2A6DB

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide rlliadppspre
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
219
Chain Sequence
EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSVYYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Germline antibody 36-65 Fab light chain
total genus 39
structure length 219
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6dB02
3BAEL 3GKWH 2YSSA 3MRJA 4U7SA 1XCQB 3G6JA 4P2QE 1SJHA 2V5TA 3ARFD 1TTUA 5CGTA 2ITCB 3A67H 2YK1L 1IC7L 1N5AB 3C2AL 5FO7B 3PV6B 3T3MF 5D4QA 4DZ8B 4KQ3H 3H6JA 4BKLB 3QFJB 4TVSa 1RMFL 1G7HA 2NTFA 3HUJE 1HYRC 5DD1H 2X40A 3SE3C 5HDOA 4XVSL 3VU2A 1BOYA 2VDQH 4HWBL 4OB5L 4LVOB 2XXMB 1M6OB 4LCUB 1BIIB 5FHAH 4HV8B 3STLB 3FO1A 4QHMB 3ETBF 5HHMB 4DUWA 1F4XH 4NM8L 4LLAA 5CWSA 5J57B 1MNUL 1YPZF 5DURB 2UWEA 5D7IE 2E8ZA 4QXWA 1CDJA 3JWNC 4TVPH 1AGFA 4C56D 1I8LC 1JZ2A 4A6YA 3BH8B 5AAWA 1KJMB 1LP9E 1U8JA 3O3DB 4PD4K 3GHBH 4XVSH 1JTOA 1GIGL 3RX7A 2H26A 3KG5A 2IQAB 5C3LD 1KIUA 3MA7A 1WZMA 4KWUA 1JZ7A 3A6BH 3DUUA 3I3BA 4X4YA 3STLA 3RWGA 2XA3A 3TJEL 4OKDA 3RWCA 4WRLA 3CX5K 4G43B 3QZWG 3IS0X 5EUKA 5D7IF 5E9DB 4FNLH 2Z91B 5DK2B 4JFPA 5D6DA 1R3KA 4XP5H 3GKZA 4PJXF 1JP5A 5I1HH 4K7PY 1HOCB 5I18H 5EPMB 1FAKT 4D0CB 3WNKA 1KENL 2BVPB 4OLWH 4PLJD 1OGTA 3GMNB 1N4XH 5LQBH 4PIRF 5LQBL 1HINL 2R56H 2XZZA 2ZJSH 5HYQB 1E6OH 2YUWA 3EYSL 1FNHA 3AMKA 1F3JB 1ZHLA 3MLVH 2APTA 4U2YA 1QSEE 4UBDC 4OLZH 4ZSOE 3TFKC 3GI8L 5DJ0A 2R23A 3N1QC 4FNLL 5CIPH 3CGTA 2AEPL 3TPUA 4Z7QE 1N26A 3WEXB 3LPFA 4QCIA 3U9UA 2Q86A 4Z8FL 1CZ8H 1KCVL 1TZGL 4ZOEA 3GMRB 2J2ZA 2C4FU 3N1MC 5EC2B 3OKOA 1FL3A 3DOSA 4PJ7A 4D9LH 4KTDL 3GMPA 1FN4B 2CJUL 5EU3B 3QUXA 3L3OB 3BIKA 3BQUA 1RQ5A 3OAZK 4JO4L 5IKCA 3BW9B 3BKCH 3HE6C 4X6DA 4NNXA 3OXRA 3ZYJA 1P1ZB 2BY2A 2R2BA 4POZD 1J8HA 4HGMA 2VIRB 1W72B 2IH3B 1KULA 3EYQD 3SCMD 3P30L 3WEXA 3QH3B 5L9DH 5MEQA 5F1OB 3BMVA 4LDEB 4NZRL 4PG2C 5ILTL 3KLAA 5DJ0B 3SQOH 3VDCA 1WAAF 5JDSA 1YQVL 2F54B 1T6WA 3BKYH 3CSPA 3MREB 1WBYA 1OWWA 3LMJL 4LRNL 5DZOA 5SWSA 3LVEA 4NQCE 1CDBA 5T1MB 5CKAA 2R1WA 3JV6A 4XWGL 4H5SB 2F19H 4GXVL 3RL1A 5A3IC 4BA8A 4FQ1L 4NZTL 2FJGB 5KSBE 1J8HB 1NAKH 1NDGA 4LRIC 3EO9H 1P6AB 3U4AA 1G6RA 3MXWL 4CDGC 1NBYB 3OXRB 2A38A 4JFFB 1A6UH 1OD7A 4PREA 4BH7B 1JHKH 1Q94B 3TZVA 1S5HA 4XNZC 1JGVH 4MNHB 3RP1A 4G8GD 1WIUA 4NP4H 5BRZE 4NKIH 3SKJL 2WUCH 4P5TA 1DLFL 3E2HC 4LLMB 3ALPA 4YBQC 5DLMH 3GJFB 2AK4E 4F7PA 3LY6A 4R7DB 4NGHL 1AR1C 1TCMA 4X5WA 2V7NB 3CX5J 4O2CA 3QQ4B 4MHHG 2XN9E 1LO4L 5JMOC 2KQMA 4YC2C 2DQHL 3NFNA 5EUOE 5ELIA 3ORJA 5HY9B 4ETYA 1CQYA 4M4PA 4IMKC 4K71C 3SDDB 4R4FH 1U36A 1OAKL 1ZE3C 4HFWA 5C9JB 1WCBB 4NKMA 2EDFA 3ZE1F 5T5NF 3RNKB 2XNAA 4G6FB 3QO1B 4G8GE 2D9QB 2P44B 2D7OA 1FZJB 3K74B 3O6LH 4WGWB 3EFDH 4P5MA 2OTWB 1J7VR 4QY8B 5DD5L 4Y19A 1WBZB 1N8ZB 4KRNA 4JM2B 1A4JA 1MCEA 4YHKL 5FFLA 3TT1L 3U7WL 4GRWB 3DI2B 2A0LC 1QFPA 4O2CB 2PYEB 4NHCH 1NUFA 2VXQH 2VE6B 1F58H 3RNKA 3OR6A 3TO4A 5KSBA 5C0RL 5DO2D 5FYKE 1DDHB 1BZ7B 4JFEE 1A1NB 3ROOA 1HSAB 1T5XB 3QEGH 3T3PF 5E00B 2EYTA 2J6EA 1RUKH 1U8MA 2WNGA 3UTSB 3DRTA 2R1YA 3SKOA 3QIUB 4IIQC 1XR8A 3LDBC 1M4KA 2UYLA 4ZO9A 1ONQA 1Q72L 1QPPA 4UI2A 4U1LB 1J05B 3ZDXF 4Z7OF 1AXTL 5I6XC 4MYWB 1EJ6A 4OZ4A 1D5BB 4U0QB 2H8PA 4I8DA 1C1EL 1I4FA 1VENA 5E9DD 4LL9A 4JGJA 3QEHA 1TVDA 2D7MA 4HGKC 3RGHA 4RWHA 5ISZD 5GSRA 4J3VA 3MA9H 4QHMA 1HILA 4YXHL 4QHKI 3B4NA 1DCLA 4Y5YB 2IBZY 3ARRA 1F3DH 4YDVA 5ID0A 3ZDXE 32C2B 4M6OH 5CBEA 4JFEA 3NCMA 4L4JA 5DVNA 3WS3B 4TNVK 5I30H 3CFIC 5EH1A 4AH2B 3OF6A 4PYHA 1AXSB 1U8HB 3MO1B 4OZGF 3QNXA 1RSFA 5L7XL 1AO7D 4MB3A 4QXTA 5KJRH 2KDGA 3MOAH 4ZG1A 5B39A 2D7TL 4HWBA 1I1RA 2AJZA 4JFOA 4B50A 5JNYB 2CO6B 1A8JH 3D87B 3QEUB 4QXUH 4WU7B 4L4VB 3BO8A 2EDWA 1JHLH 1H15B 3PQYE 4NCC1 3H3PL 3DBXA 4OCMC 4S1QL 5J4MA 1K8DB 5T1LD 2JJSC 3CMOL 4EQ2A 4PTTB 2UWEB 3X3GH 2ICCA 3MMEA 4OZGE 1K4DB 3DLQR 4HCRL 1AGFB 1NLDH 5I1IL 4I48B 2HRLA 3HI6H 3MRPB 4G6AD 3D18B 1D6EB 4KVCH 1ZLUK 4JDTH 4QXTB 5JW3H 2GKIA 3ZKND 3K2MC 5TJWK 1E4WH 3TA3C 2EIEA 1DBJL 5HHVH 1BF8A 4YQXL 3TGXA 2D0HA 1MHHB 3BD3A 2DQJH 4WY7L 5DJZA 1ZLWH 1RZIB 1D9KB 2X4TB 1MI5B 3T0EA 2VZVA 5A2KH 1LE5A 4M1CD 4KI5F 5IMOB 1FYTA 4XBPB 3SN6N 43C9A 4NSKA 3QUZA 3QIWC 4MCZA 5HI3C 1FNSL 4FFYH 2VH5L 3QT2A 5FHBL 5IFHH 2J8UA 2VDLL 4XPGH 1YMHA 1RK0B 4Z0XB 4LEXH 1SHMA 5C0JB 4JDVA 2IGFH 4TSAL 2YD8A 3UTSD 2HFEA 1C7SA 3ZHDA 2X7LA 5HBBA 4JM2D 2ERJC 3VMNA 3QH3A 3UTQB 5EU7E 4UT6H 4PP1C 2NY4D 4I4WA 3RIFF 3UO1H 3I6KA 1BFVH 5MEPA 4LCYA 1ACYL 3C8KB 2FO1A 3RWDA 1U92A 1VHPA 5D71H 1RUMH 1GOGA 5CEZD 3S5LA 1XF3B 4JQXA 1WFUA 3D85B 3RBSA 1X3DA 3AB0C 1CXIA 5F7DB 1A47A 4G8IA 1NJ9A 3VXSB 1OLZA 4NO2B 4OF0A 3O4OC 4DOHB 1T04B 3C5SA 3RTQB 5JPNA 5F7EL 2B8OT 1TQCC 5DUBB 1OAKH 5FYLL 3BVNA 4MSWB 4JO2H 4DKEL 2DQGH 1GZQA 2BSRA 1R3JB 4P23B 1K5NA 3TJHD 1MJJA 3RVTD 2B1HH 2W60A 1L9NA 5INDB 3J8F7 2AV7B 5D7LB 5JQHC 4JPIB 2Z8RA 1B6DA 3RVWC 2EXYC 2QSTA 4XVTH 5IW3A 3KPQB 2YD1A 2F9BT 3ARBD 5MENE 3GEWB 1N0XL 3RWIA 1NJ9B 5DRZB 3VH8A 4RAHA 1ZVSB 2VDOL 4QTIH 2KH2B 2P45B 1BECA 5T1KD 3OKEB 2WM0A 1IC4H 5IBUG 4JAMA 3OBAA 3AM8A 3QIBB 4MXWL 2FSEA 3LRSB 3VWJA 1R5IB 4OCXH 5T1KA 4PUBH 2BSRB 3QHFH 3KPOB 3LSOA 4HUKB 5FYKU 4K8RL 3WDIA 4BZ1H 1I1YA 5HYJA 3KXFE 4P3CL 3PWLA 5EN2A 1CD8A 5E5RB 3JBG7 4OZHB 3ARPA 4XB7A 1DQJA 5TQ0L 1MFEH 1T21A 5GHWH 5F9OH 4FFZH 4C57C 3GUTA 4HUVA 4S1RL 4RISH 3WIIH 3BZ4A 3CFBB 2DYPD 4JQVC 4DCQA 3BSZL 1R5WA 5IM7A 3HI5L 2Z31B 4M6NL 3QHFL 5CSZA 3B3IB 3HE7D 4JM2A 4J6RH 2MHAA 4ODUB 5L8JB 4WEBH 3RJQB 3PWVB 4HZLB 1J0JA 2HT3D 3DYMA 4OD2B 4ZUTB 5EOCH 4L4TA 2BSTA 4PJ8D 1RY7B 5C0CB 2DICA 3OR6B 4YR6B 2N4IA 1IBGH 1CFTB 4HUXA 5BQ7B 5EUOF 2UZXB 4L3CB 1FYTD 1U3YA 5EZLA 3GMMB 5HYSA 4M8QB 3FQRA 3TN0A 4PGEA 4NC1E 5IROA 4U1SA 3F7YA 2CJUH 2D03H 5EZOH 3RKPA 3T0ED 1KLGA 5ERWA 2AK4B 5IWLC 4LLDA 5D6CA 5F6HI 3RVUD 1IJ9A 4OZFA 4R0LC 1FZMA 4LSDA 4WJ5A 4P4KD 5ENWB 3TIEB 3NIDE 1CBVH 4QWWC 1CTOA 2C3GA 2H2PD 4X7SH 4MAYB 1MWAA 3BP7A 4Y4KD 2H8PB 1QBMH 3RDTB 4Y5YC 5E8DL 1WT5C 3JV0A 2R0KH 2R29H 3DIFA 1F4YH 3GRWH 3QG7H 4U6XA 3SE8L 4RMTA 1CF8L 1YN6A 4QHUA 2EDQA 1FVEA 4TN9A 5IBTL 5JQ6L 4ESKA 2DMCA 1NDMA 2WWMC 1AD9A 3B9VA 4GT7A 1IMHC 1ULVA 2YOCA 4OCYH 3MLTB 4ELKB 2E7CA 1HH6A 1HHHA 4WW2F 4JKMA 2NY3C 3S35X 1H8NA 5KVEL 4CVUA 1FRGL 4P99A 4KROC 1OAYL 2BVEA 1T2QL 2JB5H 4WHTA 4YUEH 4R26L 3HI1B 4PY8J 3QDGD 3WN5A 4U6YB 2P7TB 3I9GH 3DX9B 1OWRM 2BXYA 3SOBH 4YGVA 5IW6B 3FL7A 2BZDA 3VCLB 4LFHG 4P2QB 3WJJA 1AD0B 3B9KB 4FZ8L 3Q48A 4L3EA 2QEJA 4JLRA 5CEXA 5FM5M 2VAAB 1DQLL 3QEHB 4PR5A 1SM3H 4HUWB 4KHXH 3U0WH 2IFFL 3DSFH 2HJKA 1KT2B 2Z91A 3LH2L 5DK2A 1H8OA 4OCRH 4OCRL 4RX4A 2B4CC 5BV7H 5TQ2H 1ZHKB 3MLTA 3OAZH 3S35H 4ELKA 1DUZA 5ID0B 3CK0H 3S98A 3NGBC 3S7GA 2EYSB 4TVPL 2IAMC 5DEGA 3BZEB 2ESVA 1NC2D 4WUUD 3C5JA 2W9DL 5CINH 1KEML 5FO7A 1ZTXH 5F21B 4KZDL 3MRRA 4XP6L 5C09A 1U2HA 3QDGE 4HAFA 4HKXB 5T33H 4K94H 2D7PA 4PRPD 3DX8A 4Y5VA 1JWMB 1V5JA 2OL3B 3IF1A 5JW4M 3L5IA 1J10A 1GPOL 3EZ8A 3V5HB 1TVHB 2Y07L 5CWSB 4KTYA 1KYOK 3MLRH 3SDAD 1A6ZA 3RTQC 1XF4B 3BH9B 5GGSB 4JCLA 4PJXA 1RJZB 1YEDA 3K80A 4Q9CA 4MCZB 3BQUB 5IHUH 5L8KB 1FORH 1UM5H 1JNLH 1JNLL 4I3GA 5E6IB 1QFUH 1YEEL 3GKWL 1YJDH 1AQKL 4JFDD 1M71A 5LGJB 1AGDB 2BFVH 3H42H 3ABZA 3VFTA 3IRZA 3ILQC 5J1AA 1LO3L 3N9GL 3H8NA 3NN8A 4LLYB 2CIIA 1TMCB 3BKJH 4KMTH 4KXZH 1OGAD 4Z76A 2DWEB 4X7FC 1U41A 2EH7H 1TVBA 1INQB 3HKFA 2VLJE 5C3TA 2CLVA 3HPJB 3CMGA 3MREA 3CSYA 5I1EH 4PJCF 2RB8A 1JF1A 1BBDH 1MHPL 1ITBB 4KKAD 5FO8A 4OV5B 1SMOA 4HLZG 1XF4A 3O3EB 4XVUD 3BH9A 4ISVA 1D5ZA 3FONB 4KPHL 2OJEA 2XZQL 1T1ZB 5D70L 1MAJA 2ARWA 5AWNL 2KBGA 5F7UA 2GEEA 4NHUA 2HT2D 2BNQB 1JWUA 4NO2A 4F7TA 1DSFH 4XP9H 1I9JH 3QCTH 1XEDA 3V8OA 1NAMB 1U8PA 5ALCL 3NOIA 4YDIL 5E2VL 5KOVC 5FO9B 1R3LA 4P2OB 4JR9H 3GBLA 4HKJB 5FM8A 1GGIL 4M7JL 1S7XB 4I0PD 5MENB 1BHGA 1EXUA 3ZO0A 3TPUB 1NFKA 4I0PC 3ES6A 1OAXH 4LF3B 4PLOB 2Q7YB 5B3NA 5AUMB 5I9QC 4NJAH 4FFVC 4KRPB 1U9KA 1WZ1L 3QUYA 2WW8A 4UB0H 5LGHL 3PDOA 5JLZA 3MLXH 1MY5A 2WBJA 1I9IL 4NQVB 4ZFFA 4RGND 5JUEL 5BMFL 1T1ZA 1QRKA 2P5ED 1CL7H 1EHLL 2JLLA 4LCWE 3VXPB 3ECBA 4LSUH 3ARDD 1U8LA 5DRWB 1RIUL 3VRLF 4XGZA 2V2TA 5K93A 5I0DA 2LFGA 2VDKL 2PYFB 2DF3A 4F37K 3BYYA 2FR4A 1W72A 4KVNH 4PP2A 5AUMA 4GKZB 3ESVF 1KOAA 4L8DB 3OJDA 3G04A 1Z6JT 4RWYH 4R6UA 4UIMB 5K9OA 1S7VB 1EXUB 2ICWI 5IBLC 4RIRA 3O6ML 3THML 3ULUH 4B41A 2Q7YA 1QQDA 1IFHL 4LF3A 5F9JA 1E27B 2FNBA 4NC1C 1FZKA 4P57A 1AI1H 1L4IA 4WI3A 1UH2A 4NO0B 1G7LB 1EJOL 1IAKB 1D5MA 4E0RA 5DQJA 1U8OB 3V5KA 1QBML 3LQAC 3ZKSD 1JHTB 2PYFA 1CGWA 5EO0B 2LE9A 2X4NA 3O2VL 2GCYB 5BO1L 1QRNA 3V4UH 3V4UL 3FB7A 3OJDB 3EJJX 3VFPA 1EEYA 3T4AA 2X89A 3L3KA 3GNML 5F3HB 1XGQA 4WV1C 2KPNA 3GFUA 3BGMB 3QEQB 3TYFB 5LVEA 4X7TA 4QRTA 5E8OB 4MVBC 3IKKA 4PJHB 4Y5XA 4PJEF 2NY1D 3KPPB 3CVIH 3QDMA 1C16A 1B9ZA 4ODBD 4P0DA 1RJLB 1MVUA 2Q20A 4IS6A 1JZ8A 3LKSB 3BQUC 4I1NB 4DUXA 1XGRA 2OR9L 2UVFA 1CFBA 2P5EA 5EU6A 5ISZA 4M43H 4OM0H 5ESQB 2LTQC 4H26B 1HDMA 4KY1L 1VFBA 4ZUTA 2B2XL 4PV8B 4MB4A 4G8FA 2E7HA 5J1SC 1AGCA 3ULUE 3FRUA 3FAXA 3MV01 1VKXA 5JHLH 5ETUA 4L9DA 4Y5XB 1LK2A 1S7SB 3I3DA 5F6HJ 1R0AH 5TDPA 1A3LH 3CSBA 5I8EA 5D7LE 1KACB 3B9EA 3FFCE 2NZ9D 4PLKD 5DA4A 1YN7B 1CFNB 3F5WB 4XMPH 1QLEL 2AS5M 3CX2A 4XNYH 3F6LA 2E5EA 2EO9A 3M8OL 4HK0B 5CBAB 4YK4B 3IKCA 4WGVB 5E2WL 4JFYB 1A5FL 1CR9H 1CK0H 3AVEA 1NBZA 3GHEH 1XH3B 2FBJH 4CW1B 4PPTA 2WQ8A 2YRPA 2AQ1A 4PJ8A 1EA9C 1LK2B 1S7SA 1NFDA 4BQ9A 1QFOA 4PRID 1KCUH 2B1HL 2MTPA 5IEKA 1IEAB 1M6OA 4LSRL 4PD4J 1UWXK 1OLLA 5DQDL 3MLRL 2NLJB 4LSQL 3TNNB 3CVHL 2DLTA 5JXEC 3GIVA 1IQDB 3SKMA 3UPRB 2CDEB 5FUOH 1KT2A 3PQYD 4OZFG 2H9GA 3EGSB 1Y18A 2IFGA 3T1WA 1HE7A 4D0DB 2NY0D 4CN1A 2BNUA 2ITCA 2VR5A 4DEPC 3AY4A 4OLVH 5C0AD 2EDRA 2FWOB 1PYWA 4YHYB 3QUMB 1B4JL 3NCYS 4GW4A 3W39A 4ODSL 3QUZC 1G84A 4ZS7L 4KH2A 1FG2A 5F89A 4WO4B 1LO5B 3VW3L 5L2JA 4LPVA 3QA3B 1RZIA 3O6FD 3P9MB 5GZOD 1SMAA 1XF5B 4OF7A 2YXMA 3QUKB 4MJ6B 1CFQB 4QT5B 1FSKC 2NLJA 3ILPB 5ISZE 4M1GH 1Q9LB 4LPCA 4PV9B 4Y4FD 5C0IB 1EGJH 1A14H 2XOTA 3T2OA 2DMKA 1KPVA 2ADGB 1Q1JL 4G6MH 2C3HA 1YNLH 4N8VA 1K4CA 3QJFA 2C7UA 4EZMA 3RNQA 4P5TD 3TJHC 5E1AB 2HKFH 2EYSA 5DI8B 1YECL 2K7QA 3RIAK 4IRZH 3WXVL 2NXZD 3NACL 5DD3H 2X4QB 3U4EA 3QA3A 3RX8A 2ESVD 3KLDA 5EOTA 3WLBB 3IFNH 5EA0L 2X7LB 3QUMA 3P30H 3HE6D 3VFRA 2LAGB 4HUNB 3WNOA 3O4LA 4AEHL 1MRFL 2VDLH 3CFDB 1RZKC 2ED9A 4XPGL 1INDH 4ZAKA 3QEUA 5HYEA 2VLLA 3PNWA 4LHUD 4K8RH 1O7SA 4R90L 5DMJB 5CILH 5DK0B 3U6RB 2X1OA 1W8OA 2X1PA 4FXLA 5ANMB 4Q6IA 4KJWD 1X7QB 2JB6A 1R3HB 1LE9A 4NOBA 5ESVA 2Q3AA 1N2RB 4RMVA 3DO3A 3LQMA 1XGYL 3HE7B 3D9AH 4X7CC 2DQUL 3K8KA 2E6QA 1CZ8L 1KCVH 4NUJB 3B8YA 1IVLA 1AGDA 4JO1H 1MFCH 1MFCL 3MLYL 5JZ7C 5IROC 3UC0H 4EQ3A 2VKXA 3UDWC 3GSNH 2F8VA 4BZ2L 1RZJL 3MLVL 3EUUA 5FOJA 2ICWA 1UB5A 1VEMA 2E9JA 4KI1A 2UV3A 4EXPX 5IHZB 5TDNA 3VFOA 1ZSDB 4X99B 5L7XH 4MCYA 1GC1C 1P4IH 4DOHE 2D4DA 4PJ8C 4QGYA 1G7QB 4W70A 2J8UB 1KCSL 1ZEAL 4NWUH 3DGGA 2YN5A 1FC2D 2G5BB 3FONA 3R1GH 25C8H 4JPKL 3IFPA 2ZCKH 2NY6C 2J8UF 4IJ3B 3ULSA 3Q3GB 4GRLA 1JIBA 1EMTH 2EKJA 3BI9X 4DN4H 3GI9H 3JUYA 4PREB 1BQLH 5DD0H 1RI8A 3QI9B 1NKRA 1BEYH 4PRAA 1DQDL 4FTVB 4ZS6D 5T3ZL 2YD7A 3C8KA 2R69L 3TWCL 1RFDH 3S96B 1CICD 3JSSA 4L8DA 5C0AB 2Q86B 3BPOB 3QUZD 1GGCL 5CZXC 2JIXA 5J6HA 4C56E 4F33A 2FB4L 2H2SD 4ZSOA 1A6TA 4PRPB 3HC0B 1JPST 1EHAA 3STZB 1AH1A 1UCBH 1A7RH 4X99A 1T3FB 1KG0B 4P2YA 3PHOB 4AG4H 1IL1A 1MRCH 2XACC 1KIQB 3MRFB 3JV6B 3RL1B 2Z4QB 1TJIH 4NN5B 5HYIA 1V7NL 4LIQE 5DUBA 3WFHA 1ZT4B 1BJ8A 1X4ZA 5HYFA 1P4LB 4YDLC 2DQCL 4HIEA 5JHDD 1KIRB 2FO4A 4U05A 4YEEA 2VL5A 5FM4A 2DQEL 5FYKL 1F13A 3RTQA 1TITA 4B5EA 1WGOA 1UM4L 1MJ8L 1RIVL 4M6AA 2ZUQB 1ED3B 4OI8A 5IVOA 3D3VA 3MV11 4G8GB 2D7NA 4LLVB 35C8H 3EYVB 3MUY1 4MQ7A 1HCFX 3IDMB 4H8WL 4OQ1A 1GC1H 1QA9B 5HHNA 4LP5A 2IBBA 4OB5H 1KLFA 1CT8A 4RISL 4PJFA 3GSWA 4DGYL 1VSCA 4G9FB 3KYNA 4D0BB 1BD2E 3QPXH 2OL3H 5ANME 1MJ7H 4U1NB 4HIEB 2F5BH 1Z0NA 4JGMA 5JA8B 2IAMA 1QR1B 3LKQA 4QXGH 4MAYA 3S35L 5CGYD 1CGTA 4I2XA 2V17L 4HWEH 3TCXA 2X1QA 1EEZB 1UKSA 4ODWB 1RUQL 4F15B 3EBAA 1ITCA 4PRNB 3T2QA 1BZ9B 1UH3A 3HZYA 3MLWL 3BGFB 4PY7A 4FQ2H 1ZHBA 3BPOC 4JRYB 3WIFA 5I71B 5DHYA 5I1AA 1DL7H 3PGCA 4RAVB 3N85H 3C09C 3QIUD 4TUKH 4XP4H 5HHMD 1EVUA 3QO1A 1EBAA 1PEWA 4HJJH 4H20L 5B8CC 1ETZA 3KWWB 3PV6A 2Q87A 1PX3A 3GI9L 4NO3A 3LKSA 1ZGLA 4DZ8A 2Z31A 3VFNA 1FFOA 4QRUB 1JN6A 4BQBA 4WFFD 1XH3A 1BZ9A 2CRYA 5LG1A 4GSDL 4OF6A 4WFHD 1T2QH 4FQ2L 1JMZA 3T2NH 4N0UE 1A7QL 2IQ9L 1XF2B 2APXA 3FRPA 1HIMH 2VAJA 4OGAC 4Y4HB 5EUOA 1DANU 1RHFA 4ZTOL 3MX0A 5MI0C 4P23C 4HH8A 3KPRB 1KB9J 2A6IB 4K07A 2G2RB 4N90E 3GMLA 1H5BA 2VDML 4JZJB 3MBEA 1NCBH 1Y18B 12E8H 4WWID 1TETH 5BJTA 5DJ6A 4KJPC 3UPAA 2C5DC 2R4RL 3D3VE 5EBWA 4R0LA 1WSST 3C5JB 5A16B 4CMMB 3K8MA 4HF5H 3DV4B 4GG8B 4N1CA 1QUNA 2NY0B 3ZYOA 4KKAC 4UDUB 3D2UD 4BELD 4WI9A 3IS1X 2PF6A 3DIFB 3JTTB 1RK1B 4A6YL 1DLHB 3TN0C 3DETC 5CP3A 3IJYB 3NZ8B 5DEZA 1MEXH 3W11D 3K2UL 2F19L 4GXVH 5IK3B 1WFTA 1UWXH 2DM7A 3ZLQC 4HQQL 1SJVA 3QDJE 2VLJA 4XBGA 5GSVA 5GRXG 2VLKD 5GGSA 5DJXA 3DRQA 5F88B 3VGFA 4P2RB 3E8UH 1F00I 3MRJB 1ORQA 1IGML 2DKMA 5D7KD 2BVTA 2XWJA 1J1XH 2YKLL 3JTTA 1SEQH 3P4MB 4OZ4B 3D39E 5DFVC 1UFUA 5F97E 4OGXH 1ZLSL 4PGBA 5J1AB 3NCYP 1MVFA 4WHDA 1RUAH 2L7JA 4IMLB 4LAQH 1VEPA 2NZ9C 3CC5A 3VDAA 4YDJB 4F15C 4YXHH 1M7IA 1PKQB 2SEBB 3NTCH 5C6TL 5GXBB 5E9DE 2WIMA 4QT5A 5D1QB 4G6KH 4JFDA 1KTRL 4N0CC 5F1KC 5C0BA 4MNQA 3P3YA 4LLQA 1INEH 4LCUA 2VQTA 1PEZA 5D7JD 5GGUA 4ZFGL 3HRZA 4K3DL 3UZVB 3ZDZF 1G0YR 4LVHB 1T7VA 3BZFA 1U8JB 1K6QH 1ZLSH 1YEFL 3VWJC 1KN4L 3U36A 3MMEB 2P8LA 5T3ZE 3OKLA 2NXYB 3WS6A 1ORSA 3DECA 3SGDH 4EUPA 1KPUA 2OMNA 1N5YH 1DE4B 5AZ2H 5EO1B 3SJVB 3RPIB 5KJRL 4UT9H 5FYKD 2BHZA 3MR9A 5TGBB 4DKFL 3QCVH 4OFYD 5ITBL 1RHHB 3MODH 3QIBD 2X6MA 2AJZB 3LN9A 1SYVA 5DTFA 5ADOL 5IV2A 5BVJA 4W4NA 3TO4C 1HQRB 2OLDA 4JREB 2EKSA 2P24B 1DTUA 2YUVA 3K81A 5CD5D 5IQ7L 5C1MB 4FQHA 1C5DA 4S1DC 4X8JB 3RWJA 5KVGL 3WJJC 3SE3A 1J88A 4OGAD 4HGWA 3B2UC 3C5ZB 3K1DA 5E9DA 3NAAL 3ARZA 4ZFOL 3INUH 1HWGB 3D85A 4FQ1H 3S88L 1KLUB 1QSZA 2UZIL 1FVDB 4UV4H 1CVRA 1SY6L 4WIQA 3SDXE 4JN1H 1VFAA 1QD0A 1ORSB 3HMXL 5B8CB 1F90L 2BNRA 3SJVA 4CVXA 3HB3D 2QR0A 2OZ4L 4OF3A 3TBWB 4M6ML 4PS4L 2CH8A 4BSWB 1Q72H 5F9WB 2VDQL 3E8UL 1PJ9A 2OYPA 3SHSA 1OQXA 3UDWA 4DGYH 1ACYH 3ZT7A 3VFOB 5JOFA 4KJPD 1QQDB 5I1GH 5IEHB 2YA0A 3VJ6B 4HH9A 3G5VA 1T4KB 3BN9D 3CZFB 2C4XA 3L3DA 1QLRB 4PJDF 1GXEA 4JAMB 1ERNA 1WWWX 2X1WL 3LOWA 1G6RL 1CLZH 3I3EA 4LMQI 4IIQB 4I5BB 3QRFM 2HMIC 5L2KA 3K3QA 5H8DA 5D7SH 3VWKC 2VQ1B 2LU3A 4MA1B 3QXWA 1EBPA 3HTLX 3RRQA 3VGBA 1AQKH 1F5WA 4HH9B 3TPKA 3KPRE 2ZJSL 4PJHA 4U7KA 3VXUE 5D7LA 1YMMD 1FO0A 3ALWA 1QFWL 4WDIB 4H25B 1G6RH 5E8PA 5FGBA 3TVMD 4G42A 3SDCD 4S2SB 1OPGH 3WHE0 4E9LA 2IAMB 3EO1B 1OB1A 4JM2C 1QR1A 1DUYB 1UXWA 1IKNA 4YHIA 1T2XA 4F7MA 3NPSC 4XMLH 3TZVB 4O51A 3ZYIA 1CFVL 4XWOD 4K23L 3GK8L 2EC9T 4M5YL 4LCCA 1NMCC 2FGWL 1BAFL 4GAFB 2HLFC 4DVBB 1E6OL 3MXVH 3CH8A 3GJEB 1OARH 1EX0A 4XP1H 4QGTA 4M7ZC 2X4OB 5BVPL 2IBGA 1NGQL 1T83C 2UY6A 1KCRL 1EVTC 1T21B 4KDVA 4U4BA 1UEMA 3SJVE 2ZUXA 2GSIB 1ZVSA 5FUCC 1BGXH 1X9QA 5L6YL 1DUYA 5D7IA 2BHUA 2HH0H 4UOW0 4LEOB 4ZAKD 5B38G 5D6CB 3LN4A 4JRXB 2VC2H 4WDIA 2NR6D 4FQJH 1IT9L 2D7QA 3PL6C 1HXMB 4NNYA 5A2FA 1MCNA 5E5MB 1UEYA 4X4XB 3WDJA 4E0RB 5E94A 3WSQL 4PGJA 2H6PB 4I9WD 4OI7A 3OAUL 4L29A 5BOZG 1XMWA 4EN3C 4J2XA 4KFZC 4NQDE 4WNQA 2XIDA 2ZUTA 3MLUL 4JB9H 3EHBD 4XCNA 3FJTA 1VFMA 4JJ5A 4FG6C 2DI7A 5KBNC 5DQ9A 5BQ7A 1HSBA 1FIGL 5DRXB 3LS5L 1C16B 5C71A 2X2YA 5IG7A 4NKMB 3P77B 4JHAL 4NRXB 5LBSL 2A9ML 3PHSA 1DVFB 5HVHB 5ADPH 3ZKNC 2W07A 3BJLA 1J8HD 5EBWB 3ARBA 4KXZI 5LXGH 1RZKH 1HYSC 3GSXA 2W9DH 5INCA 1EFXA 3PL6A 4HJGA 3MLSH 4LKCB 1FZMB 3VMPA 2X4UB 1BLNA 1C08A 4GS7B 5ACLA 1AJ7H 4JQXC 2I27N 1RZGB 3ISWA 4UQ2A 3ZT6A 1P4IL 3UTPE 3QXAB 5CLTA 3G6JE 3ZE1E 1TZIA 1LHZA 1ADQL 1U58B 1KFAL 1LEKB 1WISA 2VE6A 5HYSB 3EDKA 3SCMB 4JHWH 4AG4L 3UTSA 4XCEA 4RRPA 1T5XA 3P77A 3FCTA 1A1NA 5D1XA 3PUCA 4PJ7E 3X3GL 4JFYA 1BQSA 4YHYC 2XA8L 5DJ8A 2R69H 3H9ZA 1AGBA 3F12B 4FHBD 4OUUA 3GBML 1ZA6B 3BEVA 2OI9B 4KKLD 4OZIE 4O2EA 4RA3A 1KCSH 4NN6B 1QO3A 4KUCF 1S7QB 4FQIL 2XXCB 3I50L 2F15A 1CD1B 4FQQA 2D0GA 4OM1L 5KSAD 3IU4H 1B4RA 2EH8L 5JQ6H 1A6AB 1JL8A 1U58A 3QUML 1BGXL 4LHJB 3T0EC 5B4MD 1IAIL 3BWUC 3BDBA 2CPCA 1KUMA 3JWDL 5D2LF 1CL7I 1BX2A 2EE6A 5E4EB 5GRYA 3WKMH 4TTGA 3O6FC 3TA3A 4LVEA 1T7YA 1HKLL 4N8CH 4X5LA 2EIZA 2V9QA 2W0FB 5HD8D 4D0CA 1TJGL 3FB5A 3D85D 1S7UB 1YECH 2RJMA 1CE1H 3MUGA 1NC4A 5DVMA 3MJ9H 3X12B 3VFWB 1PQZB 1FO0L 2J88H 5GJTL 2HYMA 1I9EA 3NGBB 5CINL 2A9NH 1R6VA 2JJSA 3MO1A 1AXSA 1U8HA 2DLIA 4M3JA 2F54D 3L1OL 4I18C 4W6XB 3S34H 3CPLB 2FCBA 2AK1L 4I3RH 4F57H 4ZTPH 2Z93A 5TQ2L 4MCYB 1NEZB 1A6UL 2W0FA 3TO2B 5CILL 4JFOB 5E5UB 5E1AA 4WU7A 1NBVH 2ARJB 4EI5A 2XPGA 1QHOA 2BOCB 1VADB 5HHOD 4ETQA 2BNQD 1JNHA 4FZ8H 1RZFL 2R2HA 4J1UB 1Q9KA 2HG5B 3VMOA 3CD4A 3GSNA 4P46D 4J7RA 2ZP0T 3O11A 4GQ9L 3MYJB 1NAKL 2XKUA 3HNTL 4ONHA 3HRPA 4AK1A 2A6DA 3CJJA 1KXVC 4M00A 1LP9F 1P5UA 2ESVE 2VIRA 2XN9D 5DJDB 3ARFA 3S96A 1FYHB 5DUPL 2B4CL 4Q74A 2ZUQC 4OFKA 4K3JH 5IVXA 1SYVB 5H2BA 1TQBB 4HWZA 3LIZL 2AV7A 4DK3A 4XH2B 3QQ3B 3FB6A 2VLRD 5C07E 4JQIH 4JQIL 4WI8A 4DW2L 3VXMA 1N64L 1FFQA 4YH6A 5DC4B 1FL3B 4JDVB 3VXNB 4WEUD 3O3AA 3UJJH 2AQ3A 4KTDH 4WU5A 4PJXE 1N6VA 2FO4B 5BO1H 2J12B 3BKCL 3GO1L 2OM5A 3JTSA 4HIJA 4BUGA 1TZHA 5DYOB 1P9MA 1MCDA 1YNTB 3OKKA 4NZTH 4LSSH 5K59F 2F8XC 3IRPX 5IMLB 1OT2A 3RUGE 3FB6B 2YPKB 1U92B 1ZANL 4R4FL 2G75A 5FDWA 5IIEA 5IVXB 5H2BB 3VXSE 4HCRA 1L7TH 3CUPB 2W0KA 2WINA 4OCWH 5K9JL 1S9XA 2R56L 5ICXA 1I7RB 5C08D 1LQSR 3PWPB 2WZPD 1T20B 3IGAA 1I8MB 4K8RC 3SBWA 5C07A 2DKSA 2FGZA 3HCVA 1VA9A 3SKJH 1CFSA 5SX4H 1OP9A 1I7UA 5CIPB 1JRHL 1RVFL 1T5WA 3DSFL 3VA6A 2YPKA 1ZMYA 4HG4J 5I1LA 3VXPA 5KVFL 3MRDA 5JPNB 4JFQB 1RJYA 3F58H 1YC8A 1PKOA 3OWEA 1KJVB 4YBHA 3TV3L 3WIIL 2JJTA 3LS5H 2R15A 1JTPA 1A1OB 4ZPTA 3T77B 4R4BA 4K3DH 1YEJH 5JPMA 3VXMD 4LLWA 1KGCE 3ARYA 3DV6A 4L8BA 2GK2A 5GS0L 1NLBH 1KNOA 4IMKA 5I75B 1B90A 1YEHL 4HT1H 5JO5A 2VISB 5HHPA 4Q9RH 1EGJA 3IU3A 4HIXL 4JR9L 2X70B 3JV5A 4L8SA 4PGZA 3GSRA 4NQDB 3UTTB 1YQVH 3I02B 4H88H 4NQTA 2YRLA 1Q94A 1A1OA 4ZPTB 2AABH 4MD4A 4G8GA 4Z7QF 3Q6FA 3ZL4L 1FPTH 4JFQA 2KUTA 5FCUL 2GJ6B 5IBTH 1I3GH 3C09B 5HSFA 1GSMA 3WE6A 3ARFC 4U1IA 1BP3B 2IH1A 5CJQL 2FL5A 3S36L 4K7FB 1Q0YH 1FZKB 3ZZ1A 5D2NA 5JW3L 3HLAA 2XN9A 3HG1D 2EZ0D 15C8L 3NFPA 1IC7H 5INCB 2UZYB 3PE9A 2FB4H 1K9TA 1D6VH 4Y19B 3QIUC 4LQ1A 4KQ3L 1QFHA 5KZCB 1MWAL 4XTRC 1XIWA 3I02A 3QXTA 1UWEL 4QYOA 3GI8H 2BJML 5GGVH 1WAAE 4LSVL 4JY4A 1WCBA 3C60D 4APQD 4XCNB 4UIKL 4WHCA 3SCMA 3QG6A 4M7KH 2P42B 3ZKMD 4W6WB 4GRMA 2XN9B 3NABH 4WI2A 3SKNA 1P84J 2Y36L 4Y5YA 3NCCB 3P4LA 2GAZA 2PO6D 4MD5A 1A6WH 2I9LB 2ZCHH 2DWDA 2OMBA 4NZUH 1I9RL 5F72S 4PJCB 4Y4KB 1UZ6E 4QRQA 2LU4A 4I77L 5SWSD 3VFSA 2Y23A 1N0XH 1QZ1A 1JPGA 2DQTH 2PYEA 5B21A 2R9HC 3SGEI 4ERSL 3EIFA 1F58L 5ITFB 3BXNA 3W0WA 4HXBH 3GZKA 5F3BA 4WJ5B 1OAXL 1A64A 2CKBL 3MROB 4JY6B 1YEJL 2DTMH 4NN5C 3R8BB 4GW5B 2VH5H 43CAB 1FVEB 4KGLA 3DUHA 4XVJH 3TJEH 3LZFL 3VGGA 4QO1A 4YFEA 3DMMB 2HJLB 3CK0L 3MUZ1 4LAQL 3CVHH 4KTEH 3FN9A 4YDIH 3G6JF 5I19L 2OZ4H 5DHVB 3WYRA 2BVOA 3R06B 4GRLD 1MF2H 1MF2L 4Z7VE 2FATH 1YY9D 4FP8L 4JKPL 1T2JA 3FCTB 4MVBD 4NP4L 4ELMB 1AC6A 3ARVA 5E6IA 4X9HA 3BOVA 1SM3L 2APFA 3BXNB 4OLYH 3FAWA 1Z3GL 4JRWA 2GHWB 4UAOB 4X8XA 4HUUA 3RPIA 2A0LD 4AL8L 5BOPA 4FABH 2EC8A 1LEIA 1BAFH 3WFCL 4NT6B 5ICZB 4K3EL 2X9XA 4Q0XH 4Z76B 1AR2A 4MMZC 1U91A 5GZNC 4PJBE 2PW1A 4LARH 5DD3L 4AQOA 1EAPA 3DVNA 1VCAA 3DMMA 4MB5A 1VERA 4WTWA 4NQXB 3RZCC 2PYED 3FO1B 3HAEB 4KJQD 5F7KC 3L3JB 2EIZB 3FOMA 3RVVD 3T1FB 3LQAL 3BKJL 4KMTL 1MUJA 3BIBX 3MRQB 3SO3C 5IP4A 3CFEA 3KPSE 4Y1AA 5C0JA 1NAMA 5E6IC 4DK6A 4QKXB 5E08L 5L2JB 5ABDE 2PR4H 2H26B 2HJFA 3KR3H 4HX1B 1HK6A 2CK0L 3T65B 2F5AH 4U1GC 3HC4H 5GS3A 4R8WH 3T3PE 3DO7A 2R0LH 3BO8B 4UINL 3ULVE 4OLEA 3VXRD 3L6FA 1FLTX 2FGWH 5ACMA 4LCIH 4F3FA 3DPBA 1T03L 4A2MA 3ZKXC 4APQC 1TFHA 5C0EA 1EHNA 2GSGB 4G5ZL 2GW5A 4Z7OE 3G6DH 4NFBA 1JGLL 1X7QA 2JB6B 5E4IA 3RIAF 4PJGE 5F6IB 1KB5B 4N5ED 1S78C 4EUPG 5FHBH 5IFHL 1F02I 5EPMA 1ZLUH 3QI9D 3MFFB 4KHTL 3QXDB 2WAHA 4XI5C 4EI5C 4Q6IC 4PG9B 4LHQB 4PJ9C 5TH2B 1F4XL 1G7MA 4NM8H 4WCYH 1KELL 2YA1A 4MJIE 3FQNA 4O58L 2EDKA 5DRNA 1R3JA 1D7FA 2G75B 2W1NA 3HUJF 5DSCB 2AXGA 2L4OA 4JKPH 1P2CA 4GBXA 2PTTA 4N5EC 4XBEL 3WBDA 3PP4H 4JDTL 3RWDB 4XP5L 3PJSA 4OCLC 4RBPH 5FO8B 4S2SA 3KXFB 4OV5A 3V4VL 4X9GA 1FGNL 1VFAB 5DQJB 1JYVA 2Y7QA 2VXQL 3O3EA 2CLRA 3VXNA 1GYAA 1V3MA 3BP6B 1FH5H 5LKNA 2MKWA 3QUXB 3OPZL 1JWSB 3L5WA 4OI9A 2R2BB 1G9NC 3VI4E 4NNXB 5HI3D 3L3HB 2VLME 3BPLC 4FQCH 4LKXA 1NAMH 1ZGLP 3PIQA 3V52H 3D3VB 4U1HA 3BP4B 3QFJE 5DHXB 1G7IB 1M7DA 2QKIB 4I0KA 2DQEH 4M7LL 3L9RB 5E8DH 3MOAL 4X7EC 5EU4B 3CUPA 3VWKA 1HH9B 5BVPH 2Q6WA 2NY4C 1TIUA 2FH6A 1HXYB 3A6CH 2AJXH 2BY3A 5T1MA 3O45A 4ODUA 5JR1L 1I85C 4MGXA 4MAUL 3C08H 4EBQH 3FZUC 3BVNB 4MSWA 1S9KC 3OX8B 3ARDB 4BFIB 1EGJL 1I1AC 2AV1A 4CDHA 4KUZL 4OUOA 3QIWD 1BFSA 4HIIB 4LNRA 2ZNWA 4KI5E 1ZAGA 2AQ2A 5JXEA 2EDBA 1GJIA 3IAQA 5EOCL 2F58L 3QB7C 3VRJB 3KLHC 1BPVA 1KEMH 5DMIL 4EXKA 4OAWA 2FD6H 1CT8B 1IAKA 2ADFL 5J0BA 1QNZL 4HS8H 4X83A 4UILH 3O2DL 3VWJB 2CIKB 4PLJC 3O6KH 5BXFB 1AXTH 1UXSB 1KIRA 2LTQB 1YPZB 4AEIH 1I1FA 3LB6D 2VL5B 3RL2A 3IAPA 4UQ2B 3ARBC 3HZVA 1MCLA 3W0WD 4F7MB 3H9SD 5I8KH 2J8HA 4APQA 1T0NB 3O4LE 4XVTL 2QLVB 4GAYB 3REVB 3OX8A 3VDBA 1RMFH 3P9LB 3EJZD 4L9LB 4X6CB 3WLWC 1MFEL 3HPLA 5IESH 1CDYA 1SYSB 4M8VA 4P49A 4E41A 1VGEL 3NFSH 4S1DD 4XP6H 4YGAB 1S9YA 2R8SH 4XCCL 1FZJA 3KYOA 3L3KB 5JMRA 1Q9OA 2IH1B 4GAJL 5GGRB 1U8NA 1DL7L 4BZYA 1VGKA 4X98A 4KMQA 5DJ8B 4DN3L 4NDMB 1OOAA 2AI0L 2ED8A 1U3HD 3D2UB 3V4PL 1YDPB 1IAIM 3BHBA 3SY0A 5D8JH 5D8JL 4JDZA 1PKQE 1I3RA 4MZ2A 1XIWD 2CUMA 2YC1A 4OGYL 4OGYH 5CJBA 1BREA 3RZCA 5E94B 3X17A 5T1LB 4YXKL 5KSBF 2NX5E 3QUKA 4TNVF 4GAYA 1HSAA 5E99H 1BFVL 2R0KL 3ZE0F 3LKRB 3I9GL 4HFUL 5GRVL 2OQJB 4NUGL 4U1MA 1BX2B 3SE4C 4JVPA 4HK0A 3H3PH 5CBAA 3X3FL 1DDHA 3SO3B 5EZJA 2VWEC 4LCCC 4YNYA 4BZ1L 1OTUD 5JXED 1YN7A 3H9SA 1UWGH 4QRUA 1OAUH 5JW4N 1QFWH 4BK5A 4TTDC 3UTZB 3QZWB 2VRAA 1P4BH 1EO5A 4KKCD 4UT9L 3QULA 5GS0D 4QRRD 4QHNA 1LEIB 3LKNA 3SQOL 4OFIA 3SY0B 5EBMA 5HXMA 3GRWL 4M1GL 2R1XA 3RY4A 1IQDA 3SKMB 1BQHB 3UPRA 3N9GH 1Y6NR 5DJZB 2JE8A 3QEQD 2HA1A 4LBEB 1MI5A 5IEKB 2EZ0C 1TJIL 5I9QB 2HJLA 1HHHB 1CBVL 3S34L 4FQXC 3ULUD 3I6LD 4P2RD 1E6JH 4G7YH 1JGDA 1ZANH 3IDXL 1AKJB 2V7HB 3D0VB 2RR3A 4PJAA 2ZUUA 1X5GA 1F8TH 3GGWB 4J23A 2NXYD 2A83B 2AXJA 3VFMA 4K7PX 2P8LB 2Y5TB 4N0FB 3TBSB 4LRNH 2JCCA 2A6JB 1IAMA 1HHKA 7FABH 2IGFL 1C1EH 1DLHA 3VFVB 2OR9H 3REWA 3MJ6A 4N0UB 2FX9L 5JNYA 3AFLA 4ENEC 1IFHH 3P73A 4CAGA 2P8MB 1KPVB 2FX8H 4PJAB 3T04D 1WEJL 5SX5K 2W9EL 3OG6B 3ILPA 1P7HL 2FJFB 1FDLL 1Q9LA 1DEDA 3D0LB 4HWEL 2B1AH 2XWJB 3K7UA 3BSZH 3NA4A 3OKNA 2ESVB 1UT9A 3BJ91 1VFUA 4TSAH 4RQQA 1I9IH 1PLGL 4LIQH 5EORL 3D25A 1DN2A 3BPCA 4MJ5A 2XV6B 4P3WA 5B8CA 4QNPF 3AS0A 2CR3A 1W2KT 3GJFK 3S8WA 1G9MH 5H35B 3A67L 3WLBA 3KJ6H 3P2TA 2DQUH 4F7EA 5J6HB 1RUPL 3L95B 5T3XL 3VFGL 4DVRH 1KFAH 3FQTB 4PRPA 4U1KB 3OV6A 3FHQA 1R3KB 3MJ7B 2IEPA 3T0EB 1IZKA 1YEIL 1A6VH 3EYUH 1C5DB 1NEZA 4JG0L 1BD2B 4JG0H 3EYSH 4MA1C 5GGTH 1HWHB 5L88L 1A7QH 2IQ9H 3FQWB 2VDRL 1V7NH 5K9JH 3QJHA 1LE9B 3QWOA 2DI9A 5JW5B 5FCSH 1QTYT 3KJ6L 3GK8H 3SDCC 2DN7A 1INEL 4CMHC 1MAML 5GRUL 1SY6A 1LNUB 2CXKA 1XGPB 1VDGA 4ODXB 1JZ4A 5DGQA 1V3KA 4XZUB 3SDAB 4LSSL 4CNIA 5TDNB 4XNZB 3F7QA 4YE4H 1MWAH 3MJ7A 1NFDF 3QFDB 5IVXF 4QCIB 5TQ0H 5HHOA 1KBGL 4Z7NF 3CFCL 5IVZB 4WUUB 2CRZA 2ICWB 4YHOL 4EEEA 2ARJQ 1A0QL 2EDTA 2YS4A 2H2PC 4LU5L 2Q6WB 5ID1B 3RTQD 5H94A 1HXYA 1EAJA 5J9PA 4DUVA 4PRPE 4PY8I 1NQBA 5JHDA 3OTTA 3DURA 5EZIL 4L5FL 1TNNA 2J7LA 4HC1H 1B0RB 4A2LA 1ZHNA 4J8RA 1JZ5A 1JPFB 4O51B 5HGAB 3P11H 4GRWF 4L4TB 3STBA 1NFDE 3LQZB 2YD6A 4RNRA 4F7CB 2IPUK 3WMSA 3BMWA 5IF0A 1F3RB 3SDXA 5LWYL 2WINB 3P0GB 3FO9A 3DMMD 3UTTD 5FGCE 1T83A 2XQYK 1GZQB 4U1IB 1BVLA 3HR5B 3GRWA 4TULL 3OSKA 4X7TB 5E8OA 5HD8C 3UC0L 2NXYC 2QJDA 3WFCH 5IUSA 4AT6B 1AY1H 1UM4H 4DJMA 2R4SH 5BMFH 3MOQA 1T3FA 1AR1D 4BH8A 5GRJH 4GRWE 4TYUA 2YPVH 3O3BB 2AKRA 4XNQA 1UA6L 2GUOA 2FIKB 4GRWH 4FMFA 3DETD 2PXYA 1Z3GH 3ALXA 4GW1A 4YHNA 2MCG1 3S3SA 5B38A 4MQ7B 1NMAL 3BKML 2XYCA 4WFED 4MNHA 3QHZL 1QYGL 2X42A 2APBA 3CU7A 5DT1L 1ED3A 4HC1A 4LGSB 1Y0LA 4NQED 4C54A 1JGUH 2QV2A 3BGAA 3INUL 2EYTB 3EYVA 1QSFD 2PTUA 2WIIB 1VGKB 1R5VA 3VFSB 5DS8A 5C08B 2VDNH 2GUOB 4QHKJ 3MRIB 3LKPA 4HD9A 2ATPB 4K23H 1I9RH 3B3IA 2ZCKL 2GIYA 3HZYB 4GH7B 3FFCA 4P2QA 4WFGD 1ZT7B 3WE6B 4E41B 1CR9L 3TNNA 3Q6FB 3PGCB 4RAVA 4XNMB 2CDEA 2XNAB 4S0TD 2RCSH 4NQSA 2H9GB 3LH2H 1HEZA 2VWEE 3QO0B 2ZSWB 1EUTA 3ZTJG 5EZIH 1F90H 1RJLA 4CRPA 2MOVA 4ORGA 2ZOKA 5I8OL 4M5YH 3UTOA 5D2NB 5E2TH 1MIEH 5DUML 5F9DC 4KQ4H 2YPLD 2GJZB 3A6OA 4ERSH 5MI0B 3SQBA 2OL3L 3IF1B 1MWAB 3F62A 1FVCA 2A6IA 2WV3A 3MV7D 3UZQA 3P9MA 3MC0A 4PTUA 1XF2A 5MEND 4JZJC 3OQ3B 1MELA 2HTLD 2AK4D 4EI6B 1FDLH 3RJDA 1SEBB 4WCYL 1VESA 1AKJA 2E6PA 2V7HA 3G5YA 5E8EB 1L6ZA 3G5XB 4N8VB 4HPYH 3NZHH 1I9JL 1JF6A 4GKSA 2QSVA 4LSTH 3EJZC 1T0MA 1W72H 3WS6C 1FJ1B 2EDLA 1MHEA 3VFTB 4TNWF 1OCWH 3I2CH 1AXIB 2PN5A 3IAGC 2GT9A 1QO3B 1N5AA 1RIUH 1IEAA 1TJHH 2NY1B 1UCBL 1MSPA 3E6HB 1JI2A 1FH5L 3TBVB 3U9PH 4R2GD 1SEBA 2VABB 2OBGA 43CAA 2YBRB 2VAAA 5JR1H 2CR6A 1MFDL 1W8NA 3FFDA 1LP9A 1I1CA 2YEZA 4YHPA 2AERT 2A77L 1HNGA 4ISVB 3JV4A 4K94C 1QSEA 2JB5L 1EFQA 3LHPH 5I74C 4MQXD 1PSKH 2A83A 1FNGA 3MODL 3V79C 4QXUL 3HNSL 3VFWA 3MV9E 4YDJA 2VABA 5F1SA 1DP0A 4UT7H 4XPFL 3NIGF 2NYYD 3K46A 3QP3A 2C26A 4LVHC 4OZFH 3E6HA 4RDQG 4ONGL 4NKDA 2DQGL 3KNBA 5IB3B 3FT2A 3OKMA 1AE6L 4MQTB 1HKLH 4N8CL 4P3DB 3V7AE 4WTZA 5SX5H 2JF1A 3RA7L 4KU1A 3MXVL 5DK0A 5EU7C 3RKDD 1BD2A 1WZ1H 4UB0L 1UYWH 4GS7C 1F6LL 3EOYG 3JV4B 4LSRH 2EDEA 3C2SA 5DC0A 5EC1A 3PP4L 3WKNA 4UT7L 3L3GA 3BP6A 1IRAY 4XTRD 3MA9L 4JN2A 2X44D 4TUOB 2XI9A 1SVZA 3VFRB 2BNRD 3BWAA 3D25B 1Y6KR 2OXGA 1KPUB 4ONOA 5DJDA 4LLYA 3S37H 3T65A 3QI9C 4QNPE 1AO7A 5C8JB 3MQIA 3U6RA 4YHLH 4ZXBB 1MH5B 1XZ0B 4CU7A 2WMPA 1HQRA 1LDPL 3L5JA 5ICXB 5CUSH 3UBXB 2O61A 1VGEH 1GL4B 2VERN 3BIKB 1XIWC 3IDYB 4F7TB 3A6BL 3OKEA 3PG2A 3EYOB 5JHDB 3HI5H 2KL6A 4BUHA 3IETB 2Z31C 2I07B 4P46A 3HG1B 4Q6YA 5GGTA 2BNQA 3JTSB 3L7EB 1J11A 4X6FA 5DJCB 2PTTB 4MXQC 5TH2A 3MRKB 4OZHA 4G6JH 1BVLB 1TTFA 5MHSE 3PDDA 5I1DB 1CIDA 4ZD3L 4KJYA 4NZJA 5LCVL 3FT4B 5F70A 5AYQA 1WIPA 5HI5D 3KS0J 4Z0BL 5JDSB 3X13A 5FA4A 5C9KA 4MQSB 3SGDI 3HE6B 3WUWG 4I18B 4Z7NE 1Z9OA 1NDGB 2DLFL 3NPSB 2V9TA 2ORBL 3PDOB 4NWTL 2OTUA 4PLKC 5L2KB 4MS8C 3RVXD 3AY4C 4EBQL 4H0IA 5C6WH 1VACA 2MMXA 5D5MF 3SPVA 1N59A 1NLDL 5CJXC 1JRHI 5I1IH 5IMLA 1EEZA 1LVEA 4JE4B 1JWSA 1U2CA 3UPCA 2A73A 3PGFH 1U8LB 5DRWA 4OKVB 1BM3L 2W60B 4JRYD 5I1DA 4JZNB 1S9YB 3GMQB 2ZOLB 4KKCC 5J8OA 3V0AC 2BNQE 5I16A 3IU4L 4BFEA 4J3UA 4QOKA 1QEWB 5MHSD 4JO3H 2PUQT 3QUMH 4GXUN 4OCYL 4KV5F 2VXSH 4NM4H 5DS8B 1IAIH 4JGUA 9CGTA 5JZ7D 5J3HC 3AAZB 1TXKA 3H9YA 1A5FH 3C6SA 1CDUA 1NBZB 2YC1B 2DLEA 1QSED 4P57B 1GGYA 4JFXB 1UXWB 3DX6A 3QBTB 2AI0H 4HIIA 3U1SL 3BX7C 3QR2A 4V1DE 1IGIL 3FOLB 2EDHA 5LJYH 4N0YH 1YA5A 3ARTA 2AJSL 1JGEA 3TIDB 1NC2B 1A9BA 5F9WC 1XAUA 2EEDA 1FP5A 3QDMB 4UUJA 2VSDA 4XBEH 1BQLL 5DD0L 3BGMA 3QEQA 4QY8A 3VGAC 5SWZE 5B4MC 4U6VH 4YAQB 3HN3A 5C08A 5GGSY 3UTZA 3NABL 3KAAA 3I2CL 1H0DB 1MCJA 3BDYH 4QOKE 5KW9H 4JRXA 1FFOB 3TH3T 2R29L 3VD3A 3UBXG 1CDHA 4PJFF 3DVIA 3OKDB 1CD9B 1KV3A 4C83B 1H3WM 5GGQL 4WV1A 4YXLH 4XMKL 3VRLE 3CDGA 2C3XA 4V1DA 4U0RB 1XR8B 1UZ8A 3QPQC 4Z7WF 1UB6B 3MCLL 3IKCB 3KJ4B 2XRAH 4GBXD 3ROOB 5CCKH 5CGMA 4DTGH 4WUKH 1U8MB 5AG8A 5EB9A 3CMOH 4HWUA 3VD7A 4OIIH 5CP3H 2AK4A 3QWRA 2BFVL 2R2EA 4NT6A 4OZFB 4ACPA 5T1DL 4OLYL 4Y5VB 2MQ0A 2Y06H 4M9PA 4DKFH 2NW2A 3AGVA 2DMBA 3C6LC 3R4DA 5GS1C 4BSJA 1NGYB 3P0VH 4J6RL 1ZEAH 4LLUB 4EVNB 2GYSA 3HZMB 3I50H 2X41A 4M7ZB 4Q6IB 1PAMA 4LPYA 1CWVA 4UV7H 1I3VA 4WHTB 2Z0BA 4X6CF 4LSUL 4RQQB 3OZ9L 1EK3A 5HVGB 4YDVB 3T1FA 4LRIA 4S11A 2HG5A 4WHYH 4GW4B 4PJGB 4ZFGH 4L1HA 3MYJA 1FJ1A 4DKEH 1MREL 1DE4A 2XTJE 4PJEE 4WO4A 5E95B 1FFNB 5I15H 4JO1L 1IGFL 1IKFL 1QP1A 3EOBA 1FYTE 4JLRB 4KK9D 4HDIB 4NBXB 1T0PB 3HI1A 1KXQE 3NCFB 1U95A 4PRDA 1RVFH 3C9NB 3DO7B 3IDJB 4HJ0C 2WWMD 2BVQA 2PR4L 3OKMB 1FNEB 3FT2B 4KC3B 2P5WB 5L8LB 5D7SL 2YEZB 4G9FD 3VFMB 3AREB 5DI8A 4PJAF 3VXUD 3BH8A 4GAJH 3KPTA 3OKOB 6FABL 2AXHA 3D0VA 1IGFH 4KK8C 4RFEB 3RGVD 1K4CB 3QWOB 2Y4SA 4ZQKB 3U30B 1ADQA 1AY1L 2YN3A 3ULSB 4GAGH 3MUGB 3PABB 1NUDA 3CC5B 5HDBE 1JF5A 3GSVB 5D1XC 1JGLH 5CEZH 5CEZL 3MYZA 3UAJC 4K8RD 4FFZL 2HWZL 3MJGX 1FRGH 15C8H 4G3YL 1SJEB 1ACZA 1QSVA 4ENED 1WBXB 2X5PA 2YRZA 4YIQA 1QBLL 3BE1H 3P4NA 4IOSD 4KDTC 3OAYH 1PZUB 4PGCA 4ZUVB 4HW6A 5SWSB 5D96C 3IGAB 3SEPA 1JNJA 3N06B 3O6LL 3BPCB 4MJ5B 4MAYC 3HCVB 4LSVH 3OKNB 4D9RD 1HHGA 3KJ4C 5IR1B 2VUOA 5KSAB 4FA8A 2FEDD 4Y0GA 4HX1A 1TZGH 4JN1L 1UQSB 4HXAH 4R7NB 3BGFC 3GSVA 1GOFA 4NRYA 1OHQA 1I8IA 3MBXH 5J11C 5C0CD 4F58H 3U0PB 1I7ZA 1FBIL 5HGHA 1ZA3A 5K9OB 2P5WE 4MX7B 3FQWA 4LCYB 5EC2A 5MEPB 1MJUL 4F2MB 3O3AB 5HI4D 4EN3A 5TE4H 3VG0L 1FN4A 4W4OC 1HHGB 4BH8B 2NY5L 5L9DL 3L3IA 4M7LH 3O3BA 3GMRA 3HNVL 3WNMA 2B20A 2YZ1A 3KXFD 2OJEB 3D69B 4N8PA 1R3IH 4ZOBA 1B6UA 1NSNH 4FXKB 1JGVL 3MLZL 1TQBC 2IMMA 1MFDH 2AXGB 4OTXH 1MHCA 2C3VA 3JXAA 2IFFH 4F80A 1KB9K 3UTSE 1I1AB 2QL1A 5C0AA 3H3KA 3L9RA 3RIFK 4F33B 4YHML 3RVUC 5CD5C 2R0ZH 3NFPB 3TV3H 2VLJD 4U6HB 3O3UN 4GRLC 3MLYH 4X9BA 1ZHNB 1R24A 2B1AL 3KPQA 4FRWA 4J8RB 1IM9B 4Z18A 3PWPA 1B2WH 4G7VL 4Y88A 3TBYB 1KIQA 2DDQL 1RZFH 3NZHL 4HPYL 2C1OA 3AS2A 1A2YB 1YNKH 3CXHJ 3DX6B 4JFHD 1RUAL 4HS6A 4PJDE 1I3GL 1T0NA 2RGSA 3O6MH 3ULUL 1W72L 4MA8H 3OJVC 4Y4HA 4ODVL 4WW2A 4JJHA 1RJYB 4P4KB 2GI7A 4TOYL 1PZ5A 4LLVA 2CO7B 2F58H 4P9HC 4PJIF 2I9TB 1UJTA 4QLRA 2A9NL 5I1EL 1MQKL 3O45B 2VJXA 3SKOB 4W68A 4NQDA 3W2DL 4JZOA 3VH8G 1FIGH 2EE9A 4XMLL 1ONQB 4O4YL 5IB4B 4TVPD 5I1KH 2YD5A 4RIRB 3HC4L 3EOTL 1SQ2N 3IU3B 1MCOH 2R0LL 3UX9B 4S10A 3O6FB 2V5SA 1PG7W 3VE0A 5EFIA 4YDKH 5GS2H 5F7NC 2FIKA 3PWVA 5GS0C 2IBZX 5FF6B 5C07D 5L2KD 5TDOB 5BZWB 3A6CL 3H7BA 2W59A 5D1ZD 5C7XH 4PRNA 4WFEE 4NBZB 5F88A 4MXWH 2HRPH 4OF8A 4Y4HC 3BT2H 5GZND 3U4BL 1JPSL 5TPWL 3GMMA 3LKPB 5F3HA 3ZDYF 2HMID 1HCVA 3FN0H 1QBAA 1WBZA 2IALA 5HPMB 4XP1L 2J8OA 3BPNC 4R3SA 1RIHH 4APQB 5IBLD 1IAOB 5T3XD 2XTJB 4PJEB 4C56B 4PJHF 2F74B 2W92A 2X1XR 3TCLA 1QPXA 4EOWL 4F37F 4Q9RL 5KN5A 1KN2H 3GDBA 1ZTXL 5AYUL 5HHQA 1FGVL 5T1LA 1PKQA 2SEBA 1QRND 3U7WH 1XIWB 4Y16B 1NDMB 4WI4A 3QQ9D 4U3XA 4RSVA 2I60L 4JY4B 3CDFA 1YZZA 1CFNA 5HVWA 1JPTL 5DJ6B 1X6NA 3MRGA 4KGJA 1TQCB 1TTGA 1CGYA 2C3WA 1EPFA 2BRRH 3SGKA 2QHRH 2MPAH 3WHE1 2DWDB 2GAZB 1E28B 4XMPL 4G9DB 3QNZA 4O9HL 1CGUA 2UVEA 2Y5TA 4J4PC 1FL6A 5IHUL 4DWHA 4GSDH 3Q1SH 3MR9B 5TGBA 4OLXH 3VRIB 1HHJA 3PGFL 5BZDA 5T3XE 5CZXD 4RMSA 5MEOA 3MV8B 1CD1A 1ND0B 3M1BB 2ZNXA 1F4WH 1RK1A 4JKWA 4U2ZA 3QQNA 5I1CH 4OJFH 1DVFC 5F7LB 4P3DA 3G5YB 4E41D 4MXQD 1OL0A 4EI5D 1J0KA 5EIVA 3W2DH 5BS0D 3QNZB 5IHLB 2B2XH 1A7OL 1AGBB 2HJKB 3F12A 1S7RA 2ICWJ 4RFEA 2GTWB 3ZHKA 2DM4A 3MJ8B 2CDFA 1QOKA 4OGZA 4N0FA 4WWKD 1UKTA 4X6CE 2BMKB 1JWMA 2OL3A 1GAFH 1GAFL 3VFVA 2BX5A 2DQIH 3UROR 2PW1B 4X4ZA 3O3DA 1E4XL 2HFEB 2VLKA 4OZIF 3FQNB 4IHOB 4NZDA 5LXGL 2DD8L 1NGZB 5ICZA 4RFOH 1U95B 4Y16C 4DAGL 2EYRA 1P2CB 1NGQH 3NMEA 5E0QA 3TWCH 2PKDA 5I66A 5CKGA 2YBRA 2ENYA 5BRZB 2HFGH 3E6FB 3IXAA 1HOCA 2FJFA 4HIHA 5D2LE 3GMNA 2QADD 4ZDHA 1D5IL 1QG3A 4KKLC 3AMLA 3GIZL 1FPTL 1G1YA 1FNFA 4JFFE 1BZQK 5KSAA 5H37H 4PJAE 5HJ3B 1NKOA 4PJBF 3KGRA 3JWDH 5FYLE 4RMWA 3B6SB 2K3TA 3GB7A 4Y5XC 4G80A 3OKKB 1QLFA 4I3RL 4IDJH 1EEUA 4HJ0D 3MTRA 2XKNA 1XT5A 2O5ZH 4P23A 1JF1B 1NGZA 3KYMA 1WIOA 1B3JA 4TNWK 2YMXH 4O00A 1FO0H 1INQA 4Q9QL 3VXQB 1WICA 2D31A 1WT5A 1NLBL 2H2SC 1N2RA 3GBNH 4XNYL 4AYFA 4PP1D 4UTBL 3GSNL 2AXFA 2G9HB 1PLGH 1YEGH 2NNAA 4LIQL 5EORH 4OZIB 2EE2A 2FZ3B 4HWNA 4CADA 3KPMB 1OGAA 1II4E 5HDQL 4PJ7B 3TYGH 1QACA 1E4XI 5T1KB 1PX4A 4KROB 1F4AA 5ITBH 5IKCB 1JWUB 2J4WH 3MFFA 3MGOB 3BKMH 5T3ZD 1UQSA 3P0VL 4I4WB 3QDJA 2QR0B 5F7FA 1L7IL 3T0VA 1J5OH 2WP3T 4OM1H 4K9EH 3QHTC 4WUUA 4PJ5B 4NPYA 5IFJA 2P1YA 5DSCA 4L8CB 5EA0H 4HUVB 4PB9H 1BIHA 4M48L 3NCJH 4KPHH 3VXRE 2FJGA 4N90D 1HZHL 5IHZA 2A77H 3FO0L 5MERB 1R24B 4WU5B 1K2DA 4QHLB 2CDGB 1BFTA 3EYFB 2CK2A 1CS6A 1DSFL 1I8MA 3MCLH 2WBJC 1M05B 3FQUA 3RUGA 4PFEA 2PCPB 4G6AC 2NPLX 4I2XB 1CLYL 4R2GC 2XWTB 4J3OC 5HGAA 3FOLA 5DMKB 3VXSA 5KVGH 1DBML 1DBMH 2QQKL 2QQKH 3E2HB 1NC2A 5GHWL 4I5BA 4PBWD 5GJSH 5DQ9B 2AEWA 3QI9A 3KYOB 1DQDH 4LKXB 3HHRB 4UDTB 3EDDA 3QISA 3PIQB 2IAMD 2ZKHH 3O9WB 3BD4A 2AEIT 4RX4D 5K9KA 4JREC 1IT9H 4YZFF 5SWZD 1MLCB 3LPWA 12E8L 5CMAB 4M3KB 1CCZA 3MRCA 1J1PH 5HHPB 3QQ4A 5JIHA 4HBCH 2CGRH 3QUXC 1WWAX 1WK0A 2Z8SA 5GRJL 1C08B 4YJZL 4W81A 3VXRA 2DI8A 1U8OA 1MCIA 4XCFH 2IAND 4JZNA 4K3GA 4H88L 1KJVA 1ZT4A 1BQHG 3IT8D 2ENSA 5AD0B 5I71C 5D2NE 4OT1H 2G60H 3KPOA 3LSOB 2APWA 3QG6B 4YZFE 4V1DB 3B9AA 1HEZB 3QO0A 5F7MC 1YPZE 5AZEL 1KTDA 4M93C 3V6OE 1BMGA 4YDLB 4UDTA 4MNGE 4UBDD 3IJSB 1WLHA 4PGDA 4FP8H 3MOBH 3RWEA 5B39G 5BRZD 2PXYD 3TN0D 3QULB 1DLFH 2VDKH 1URLA 4GG8A 2JIXD 4NQUA 4OD2A 1MVUB 4IS6B 2P7TA 2WP3O 1MFAL 3W82A 2ID5A 1HXMA 4NNYB 1NMAH 1VKXB 2E8YA 5E5MA 3W9DA 5IW6A 4JO4H 4MXVF 5AZEH 3WNNA 3HZVB 5GIRB 3NZ8A 3S5LG 1I75A 5FF6A 1WV7T 5E2UH 4QWWD 3NAAH 4J3WA 4L9LA 1AFVL 1H3PH 4LSPH 3FQRB 4PGEB 3TN0B 3BPLB 4EI6A 1T1WA 1GCFA 1CU4H 3MRGB 3GSXB 3UAJD 1OAYH 1LD9A 3U2SB 4KI5D 5FKPB 4LKCA 4ONFL 1JHLL 1VPOH 3MRMB 4NQEB 4D8PB 1FAIL 4FOMA 1NL0L 2J6EL 3CFKB 4Z7UE 3CXHK 1F6FB 4LCIL 1NGXB 3BP7B 4ODTH 5C70A 3MRLB 1OT1A 3MRRB 3VGEA 4MLIA 2FD6L 4JKLA 3QCTL 5ITFA 4IMLA 2DD8H 3SGKC 2GFBA 4NNPL 5T1DH 1N7ML 1QFWI 3LD8B 4U3HA 4XNMA 3BEWA 3O6KL 3QXAA 4XPTH 3CVIL 3UMTA 4EKXA 3OKDA 1H3UA 3MLPA 5F8QC 1TZIB 5JXAL 2F53A 1FZOA 1HIML 2DYPA 4MD5B 5KVDL 1CGVA 2X89D 4H1LA 2OCFD 3T4YB 5CSBA 4J3SA 5FGCB 1RURH 3ZT5A 1UWEH 4J3XA 4XWGH 5JHDE 1T89A 3B5GA 4U6YA 5CJOH 2Q8BL 4Z7VB 3GJFH 1SJHB 4Y1AB 5CFHA 5E6ZA 5DZLA 4OUUB 3SGJA 1JCKA 4YFDB 4O2EB 5ILTH 1DEEA 1T66C 8CGTA 2ZZUT 2IG2H 5EBMB 2A6KA 1Q9WA 3WO4B 3QFJA 4EIZC 2VSCA 2B5IB 2FHCA 4CU6A 5I66B 2HN7B 3ZTNH 3L6FB 2NX5D 5FCUH 2YXFA 5I76A 3NA9L 5ESAB 1CK0L 4ZUSB 3V52L 4HIXH 3TA3B 1M7XA 2GJ6E 5EOTB 2HLFD 5E2JA 2V2XA 3DX8B 5ACZB 1FV1B 3BZEA 5DGRA 5KAQF 1FSKB 7CGTA 1I8IB 4M1DH 4HAGA 3QUYD 4RFNB 3TO4D 2XQBH 5D1QA 4GLRH 1MFNA 4FMKA 1V7ML 2H3NA 4GG6F 3EAKA 2ZG3A 3ILQD 1XR9A 3WKML 3HAEA 1OCWL 4P2OD 4P9HH 2I24N 5FYJU 3VG9B 2X4SB 5C0FA 2VZUA 3KPSA 1Q9KB 4E5XA 5D2LB 4FTVD 1PBYA 2PNDA 3O11B 4EI5B 1QLRA 1R3HA 1B0RA 4XNUH 3WHXB 1Q0XL 2A6DB 5ALCH 1T5WB 5J7CC 4XCYA 1MRFH 5F6IC 1WBXA 4JHAH 3MV9D 4GXUM 3QDJB 5EBLA 5IB2B 5EO1A 1UH4A 4F9LA 3KS0H 4Z7VF 4RRPG 5K9QI 1HHIB 1UB5B 4MQXC 3ET9F 3RHWK 2X9YA 1CQKA 2EO1A 3MBED 2HP4A 5CS7A 5K33A 4XH2A 5CUSL 2NY0C 1AGEA 5JIKA 2CK0H 2NNAB 4OZIA 2F5AL 1WZKA 1OB1B 5GRZA 1GIGH 5CEYB 5KOMC 2G5BA 4IRSD 1OSPL 4CJ1A 4TSBH 2A2QT 4P2CG 2BVUA 4GW1B 5IR1A 1KTLB 1LILA 2Q8AH 4F9PC 3EO0B 5FYLD 5C8JA 3C5ZC 3MLSL 4OKVA 1CXHA 3VA2C 4AIXA 4IRJC 4FQCL 1UENA 2R4SL 3ULVC 5BS0A 4BSVB 1OAUL 1S7WB 1X44A 3G6AB 3O9WA 2OK0L 3B2VL 4G8EA 3KLAB 4JKKA 1UM6H 3HC0A 4LEOA 3DVFA 3MRIA 3TM6A 4NUGH 3ES6B 3BYTA 4NC0B 2ORBH 1I1FB 3EO0A 5CEYA 5F9AC 4UNUA 4DEPB 1UJ3B 4Z78A 1JE6A 2C3VB 4O9HH 3PDGA 3MRKA 2Z9TA 3T3ME 4N9GA 1KNOB 5DJYA 4GKNB 3GUTB 2LVCA 3QNYB 2VISA 3MNZB 3UYPA 2JELL 3IDIA 5C0BD 1UYWL 4R4BB 2BERA 3T77A 3T0AA 1DQJB 1RU9L 3B9KD 1WQVT 5E8PB 1A7BA 1L0YA 2HT4D 1IM3B 3G04B 4N8VG 3ARBB 4AT6A 4PJFB 1FCCA 4FZEH 3OAUH 5FK9A 3FMGL 2CIKA 2WBJD 2CSPA 4NO0D 3HI6L 4U1NA 4BFIA 1T80A 1E27A 1BLNB 4XC3L 4OF5A 2X70A 3TA3D 1C8PA 4KKBC 1CICA 2DS4A 1XCTB 4Z5RA 4FN0A 4OCNC 4IRSA 4I0PA 3HNVH 1A6WL 2ZCHL 4OBSA 4PG2A 1AC0A 1T1WB 3K8LA 3WFBH 1CN4A 5FOBA 3DARA 4YR6A 2A74B 2HRPL 3WV0A 1ZHBB 4UILL 5IB4A 3RVXC 4RFNC 5GGRA 2Q1EA 3G6DL 1KCLA 4JM2F 2FL5B 4FQXD 3ULUC 4UIKH 3TYFA 3KPRD 5FYJH 3HLAB 3H3BC 3QZWA 4Y4HD 4L8SC 4L29B 3UYOD 1FGNH 3KLSA 2NY4B 4X6CA 4UINH 1TJHL 1JGEB 5KSUA 1A9EA 5EFIB 3O0RH 3GBNL 3BEWB 1JMXA 1U3ZA 2LV4A 1JK8B 1WWCA 4XAKD 3FFDB 5CZKA 3LKRA 5E00A 1JYXA 3NA9H 4JANB 1LK3H 1JV5A 5I1GL 3FO0H 4FFYL 1FIEA 4DGVH 1S7RB 2DBLL 2DBLH 3DHMA 4URTB 3DV4A 2IJ0C 4PRHE 2C7UB 4Y4FB 4C56A 5IG7B 4U6TA 5CEZE 2A9MH 4YX2L 1S7UA 4X6EB 4ORGB 3OL2A 5ADPL 1A6VL 2NX5A 3EYUL 3SBWC 5DR5H 1DN0A 5DD1L 2VR9A 1LEGB 2DDQH 4Z7UF 1IAOA 4YHOH 1ZKAA 4HJGB 1YNKL 1FL5B 3P40A 5DEFA 3U0TB 4PRDB 1EO8L 3JWOH 1G9ML 3BESR 3MRNB 3FRPG 5DJXB 3IDJA 2GK0B 3MZTA 1NH6A 1Z5LB 1BBJA 1Q1JH 4G6ML 1FFRA 2WWKT 2FECL 3JVGA 4ELMA 4D0DA 4H1LB 2YPLA 5IQ7H 1T0MB 1G7PB 2BVOB 2NX5B 4XNUL 4UV7L 3R06A 3UP1A 3GHBL 2F8OA 1EMTL 2NXZC 4ZPVA 3G5XA 4S1SH 1IC4L 2RCSL 4N0RA 4Y4FA 2M8XA 3MCKA 4LPWA 32C2A 1ND0A 4RAUB 4XB8A 4X4YB 2JK5A 4PRHA 4OCXL 1M7IB 4Z7UB 1ZT1B 1L6XA 3U7AA 3LZFH 2P5EE 3B5HA 2V5MA 4ZYKB 5KANG 3DXAE 3REWB 3KHOA 4ZUWA 4HPOL 4DKDC 3HFMH 1FG2B 5F89B 2ATKB 3KYAA 1FE8L 4U1GB 4D9QD 2D31B 1BFOB 1NCDL 2EDDA 4X6DF 5AAMA 5B39B 3T0XA 2YSSB 3MZGB 3F7RA 1RV6X 4TQEH 4YHPB 3V9FA 4KRMB 3Q6GH 2CKBA 2DOCA 3OXSA 3U82B 5TPWH 3WN5C 1IC1A 3TVMA 4KDWA 3PQYB 4R4NC 5EIIA 4JHWL 3O8XB 5E2TL 2CDFB 1IEBB 3V0WL 4Y1AD 3MGOA 4DGIH 3MGTA 5GPRA 1IGCH 5F1NA 3ARQA 4HBCL 2JK5B 1G7HB 4PRAB 3OHXB 2CLVB 3HPJA 1W0WA 4U1HB 5GQBA 4XNXH 3MOBL 3EDFA 1JVKA 3GBMH 1M7DB 2FECI 2QKIA 2RFXA 2CIIB 2PW2B 4HGWB 4BFGA 5DTFB 4XXCC 3FQTA 1CDCA 2VN7A 2KZWA 5D9SB 3RI5F 1QVOA 1KJ2L 4LFHD 4IOIB 1WITA 5ID1A 2R2HB 3PQYA 3U9PL 4J1UA 1UJ3C 3L3IB 4FXGB 4TUOA 3WO3B 3TO2A 4K3JL 3TT3L 3AU1B 1A1MB 3BN3B 2HFFB 3LN5B 2ARJA 2BCKB 3S3PA 1B0GA 3FO2A 2BY1A 3UTPD 5IJKA 2GJ6D 1CU4L 5KVEH 3TBTB 1VFOA 3DYPA 3WFZA 3OB0K 4EDWL 4X4ME 4TUJB 1X5ZA 1MPAL 1KSRA 4KK9C 1PGRB 3H42L 2A1WL 5DJ2A 3IXTB 4RA0C 4AENA 3DUSA 4XVUC 1WUNT 1TPXB 5DZNA 1CF8H 3QHZH 3HR5A 1OAZL 1UACL 3LQAH 1MRCL 1BJMA 5DRNB 1HHIA 1MLCA 4JY5L 4BFBD 5L88H 1ZA3B 1MH5A 2BJMH 4HEME 5GGVL 4ZXBA 5D9SA 3ELAT 1XZ0A 5DFWH 4BK4A 3VGHA 4Z8FH 1HI6B 2ZCLH 1K3IA 5FYJE 4PBVC 5B3JE 4KI5C 2EDJA 5HHOE 4RGNC 3U1SH 4D9LL 4JQVA 3SOBL 3WSQH 5HYQA 5J13C 4F58L 3IJHB 4M02A 2FX7H 3SJVD 2JIXB 4CJ0A 4ODHL 1JRHH 2EXWC 4TTDD 1WTGT 2Y06L 4EN3B 3PP3K 4ONGH 1MCHA 1G7IA 4C58B 4NPYB 4M7JH 5FDWB 4LDLB 3C60A 1KEGL 2HT3C 4P59L 3HE6A 5D7JB 5F9JB 5TFSL 4YPGA 4TPRH 1N3NB 2QQNH 4B0MM 3SDDA 2XQBL 1XCTA 2XFXA 5HPOA 4YHIB 3HS0A 4WW1A 3C6LD 2O93L 3QIBA 2VLRE 1DQMH 4WV1B 3ARGD 4N1EA 3ARDA 4OT1L 2F5BL 2OQJA 4XP4L 4TUKL 1X5KA 4PRBA 5EUOB 2Y07H 2DJ4A 1KPRB 4TSCH 3VWJD 2YHGA 1I1YB 5HYJB 2G5RA 2ZOLA 1H5BB 4D0BA 1DFBH 2FLRT 1I3UA 5JPMB 3V7MA 2C1OB 5IW1B 1RPQA 1F3DJ 2XKSA 4ORZC 3QDGB 5D7JA 1OTSD 2OS7A 3REVA 3MV9A 3U46B 2BSSA 3ZHLA 1AGCB 3MV7B 3RDTD 3TIDA 4NRZA 1BQHA 3RL2B 4JJ5B 1XGRB 1IILE 1G9MC 4LBEA 4Y19D 4HZLA 4X6BA 2EICA 4DVRL 4WNQB 1PZ5B 4KV5E 4G7VH 4GMTH 3NVQA 4KZEL 1UWGL 4M93B 3WFEL 1OTSC 2ZSVB 2VXTH 3M45A 5M95B 5FGRA 5E8EA 2GTZA 1TPXC 4HXAL 4P4RA 4D3CL 1A14L 4XX1E 5CJQH 3S36H 5KVDH 3V6BR 1WWBX 4AIZB 3DROA 3VE0B 1HHKB 2WBKA 1EFXB 3PL6B 5DUMH 2V6HA 2VDMH 3MPCA 4M5ZL 1J1PL 1JN6B 4XPFH 4ZFOA 4ZXBC 5E2VH 1OW0A 3RY6C 2HH0L 1YMME 3S3JA 2FATL 3RDTA 4JZJA 1BM3H 4RGOH 5L2KE 4I0CC 5D1QC 1DBBH 3MRBB 4Y16D 5DVKA 2ZOKB 4NQXA 2E3VA 5A2IH 4N0CD 3DROB 3VXTB 5C0RH 1K8IA 5HPMA 4XVJL 2ED7A 1RIHL 1OP3K 3MLXL 3V0VA 1WF5A 4GQPH 4Q0XL 5EOCJ 1H9VA 2MCPH 4YXKH 1C5CL 4PJ5E 1G1CA 3B9KA 3R8QA 3ME0A 1S7QA 2O5ZL 3ULVL 3WN5B 2R2EB 3QDMD 2E7LC 3DX9A 4MJIB 4XXCA 3KNBB 5IB3A 4YGVB 3VXTA 5IJVA 4M62H 4AM0B 1EO7A 3E6FA 3IXAB 2OSLB 4XXDB 3QFJD 4PJ9A 3MNVA 1TENA 3SGJC 1D6EA 3QIUA 3TYGL 3BISA 3UYRL 1FNGB 1UA6H 1DQQB 2IQAA 5EBGA 2J5LC 4ZAKB 1OVZA 1DBAL 5CD3B 1U91B 1NC4B 5EBLB 3X3FH 4ZNCD 4OGXL 2P43B 5KVMC 1F2QA 4ALAL 1S5IH 3H9HB 5T5NG 5DJAA 2KQNA 4N0UA 4K3EH 2QQLL 4K55A 3C9NA 5E2UL 3S4SB 3RY6A 5HGDB 1CTNA 3Q1SL 4OLXL 1S7TB 5FYJL 2IADA 1CLOL 4LASH 3ZE0E 3S37L 3ZE2F 1SY6H 1LE5B 2C1PA 5KSVA 5FM5O 3TLRA 4CADB 1U0QA 1NGPL 2W0PA 4Q9BA 1C12A 5DMGC 2DQJL 4WY7H 3RPKA 4WUKL 2HJFB 2ADJB 4ZQKA 4IIQA 5JOEA 2HKFL 1PY9A 5F1NB 2Y5EA 2H3NB 1TNMA 2NY2D 3W5MA 5GS2D 4KAQH 4NKDB 1CGXA 4U1KA 4KVCL 1U93B 4AENB 2UWEE 3FTGB 3DYOA 5BRZA 3HUJB 3F7VA 4L9LC 4Z6AT 4LGRB 4PJ5A 3U48A 5IFJB 3D39B 1RULL 4KJYB 3S4SA 4OBRA 3VFUA 4P2OC 5I2IA 5EC1B 2Z92B 5J12B 3RAJH 3DBXB 1LWRA 1PY4A 1F4HA 3CLEH 4NHUB 4NM4L 4PJDB 3W81A 5D7JC 4N1HB 3U4BH 1IQWH 3VXMB 3IETA 2VXVH 1KC5H 2BC4B 2CXGA 2WSKA 4HKBB 1N59B 3GHEL 4D2NA 4U6VL 1U8KA 4XCYB 1U6AL 3W9EB 4ZOAA 5D71L 4P2OA 2CUHA 4GFTB 4RGMB 4YWGH 1K85A 3QXDA 1PSKL 5DYOA 5A1AA 5I1JH 3DUSB 1TCRA 1KN2L 1GHFL 2KKQA 1YJDC 3GSUA 1MLBB 5A2JH 5F7HA 1YEGL 3UEZA 1RZJH 5C86A 3IDNA 3AS3A 4Z7WB 3X13B 4WUUE 3ULVD 5DVOA 2JELH 1ROWA 2Z92A 3AS1A 3PXHA 5I1KL 1P4LA 3D69A 2IANA 5J9PB 3DI3B 3GO1H 5L0QB 4FXKA 1T66D 3BDXA 4WTZG 4XAWL 1ADQH 5JLZB 2H6PA 2WBJB 4NQVA 3P9LA 1KTLA 3ZKMC 1N0LA 5C92A 1MLBA 2VDOH 4PRBB 3H2WA 4RNRB 4K71B 4MDIA 4B53A