RX5A 1RUMH 4PJXB 1MCSA 1T89C 5EG6C 1LWRA 3NOIA 3ME0A 2SEBA 5C70A 2A77H 1PG7H 1HHHA 2DQHL 4DKFH 5FF6A 5KAQF 2XTJD 5CD3B 4FFYH 2Z91B 3HAEA 4RBPK 3KYAA 2R29L 4BZYA 3VDBA 4HFWB 5FYJD 5F3BA 1D3CA 1KNOA 1F6LL 3LQMA 3TV3L 1DZBA 5IMLB 5HJ3B 1GVIA 4DQOL 2X4RB 2P47B 4FQLH 3ZT6A 5FV2A 3SE9H 2AQ2A 4D2NA 4HF5H 4Z7WE 4FFVD 3VFPB 1KIRB 2ZCHH 5CIPH 3K3QA 3H9YA 3REVA 2J6EA 4OGAC 4TYUA 1BQHA 1U6AL 5HHMD 3MA7B 4PG2C 4OSUH 5KJRH 5IB5A 2FD6L 4QWWD 1KBGL 5DJ2B 1NUNB 3LKQA 3UPCA 2COQA 2GSIA 3QIUB 1WQVT 4PRAA 4P5TC 2VDNH 2FIRT 1KPUB 5F9WC 3HZVB 4P5MA 2ADGA 2FDBP 3QJHB 4XZUB 3UJTH 4KRPB 3EDKA 5INDB 5EN2A 4DFHA 3WD5L 2R2CA 1X5ZA 3CSGA 2NXYD 3WSQL 4I13B 4R2GC 4RFOH 1IFHH 4UU9A 1ZWIB 3TYGH 1BM3L 1BZQK 4BJLA 1LMKA 1S9WB 5IB3A 2OTWA 4DN3L 4C59B 2VAAB 2VLRB 1F58L 3SJVE 3JZ7A 2CQVA 2X9XA 5BVJA 3PP4H 3F65A 1L7IL 1AGEA 5C3LD 3E6HB 3PHOA 5FGBA 1U8QB 4NNYB 5C0CE 1A4JB 3MLVH 3AMLA 2HKFH 4MNQB 4UOW0 2R1WA 2IGFL 5EU5B 3BJLA 3BH9A 3FN0H 4R4NC 3DVNA 3DX9B 3P4OA 4L4VD 3VXTA 2NYYC 1QO3B 3P9WB 1QSVA 4KWUA 2A9NH 1CD8A 3KPQA 3VE0B 2CLVB 1ZLSH 4U1NA 5HY9A 1FFPA 4YPJA 4LCUA 3HI6H 5F88A 5JW4Q 4MMXC 5I75C 4JB9H 1KN2L 3BOVA 1JGDA 1KFAH 3LQAC 1CF8H 2BCKB 3VD4A 5GS1B 4EVNA 3C5ZB 4BH8B 1UWXH 5DD5L 4QCIB 2PO6D 5C08D 2EIEA 3EYFB 1JZ4A 5I1LA 3L7EB 2E27H 2Z9TA 3D69B 5C0JB 3WFBH 3RVXC 4YBLC 4HK3J 2OZ4H 2CKBA 2VABA 1HHKA 3RWCB 4GG6F 4K3HA 3ZT7A 2XWJB 1VKXB 2RCSL 3P77A 1BZ9A 4WHTA 3ALWA 3O41A 4KAQL 2AI0L 3X17A 2DYPB 3CLEH 2DM2A 4R4BB 5E4IA 3O6ML 1CGWA 5AYUL 4GOSA 3CVHB 1QKZL 5FCUH 1OAXH 4EI5C 2BP3A 1MRCH 3PWPA 4Z7QE 1N5AB 5DXWA 5DK0B 5F44A 3TJEL 1R5IA 1NBZA 2ZOKB 3FB6A 3BWAB 3SDDA 1E4KC 5HI4C 2Y07L 3MLPA 5FGSA 3MV7D 2DOCA 1LO0L 3LSOB 3HUJE 4OFPA 3MRLB 2FWOB 3BKJL 4U1HA 2OR9H 5AZ2L 4GRWH 5ANME 2C3VB 3LRGA 2ZUXA 3BZ4A 3S36L 5EOCJ 2YKLL 1E0OB 1S5IL 4YDVA 3QIBA 4Z77B 2JCCA 4NP4L 4Q0XH 3PUCA 4XCNB 5DMGC 5IVOA 5IVNA 3GMMB 3OMZA 4XPTH 3BP6B 3SDAB 3MRHA 3P11H 2DTSA 5F1IB 3VXOB 2AKRB 4XXDB 1RU9L 3KLSA 4OGAD 4N68A 1MEXH 4F7PA 1OY3B 3HZKB 1QLRB 2EDBA 3P3YA 4RNRB 3S37L 5CWSB 1KJ2H 4MA7H 4PJAA 4KJYA 3KYKH 4P5TD 1MHCA 4XNQB 4D9LH 2ICWA 1YNKL 2ZUYA 4M48L 4XCCH 4GAYA 1AO7A 4JHBA 3QO0B 3RVWC 1CLCA 5CGMA 4R2GD 4RGMC 4Z7WA 3L3DA 1CIDA 1DR9A 4JPVL 4HSQA 4YK4C 3G04A 2A6JB 1FJ1B 4KDTC 1PJ9A 1TZHA 1UKSA 4N1EA 3TIEB 1SJEB 2AJXH 2Q1EA 2HTKC 3OZ9H 3SY0B 4UV4L 3UBXG 2FX9L 4KVCL 2ZG3A 1MQKL 2PW1A 5DYOA 5KTEL 3MGOA 3PDOB 5D71H 1RY7B 5E2UL 4H8WC 2A74A 4P9HL 5T1DL 7FABH 5DJCA 5TH2A 3FQXB 5GRXG 1RAMA 4HUXA 2LABA 4WWKA 4R4ND 1XEDA 1F3JB 2NY2C 3K80A 1GC1L 2NYYD 1YQVL 2DDQH 3I02B 4O4YH 2B5IB 1CICA 1KB9J 1RUPH 1K2DB 5IBUB 4FXKA 5ESQA 4M4RA 3ARWA 3JXAA 2YC1A 1NFIB 4JFHD 4AIXA 3MUY1 4BSWA 4O58H 1WIUA 1DBMH 1NDMA 1FV1A 1GGCL 1M7DB 1B9ZA 2WIMA 2VZOA 1KCLA 3VA2C 4ENEC 3SN6N 1YPZB 5FO7B 5F7YC 5I1KH 1A0QH 2JB5L 4F2MB 3SE3A 3RVXD 1S7QA 3NFSL 4KDVA 4OLWL 4C4KO 4RFNC 3VRLF 1FAKT 5JW4M 2WQ8A 2QHRH 1SY6L 1S7TB 4AT6A 1L9MA 4Q6IB 3AFLA 1RIVL 2VDKH 4U1LB 4X7SL 5TQ2L 3C8DA 1FVDA 2BNRE 4HFUL 3D25A 3ULUF 3QXAB 4HIHB 1MCOL 4EI5D 5J3HC 3OQ3B 1F00I 5C0NC 5SWSB 5HVHC 3ARPA 5D96C 1OAZH 2VLKE 4NJAH 3QEGH 5DUML 1QTYT 5HI4D 4CVZA 3QEQA 2RR3A 5C0AB 1Q9LB 5CBAB 4PV9A 2OSLB 4OQTH 4K94L 3EGSA 2A1WH 1UEMA 5CINL 4NHUA 4U1IB 4XP1L 3GGWB 2ARJA 4NRZA 2IFFL 2V2XA 1DE4A 3K4DA 2ZJSL 1KTDB 3OGOE 5IWLC 3F7VB 4OV6F 1K85A 1J8HE 3U36B 3S3SA 4HJGB 5DLML 3AXLB 3MA9L 4LIQE 1V3LA 3D85A 5E2WH 5E5UB 5L8JB 3IKKA 2GUOA 4MX7A 5DMGD 2PYFB 3WIFA 5L2KD 1LK2A 2FGWL 4PJ8C 4HJ0C 4NUJA 3I9GH 2D9CA 4DGYL 1I8KA 5EZJA 4FRWA 4JQIL 3VFTB 3UTQB 5ANMA 5E8PB 1YMMD 1NMAH 3CZFA 3U83A 1T1ZB 5C86A 1L0QA 2A0LC 3BKYH 3MRNA 1I7UA 1LILA 2Z93A 3FOLA 1RD6A 1CGTA 2FX8L 4DCQA 1EAPA 4JG1L 3D0VA 4X6EA 3ZE2E 1FZKB 3PL6A 2OXHA 2F19L 4EDXB 3RVWD 3RGVC 5IMOB 3PQYD 4LRNL 4ODUA 1IC7L 1J0ZA 1QSEB 2V17L 3MNVB 5I8EB 2GYSA 4CVXA 3ES6B 4PJHB 5EOCH 1U8NA 1EFXD 4LQFL 2HTKD 4XC3H 4WI9A 3GSOB 4MMZC 4H0GA 4FMFA 4Y4FB 2VXUH 2P48B 1FYTA 1H5BA 3V4PH 2X4TB 4J3VA 4NUGH 1G7QB 5F7UA 1DBKL 2DAVA 3BVNA 3QO1A 2X4QB 2VKXA 5KW9L 3IFLH 5KS9B 4LMQE 4Y5VC 5HXMA 4FA8A 5EO0B 2NY2D 3PWUB 5DMJB 4K23H 4MA1C 4CU6A 4HMCA 1FIGH 3FMGL 1H0DA 1KCVH 5MEND 1MLBB 3GDBA 4IIQB 1XGUA 3MACL 3STZB 3QDMD 3PNWA 2E9BA 3QUZA 5IKCB 1G9MC 1U8MA 1VADA 2CSPA 5A2FA 4JKLA 1WV7T 5C0BB 2GJ6D 2WV3A 3UDWA 4X9HA 5IGXH 2EDNA 3EO0B 1MCWW 4MXVE 5HBBA 1FVEA 4ENED 3K2UL 1OGTA 5JIPA 3FRPA 2GITB 1IAKB 1NGZB 2WW8A 5DRZA 2WZPD 1MH5B 2VLME 4HIJA 4U1SA 4BH7B 1I4FA 4MNGB 2YN5A 3MRDB 2AGJL 1QLEH 3MGTA 2ZCKH 2ESVD 1WEJL 1WK0A 3EOAA 1U8KB 4XHJC 4TQEH 3S5LB 4CN4A 1KLUB 4JY5H 4OZHB 3KLDA 4XC1L 1F90L 3UTZA 3G5VB 4OUUA 4HUUA 3S9DB 1G7MA 2YR3A 3K4AA 4LVOB 3T8XA 5J3HD 4JDTL 3BIAX 2AXFA 4X5WB 2D31A 1Q0XH 2AEPL 4XB7A 4BZ2H 5DK3A 3GZKA 5C0ND 4FQCH 1RZGB 4HAGA 5SX4H 1R5VB 5GJTL 1T83C 4XGZA 4JFEA 5BS0B 4X6FB 4XCEA 3MUHL 4KJQC 4EEEA 4HUVB 3DO7A 5E1HB 1FORL 2QHLA 2DMCA 1EA9C 5IUSA 1C8PA 2AW2A 4P4KB 1LP9A 2X4PA 2YXMA 5DSCB 3MROA 4FNLL 4AEIL 4UUJA 5L8KB 3BT2L 3UJIL 1MFAH 4QRRB 4OF5A 4RBPH 4X6CE 2FHBA 3SPVA 4WWID 1BGXL 4NBYB 5JHDE 3KPSE 1OGAE 1GGBL 3MUGA 4Z0BL 5D2NB 2CRYA 3IT8D 3VCLB 4AIZB 4PJ8D 4Q9BA 1RHFA 4HJ0D 4PD4K 1CFBA 4XMKL 4GRWE 1UZ6E 4PUBH 3HR6A 4JVPA 3KLAA 1JZ2A 3NVQA 5C71A 4GKNB 2EDFA 1I7TA 1OW0A 1MRFL 5CEZL 3L1OH 1E6JL 2AQ1A 2YA1A 4ZUTB 4KRMB 2NW3B 1ZHKB 3QCVH 3T2PA 5E8NA 3W9EB 2X7LB 5IW3A 3R0NA 4N0FB 1KT2A 2A0LD 4XWGH 4DTGL 4ZPVA 1J8HA 2LVEA 1T22A 1DN0B 5IROA 2DWDA 1XGTA 3BKMH 3RGVD 5I1AB 2K1MA 4WFEE 2AK4E 1A5FL 2AJSH 5F9JB 4B53A 2CMRL 3OSKA 3IDXH 4JO2H 1LO5A 1BD2E 3TBSB 5BXFB 4L1HA 4UDTA 1KXTB 2EDWA 4YFLF 1VACA 4JRYA 1LDPH 4DWHA 5KANI 4M6NH 2P5EB 1I9RH 4CADA 2GK0A 2EC9T 2F74A 2Z35B 5FUCC 1ZVSA 5A16B 4LHUG 4CU8A 5E6ZA 1T0MB 5DJAA 1ACYL 5JIHA 3VG0L 5DQJB 1S9XA 4I9WE 1JWSA 5FUOH 4RMVA 3KVQA 3ULUH 1DBJH 4FQJH 1OAUH 4YHIA 2P7TB 3T3ME 5CIPA 4R7NA 1XT5A 3VJ6A 3VI3E 5D93C 15C8H 5D7IE 3SKMB 2X1QA 2R2EA 5EZOL 2EDRA 5DZLA 3L3KA 5DUPH 3MV8B 3BHBB 4YO0B 1Q1JL 5ITFA 3S6CA 4G9DB 3UC0H 3VFUB 4M7LT 4NM4H 3T3PE 1GL4B 3D39E 4PR5B 3VMPA 3IKCB 1OWWA 5A2IH 1KYOK 4NWUL 3P0VL 4DVRH 3T65A 5MI0C 1IEBB 2EXYC 1U2CA 2J88H 1A9BB 1UZ8B 4L4TA 4M8QB 1JFQH 2D7MA 3FQWA 3S8WA 2XQBL 2FGZA 3AM8C 3T0BA 2P45B 4UMGA 3MYJA 4YHZH 3WXWH 5LCVL 3ZYIA 5CKGA 3P0YL 1U8PB 4F7CA 1AY1H 5FA3A 1QA9B 5GRVL 4AYFA 1F2QA 1DQML 1I8IB 2GK2A 2EE2A 2B1AL 4XHJD 3U7YL 4PJGB 4TUOB 5I9QC 4RWHA 3CFCH 1V5JA 3SO5A 3TC9A 2PO6A 2A6KA 1PAMA 3IXTB 3RWGA 3SDCC 1JYWA 4GBXB 3DRQB 1IAMA 3HS0B 1QACA 1L0YA 4WU5A 2OR7A 5FUZL 2LE9A 1H15A 4QXTB 4KJQD 2Y23A 5KVMC 3AY4A 1FO0B 3TWCL 4KQ4L 3MNWA 2G5BA 5GGQH 1FG2A 4PLOB 3OKMA 1ZK9A 3WJLC 4F7MB 4RQQB 1F02I 1YEKH 4ZODA 5J4MA 2WLYA 5C0GA 2AAVA 4R6UA 3GK8L 1T89A 2MKLC 2FX7L 4Z78A 1T2QL 1CL7H 3U1SH 3MXVL 2OZ4A 1AXTH 5JIKA 4HC1A 1HQRB 4FQQB 4C56E 5BRZA 3ZHKA 4Q9RH 5IBLC 4Y1AE 5FECB 4JM2C 3Q5TA 1A9EB 4NQEE 4DZBA 3QI9B 1CR9L 2MOVA 1P4LB 2MQCA 4YEFA 5ICZB 3VI4F 3SDYH 5KZCB 4QRPA 3KPRA 5JPMB 2FYYB 1CFQB 3TBVA 1CGVA 5DQ9A 1Z9MA 4Q9CA 5AAMA 3S4SA 2IALB 3D3VE 4ZDHA 5B39B 4MHHI 3WNLA 4CNIA 4GMTL 2G75B 4F15C 3ROOA 4ZUWA 4FN0A 1CDIA 3EDEA 4H26B 5EBLA 2LVCA 1IRAY 4S1SL 1KJ3L 5E94B 3RTQB 4KKLC 2UY7A 4WV1B 5HYFA 2YPKA 3N1MC 1A7PH 1ZT4A 4TUKL 4PTUA 4OCXH 5GS3A 3MFFA 1NFDA 4EZMA 4BM7A 2JIXB 4OGYH 3HRZA 4JY4B 1AP2B 4F58L 1G9NH 1QLFB 4RZCA 2F54E 1B90A 3V7MA 3QUKB 1GAFL 2R0ZH 1YECL 4LCYA 5EUOE 3CK0H 4A2MA 5IP4A 4GG6E 1XMWA 4I18A 3GIZL 5MEPB 1U8LA 4W4NA 1KJ2A 1JHLL 3KR3L 1UQSA 3Q0HA 5DR5H 3K1KC 2OTUA 4LSRL 4POUB 2YK1H 3MBXH 4PLNC 2EDXA 2BK8A 4PJDF 4WTZG 3V2AR 2EXYD 3RIAK 4GLRH 3PWJB 5T1KB 3MV9D 4XRCA 5HYSG 1MFNA 4NO5B 4K2UH 1U41A 3CDYA 5I16A 3FQTB 5LBSL 2E7MA 4H20L 5KSVB 3A6OA 3VH8A 2AJUL 5EOQL 5IFJA 1AFVH 1MHPL 4HIIA 4QXGH 5GS2D 1UJTA 4GSDL 1S7SB 4JJ5A 2W9DH 4OKVB 4F57L 3S36X 5J89A 1R6VA 4JO3H 1TTFA 2N7AA 1X5IA 3MREB 5FM5M 3V6OE 1WBXB 1OP9A 4LDOB 2PYED 5LXGL 5CILH 3JV4A 1O7VA 3S88H 4JE4B 3QIWC 5SWZD 4PD4J 5ISZE 4K71C 4OF3A 3V5HA 3SDCD 4ODSL 1N2RA 2CO7B 4ZQKA 2HVJA 3MOBH 2C3WA 1NANI 3WFZA 3SO3C 4G3YH 4AQ1B 5I1HH 1NC2A 2C3XA 3MLZL 4DVBA 3S37X 1TMCB 1FC2D 5CS7A 4N0UB 5D7KD 2V7HA 4G9FD 1N8ZA 1EEZB 4F9PC 1RIUH 1WZ1H 3O2WL 4LCCC 3A6BH 4Z5RB 5I66A 1I9IH 3W5MA 1REIA 5D1ZC 3MRIA 4H5SB 2I5YH 3QFJB 4FQ1H 4LSDA 4UIMA 2IPUG 5CZVL 2YMXL 4LEXH 1F4HA 4ZG1A 5FHAL 5C0CD 3AB0C 4Y16A 1QPXA 4LVNC 3LKQB 4ELMB 4LSPH 2MCPL 1ZHLA 3RNKB 2XKNA 4UDUA 1TPXB 3OHXB 5C8JB 5IBLD 3KYOA 1NCCL 2CK0H 4JM2D 2APWA 4JLRA 4PG9A 4OLVL 3RZCC 4LBEA 5C0DB 5EZLB 1INEH 1GH7A 2X9WA 2VDRH 3NN8B 2Z4QB 2DQDH 4UU9B 5JXEA 2AJ3B 2ARWA 5TPWH 2FEDD 4JFQA 4PRDA 1CGYA 5CHNB 2BSRA 2NY6B 5L2KA 1T3FA 4L9LC 3RDTA 4ZYKB 1QYGL 3X14B 4X0KB 1UT9A 5ACZB 2O5XL 2VL4A 1E4JA 1RK0B 1KYOJ 3H0TA 4UZGA 4KMLB 1IGYA 4HWBH 4OQTA 1T7VA 5C7XL 3IJSA 2XPGB 4KKLD 5M7QA 3U0WH 5ICXA 3KAAA 3WXVH 1BEYL 5H37G 1K4CB 2R1WB 4XPBL 4PJFF 3BPLC 4JY6A 2FB4L 1FLRH 3BH9B 3DVNB 2ADJB 1P7QD 1FNEA 5C3TA 3PQYA 3RUGF 1HOCB 5HY9B 2AV1A 5C07A 1N0XH 1S7VA 5BV7C 2R1XB 2DQIL 4Y5XB 3MZTA 3MNZA 5EO1B 1NH6A 1EFXA 4LFHG 1NBVH 2GCYA 2F58L 4EXKA 5FM8A 2F53A 4M6ML 1CVSC 2F5AL 3VRLE 5EU6E 1RULH 3VXMB 4KTEH 2FHFA 3RQ3A 4FQXB 1XR9B 3LAFA 3NBNA 5HVFB 4OCYH 3ULUE 4X7TA 4L3ED 1A6VH 2J8UF 3SDXF 2EKSB 2ORBH 1OD9A 4R8WL 4G43B 4MD0B 4WCYL 1BZ9B 2C1PA 1T21A 1NGPL 1PZ5A 3VGAB 5MENA 1FFRA 1G1CA 1YY8A 4U1JB 5EU7E 1Z9LA 1PLGL 1LEGA 2Y7QA 3KPOB 3OKOA 3FRUB 3FB6B 5FFLA 3UTPE 2FEEI 3VXPA 1ED3B 3MRGA 1C1EH 3QIWD 5DEFA 1MAJA 2IPTH 4HWEL 1IVLA 2BDNH 1FDLH 1JHKL 3LS4H 3UTTD 4PRIB 4U1HB 5HVWA 3TVMD 4EUPH 5JHLH 3GSQB 4DZ8A 3ROLA 3P4MB 4Z9KB 4Y8AA 4JG0H 2Y5TA 2JLLA 3DHMA 4NCDA 3QIBB 5CCKH 1P4BH 2GTWB 2X44D 2P5WE 2YEZB 2ZPKL 4U1KA 2EH8H 4N9GB 5K9JL 4K3DL 1RMFL 4WEBH 2WWKT 1DUZA 3F12A 4O02H 5EZIL 3N9GH 1JGVL 1YEFH 4JFZH 2IQAA 2VAJA 5D1ZD 5GS0C 2HFGL 5DD3L 1CZ8H 4K9EC 4IMLB 5D2LB 4OTXH 2DTMH 4KK8C 5B38A 3QUXB 2ZSVA 2R56H 1EBPA 1BIHA 5KANG 4JANB 2JJTC 1MHCB 4J3UA 2E7LA 3IXAA 3LPFA 3U7AA 3ZTJG 1BOYA 3B3IA 5J11C 1VFOA 5TE6L 2AJYH 1UACL 3RZCD 4GAYB 1AO7B 5TF1L 4DW2H 3IETB 1RZKL 4MQXC 3TO2B 5DS8A 4MB3A 3L3DB 3P9MB 1JZ3A 3O6KH 4U7SA 2EZ0C 4U7MA 5D72L 2W0PA 3NACL 5BV7H 4DEPB 5GZOC 1KB5L 3RIFF 5ICYA 1GPOL 4LSSH 5F9OL 4Z7VA 5DMIL 2ZCLL 1IGJA 3MC0A 4UIKH 3WJJC 4GS7C 4JQXA 3WHE0 1G7LA 1MIEL 5ESVA 2A74B 4RGNB 1KIQA 2FZ3B 4YH6A 1MCJA 5IHZB 2PXYA 1CDHA 4M7ZB 3H7LA 2H9GA 3FL7A 4Z7UE 2BNRD 3U82B 4XBPA 3T2NH 5I1DA 3PGDB 2Q6WA 2X4SB 3O0RH 3VFOB 1YUHA 3H9ZA 1U8HB 1VFAA 2BSTB 3VGGA 2D9QB 3L6FA 4PJ7F 1IGML 2BOCB 4M61A 4XP5L 3DXAE 3KYMB 4LGSB 5DWUH 5IVXB 5E0QA 2VLKD 3QPXL 3LKOA 4I0CC 4TSBH 2FJHA 2EDDA 2YD1A 4LLDB 1EEYA 4PJXF 1ZLWK 2VH5L 3NCJL 3RWEA 3PHQA 4LSUH 2DMBA 1A6TB 2RBLA 2VMFA 1T7YA 5ILTL 3MR9A 3IJHA 3MLUH 3I6KA 1HH6B 2VISA 2HKHH 1OCWL 1JPFA 3WL9B 1V3JA 2Y9RT 4L8DA 5K9QG 3GIVB 5D6DA 1JNLL 2AXJA 3CSYB 1X5JA 4ZO8A 3RVTC 4NKQB 5J8OA 5D7SL 4ZFFA 2NQCA 4LVHB 4MCZA 5JW5B 5E70A 3K4ZA 3D25B 3HFMH 4U3XA 4N0CC 1JK8B 1C5CL 5EU6A 2P8PA 1WFOA 3T77B 1DLFL 4WTWA 1KEGH 3WHXA 1H3VA 1M6OA 2LU7A 3IU3B 2NCMA 4ODTL 3DYOA 4PRHE 5I1EH 1T0PB 3QEQB 1F13A 3O3AA 1DUYA 3LPWA 1T7XA 3VXNA 1E6OH 1EV2E 5I74B 1MAMH 4PP2A 3HNSL 1XIWC 2KKQA 3VXRB 1I1AB 4Y19D 3VFWB 2V2XB 4I0PA 1XCQA 2UWEB 3LHPL 5GGUA 2MKWA 5GSVB 5M94B 4QHMB 1MREH 3I2CH 4U6VL 5B8CB 3WKNA 2LFGA 4MX7B 3MO1A 3HMXH 4BKLA 1I85C 4S0SD 3U30C 1LK2B 2AQ3A 4MHHG 3ARVA 1ZHNA 5GS0D 3QUYD 1T83A 3G9VA 3O9WA 4TUJB 1ND0B 2R9HC 4KK8D 2ITDA 5ALCL 4V1DA 2LV4A 4R97B 4CKVX 3CZFB 5IHUL 2YPVL 1J0YA 4KK6C 3OB0K 2PCPA 3RKPA 1AGCA 2FATH 5F8QC 5J7CC 3DGGA 3MRNB 3ALXA 3V52H 3M45A 2J12B 1TETL 3D0VB 4X6EB 3PL6B 3MXWH 2KQNA 4MQXD 4KK9C 3FB7A 4M6OL 1BFOA 3VWKA 2HN7B 2EZ0D 1JGLL 4F33B 4NWTH 3ZTNL 1MPAH 1WITA 4I3SL 4HS8H 1J5OH 1RQ5A 5GZOD 1CE6B 4LCWA 5KVFH 4G6KH 1T4KA 3L3OA 5CJXA 3AAZA 2YSSA 5F9AC 1YEHL 3ESVF 3GMRA 2VDML 3NA9H 5JOEA 1FYTB 3SE4C 2VLMD 2ED8A 2H1PH 3TH4T 4NN7B 1K9TA 1VGEH 3CXDL 4C55A 3BVNB 1U2HA 4YPGB 1EHLL 4L8BA 1LEIA 2OMBA 1YNLL 1EXUA 3W9DA 4JFPA 4X80H 3SOBL 1H0DB 1G6RH 1CTOA 1QBAA 2IQ9L 5HPMA 1XGUB 4BQ8A 5IMKB 5J56B 4NKIL 3CDFA 3QB7C 1U8MB 1LO4H 1QRNA 1YYLH 3HC0A 2X4OB 5L2JA 4AK1A 4MA3A 1HCVA 5KVEL 4OLUH 3TN0C 2CKBL 1PD6A 2QV2A 4XBEH 1HSAB 4WJ5A 1Y6NR 1U3ZA 3B9EA 1JMXA 3LN4B 3KNBA 2I9TA 1BHGA 3QDAA 1ZHBA 4HXAH 3KPSD 2EICA 3EOTH 3O4LA 3CCHB 3RVTD 12E8H 3QIUC 3U6RA 1OAKL 1ZOXA 3BGFC 2IAMA 3QH3B 4K7PY 2MSPA 4N0CD 2JF1A 4QTIH 1RSFA 2AXFB 3IDMA 3LKNA 1WZMA 4Q2ZA 1CK0L 3MV9A 1CBVH 1XGYL 3T4YB 2FLRT 2Z31A 4WFHE 4XGZB 4JFEB 2MPAL 4XCYA 3JV6A 3K81A 1PBYA 5DO2C 1U3HC 4TNWF 3LEYH 1VA9A 3QA3B 1LP9B 4S1RH 4XP6H 5H94B 1XIWD 5FOBB 3ZDXF 5IJVA 2PTTB 4OB5L 4WFED 1Q38A 4OM1H 4MJID 2CDFA 2YRLA 1F6AA 3CU1A 3U79A 4LQ1A 1BD2D 2PYEA 2XTJB 1BQLL 4MDIA 3RWIA 4E41D 1L9NA 3MUGB 5SWZA 2BY3A 3SCMC 3VI4E 3GBML 1IC5H 5EPMA 1TJHH 2IJ0C 4LARH 1DBAH 3TBTA 3QZWG 4XNUH 4UILH 4I9WD 5DJYB 4GW5B 1ORSB 5DI8B 2OI9C 4KH2A 3CFKA 1VPOL 2R9HD 1N4XH 3CPLA 4ZS7L 4G9FA 5AUMA 3NPZB 4UT9L 3WJLA 1YEJL 4KK6D 4AMKL 5LGKA 3PDGA 5GS1C 2ZOLB 2VQUA 2CK2A 4H88L 4HDIA 3TT3H 3D39D 4HQQL 4KI1A 4Y89A 1AQKH 3CAFA 5I0ZA 4D0BA 4KK9D 2DWDB 1XGTB 1LO2L 3Q1SL 2QKIB 3V6ZB 4OZGB 3QYCA 3KYNB 1W8NA 5MERA 4UINL 5EU4B 5HDLA 3U4BH 1VFBB 4K7PH 1XH3A 2BRRL 4QOKE 5C6TL 1VACB 4WY7L 4GXUM 4JM2A 4RAHA 3GM8A 2B4CC 3MRJA 1CXHA 1DTUA 4H0IA 4GUPA 4CADB 4JFDE 1ZVSB 1TQCC 1MFDH 3IGAA 4P99A 3EYSH 5FGCB 1TCMA 4HKJB 5F1SA 1Z3GH 4PJDE 3VJ6B 1YEDA 3CVIL 1DL7H 2R2EB 3E8UH 4PFEA 3G6JF 3HNTL 2NY1C 3A67L 3ILPA 3TF7C 2X10A 1IQWL 1GGIL 1C12B 4F7TB 1BLNA 1JRHH 1KPRB 3M1BB 3GO1H 4X98A 1YMHA 1OLLA 1P7QA 3BZEB 4OLXL 4L4VB 4MLSA 2WUBH 4HUWA 3TN0D 4DUWA 3MYJB 5IFHL 1FC1A 3MCLH 2J2ZA 4YHML 3NH7H 4F37K 3FFCD 2MHAB 1BMGA 3VGDA 5ITBL 5KVGL 1QUNA 2ZZUT 5FA3B 4AM0B 4BQ9A 5DA4A 2DQTL 2J5LC 4M62L 1MFBL 4OIIL 2KL6A 2UZIH 2G60L 4QKXB 4HWBA 3GMQA 2P49B 1IGTB 4R96A 3QIUD 4X6DA 4AENB 4C56D 2OCFD 5C08B 4P2OC 3T1WA 2Q3ZA 5MP6H 3BKCL 1E4WL 4L3EA 4ZSOB 4P2RA 5I73C 2NZIA 4XNZC 4Y0GA 3FO2A 5C0RH 4HT1L 3LDBC 3MJ8B 2HJFA 4NIKB 3OJMB 4YHLL 3DOSA 2HFTA 4UAOC 1KCSH 3LH2H 5HHPA 5BMFL 3FHQA 4NC1E 1NCWH 1U3HD 1ZT1A 5DO2D 5TE7H 3KS0J 4CVUA 2G5BB 3OKMB 5J0BA 3HCVB 1SEQL 5I1JH 1NBYB 4OCWH 4JFOB 5D1QA 5ADOL 3ARGC 3PIQB 5E4EC 1RZFH 4LEOA 3CNKA 1DLHA 1WZKA 1J10A 5I76A 1F97A 3DUHA 1I9JH 4BSVB 4PLKC 3CGTA 3MV7B 5GJSL 5GZNC 3SCMD 4FXLA 3UTTA 1D9KA 2JB6A 1A6UL 4IRSB 3TVMA 5FB8A 5DZOA 1EJOH 1QFWH 1MJ7L 1J1OL 2L4OA 4MAUH 4J23A 5T5FH 3HPLB 5JORB 3HZYA 2YD2A 4OLEA 3VXSE 4YXLH 1FBIL 4EI6A 3EJYC 3OF6D 1DSFH 2GQHA 3CVHH 1AXSA 4F9PA 3MJ9H 4LCCA 1N6UA 1OAYL 3LIZL 5IK3A 3DUSA 1TCRB 5D1ZA 2A6IA 4J3WA 4ZDHB 2QTEA 4QY8B 1TJIH 2R0WL 5ID1B 2HJLA 2QR0A 4N8VG 4HKXB 1ZT4B 3O2DL 4P5TB 3IU4H 5F9WB 5IIEB 5M95B 3P30H 4RMQA 2R0KL 5DJ6A 1VDGA 3OKEA 1W0VA 3HRZB 1JNNL 1FH5H 1CFSB 4NCC1 4X4YA 5LWYH 2CLZB 1FAIH 4JKKA 3IDYC 2E8ZA 4R2GB 4RZCB 1C16A 1F4WH 3PWVB 4YXHL 3ZKMC 4ZNEE 3OAYH 1XR8B 3L95A 4LCYB 2J8UE 3SDXE 2XA8H 1UXWA 2NY0C 1WBYA 2HWZH 4KI5E 5EFIB 5F3HA 3BIKA 4H1LA 1TJGL 5ISZD 4ORGA 1JWMA 4I77H 3WNNA 4MQTB 5DD1L 2NY1D 3N85H 4PJIB 3H7BB 1P1ZA 4OZHF 4JVWA 5F1OB 2B2XH 1AHWC 3D9AL 3PV6B 3IFOA 4RIRA 5EBWB 5E00A 4PGZA 3WLBB 1W0WB 4UQ3A 2HFFA 1IJ9A 1ZSDB 1S7XB 1HK6A 1JTPA 3QISA 1YDPB 4FQHA 4U1MB 4XRCB 3O11A 2OK0L 5E6YA 3QEHB 5H35A 3IS0X 5I19H 5EU3A 1EAJA 3PGFH 4Y7MA 4PJDA 2HH0L 4LASL 5KN5B 1ZLWH 4ZUSB 1WGOA 1IL1A 1MQ8A 3LKRB 1OB1B 5I75B 3BP5A 3E2HC 2XRAH 3LN5A 4TPRH 1EEQA 4HS6B 3QUMB 2MTPA 4X4MA 4ZS6C 1GIGL 1WTLA 1UCTA 2IG2L 3KPNB 3JV4B 7CGTA 1NGWB 4P2OD 1NL0L 4FG6C 1BAFL 5C9JA 3ARFA 4LCIL 4XVTL 3V5HB 2WBJC 2EEBA 1OSZA 2VDLH 3WIIL 3RA7H 1X5AA 5LGHL 2B1HL 2R0LH 2XN9D 3S7GA 1N3NB 2BMKB 4RFEA 4EKXA 2YZ8A 1NMCB 5JR1L 4WUUA 2J8HA 5ETUB 4S0TD 1HQ4A 1A7RH 5EC2A 1NEZG 4WFGE 3SGKA 5DURD 1I3UA 1WBZA 1MVUB 4LDLB 2DQJH 2W92A 1RURH 4HH8A 1J05B 2NW2B 3GHBH 4NNXB 3LCYA 4EI5B 1XGRB 1SYSB 3FB5A 1CDJA 3MRFA 4MQSB 4P2QE 4Y4FC 3BDYL 3ARGD 1PX3A 1MCPL 4QT5B 4UIMB 4YUEL 4YXKL 1YQ2A 3P73A 4L3AA 4JGMA 4PJEB 3HI1A 4PLKD 4OZIB 5FO8B 1G0YR 5GISH 5GZND 2CIKB 4X6BB 2FBJL 1ZA3A 3IFNL 5DVLA 3R0MA 2EIBA 3PABA 3V8OA 1OT2A 4M7LH 2E6PA 4Y19A 5DTFA 3B2UC 3FONA 4PG9B 1K5NB 4NSKB 4F37F 1UFUA 1SVZA 1I1CA 2H2PC 3B6SB 4LBEB 1JNHB 3EYUH 5AAWA 2GJZA 5F7WC 1MWAL 3EJYD 2IAND 3JUYA 3MJ6A 1DQQB 1PDKA 4P3WA 4NQSA 4GAGL 4JFQB 4HX1A 2BSRB 5A1AA 5L2KB 1T3FB 1B0GA 2OQJA 1KENH 3C2SA 4GKZA 1HILA 2DQFB 3Q6FA 5E8OB 3DJ9A 1XGPB 3QUYA 1VHPA 1I1YA 4FFYL 1G7HB 3OB0H 3KS0H 4G6ML 2EDJA 2YPLE 1CFNA 3H0TB 4TOYL 4PJ7E 1YMMB 1RZ7H 4LPTA 1LO3H 5TDOA 1D6EA 4MD5B 2YHGA 1MVFA 3DUUA 5JMOC 4XVSL 1Q9KB 2FCBA 4NDMB 1ZANL 4HF5L