2A6KA

Crystal structure analysis of the germline antibody 36-65 fab in complex with the dodecapeptide slgdnltnhnlr
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Germline antibody 36-65 Fab light chain
molecule tags Immune system
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
total genus 49
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6kA01
1U91A 3EJZC 3BW9B 4TRPH 1UADC 1MRDL 4HWUA 4Q6IB 5BXFA 4F7PA 1VFOA 4X6FB 2AXFB 3T3PE 1MPAH 5B3NA 1OWWA 4BQ9A 4JFXB 4KROC 3TBSB 3ZO0A 3TFKC 2DLGA 4M5YH 2A0LC 3HAEA 1P4LB 2NNAA 5JUEL 4I9WD 4Y4KB 5DEGB 5IHBA 2F58H 3MRQA 4RFNC 2GW5A 4M5ZL 4BELD 1NGZB 1S7VA 4OQTH 3NIGE 4LKCB 35C8L 5DJAB 3MRQB 3LIZL 3OJ2C 5D7IB 3FZUD 3FOLA 4FQXB 5GHWH 1LHZA 4LF3A 4YUEL 4ODVH 4PJAA 5T1MB 2XWBB 3GMMA 2WBJB 3DIFA 5JTWA 3OL2A 4CN4A 1IGFH 2DBLH 3JV6B 1G9NL 5HHVL 5EN2A 4IS6A 3WCYA 1MUJB 4PR5B 3OAZK 1GZPA 2XTJE 5C08E 2DM4A 4XMLL 4PY8I 1X5KA 3WIHL 4IRZH 3FFCB 5I1IL 4WY7H 5ECJE 5I75B 4Z76B 3S34L 4PJ5D 1ULVA 5DRZB 3TJEL 3O3BB 3VFTA 5E4EB 4HJ0C 1NH6A 1RZFL 3H8NA 1UH4A 3NZ8B 2GSIB 1MWAL 5JA8B 4XZUA 4PJBF 2W65A 2V5RA 4OBSA 3T0ED 4EI5C 5FYKD 1RK0A 3P9LB 5TPWH 4GAJH 2VSDA 1T5XA 2E7LA 1CLYL 1U8IA 2MKLC 4JO3H 3CFBB 1QRND 4GRWE 1XFPA 3SKOB 1DVFC 2ZNXA 5E0QA 3QIWC 1NBYA 4XTRD 4PJ9B 3V8OA 1LEKA 3JTTB 3O6KL 3WD5L 2WBJA 4Z8FH 4MAUH 3PL6B 3HA0A 3TIEA 3HRZB 1GOGA 1JWUB 4NNXB 3QG7L 2B1HL 4Z7VA 1IE5A 5F7HA 2XKNA 3UMTA 4OLZL 4TNVK 1CDHA 3IETB 1SM3L 5F44A 1MCIA 3BO8B 4X6BA 3O45B 1NUDA 2HP4A 2V5MA 2VR4A 4KMLB 3L95A 4P99A 1IGJB 3VG9B 3HI6L 3SDXA 1CICC 1P9MC 1Q38A 4NQXB 3GSUB 3AROA 4N1HB 2CQVA 1DLHA 2DDQH 1HHIB 3V6BR 4NQSB 5HYJB 5E9DE 1EO8L 1MFBH 5CGMA 3VDBA 4G8IB 3MRLA 5JHLL 1I9IH 5DMGD 4HS8L 4HG4K 3HPLA 3QDGD 1I8MB 4L3CB 5CZKA 4ELME 4W70A 3HI5H 1Q72H 4J1UA 1DZBA 4HC1H 2GI7A 3MBXL 2XZQL 4HX1B 4X4MA 3FQTB 4S1DC 4X9BA 1DQDH 3I85A 4L4TE 3RPIB 1A7OH 3CSYA 1ITBB 4X5XB 4HK3N 2JIXB 4DN4L 1HINH 4XMKH 3SCMC 4NQVA 2NXYB 5DLMH 4G8GA 2IBBA 3O9WB 3FT2B 4NT6B 1NANI 5GGSB 5TE4L 2MQ3A 4JRYE 3QUYD 2BJML 3BAEH 4R3SA 5JZ7C 3W0WB 3QDJA 4IMKC 5GQBA 1FDLL 1TNMA 1NMCC 1PDKA 2FJGA 3ZDZE 1U58A 1WAAA 1MF2H 1OSZB 5DJZA 2VUYA 3RIFF 3QWQB 4I0PB 5ICYB 4C55A 1GHFH 4NYLA 4IIQB 5SV4A 2AJVH 4PJDE 3MCG1 5HGDB 3Q6FB 4UMGA 1NL0L 1QSEB 1H8OA 1T7YA 4PJ8B 2OTWA 5I8KL 1U8MB 3ARDD 4NN5B 1T20B 2VXVH 1HIML 1UZ6F 5DVKA 1VGEH 4OLXL 2EDHA 1GGCH 3W39A 4KHXH 2J6EA 5SX5H 2DM7A 2ZOLA 3NN8B 1BGXL 1CDGA 2YA2A 4HK3J 5AYQA 1JZ4A 3ULVE 5HJ3A 1RUPL 5EZLA 2Q7NA 2V9QA 4BSJA 1DDHA 4OI9A 1VDGA 2AERT 3LD8C 1F42A 3UO1H 2H1PH 4G6KH 3C8HA 4X5XA 2CD0A 1HKLH 1IBGH 1IT9H 3U0WH 4YDIH 5FA4B 5DUPH 3UYRH 3LKPA 1D5BB 4PG9A 3VG0L 5A3ID 4OM0L 5KZCB 2X1WL 5FUOH 4JN2A 1Y6MR 4NFBA 5A3IC 2V7HB 5FUCC 4KJQD 1T89C 3SKMA 2EECA 3VFOA 2J8UE 2R56L 5D7JC 4OLUL 3LCYA 1FIGL 3GMOB 4M61A 2HMIC 4NQEA 1HE7A 2X70A 2GTWA 2YKLH 3SDDB 4RA3A 3I6LE 2FBJL 2NZIA 2OBGA 2O5ZL 2B1AL 5F1NB 4L8SC 2EDFA 4OQTL 2DKMA 4R2GB 5FUZL 1HWHB 4N8CH 5EO9B 2IH3A 2NXYD 3K1DA 3GI9H 1WEJL 5C0EB 4XPBH 1W0WA 2VIRA 4JKWA 3GMRA 2MHAB 3T1FB 3S3PA 1UVQA 5T33L 2FR4A 5DJ0B 4JGUA 1W0VA 1YMMA 5I1DA 3QQ3B 2VLJB 4IBLT 3VG0H 5DEZA 3QDGB 3ARFB 2ADJB 3P0YL 4PRHA 2VLLA 1IEAB 5I1AB 4YO0A 1CLZH 4GO6B 3QIUB 5D1ZA 4EN3C 1N3NA 1F3JB 3QUXA 4MX7B 4G5ZH 3P9LA 2ZOKA 3O3DB 1RIVH 1K6QL 4XZUB 1UVQB 2FR4B 2EDNA 1T7XA 1FH5H 3LV3A 1MI5B 3VFGL 5L2KE 5IK3A 2EXYD 3MRMA 3I02A 4WV1A 4J6RL 3WL9A 5IF0B 4X7FC 4EI6A 4UT6L 1EZVY 5IWLA 3OR7A 5EO0B 1DJSA 3RDTC 5DS8B 2WW8A 3VFMA 4KJYB 3KPMB 3RHWF 1FBIL 1FPTH 1ZTXH 2IMMA 4H1LB 4ZFGH 2DL9A 1DBBH 3KYOA 5I66B 3LIZH 1XF2B 4MD5B 4AIZA 1CWVA 4D0BA 5IB4A 4GG8B 1FO0A 1FDLH 2BVPA 3VXSE 1GAFL 5I1HL 3SE4C 1U8MA 1VGKA 1AGDB 4I2XE 4HH8A 5IHUL 1G9NH 1ETZA 1KJ3H 3MREA 4S1SL 3VWJA 1MVUB 5F9JA 3CD4A 3FN3A 2IH1B 4GS7B 2DMCA 2Y9RT 3DX8A 1MF2L 3IDIB 2X09A 4PJ5A 3F62A 5D5MB 4X5WA 1B0GA 4WWKB 1INQB 3HNTL 4HUVA 1H5BC 1QRNB 1KEMH 2AV7B 5DZOA 4WVRA 1A7QH 3P4NB 4BFIB 2HVKA 1XF4B 4AG4L 3DNKA 3QYCA 3FRPG 3HG1B 2Y4SA 4WCYH 1XIWD 1Q1JL 4DOHE 5DMIH 5B38A 2P24A 3HI5L 3IDMA 2ZG1A 1J1OH 1HSBB 1HI6B 1JGEB 2WZPD 4QRRA 5GGUA 5IW6A 4QRQB 4UINH 1GAFH 5E8DH 4C83B 4U1SB 2EO9A 1NFKA 1NCUA 1X5IA 5D93B 4UQ3B 2VXUL 5D4QA 2IBZY 3MJ8B 4Y16D 3QDGE 3I3BA 1QQDA 3LAFA 1H5BA 4HJGA 1AQDA 4PGCB 5DK0B 2FCBA 3LN4A 3UC0L 4P5TC 3VXRA 1QLRB 1T1WB 2DTML 3E1F1 3JXAA 5IT2H 3O4OC 3KHQA 2LTQC 3CH8A 2P8LB 4JVWA 3ZDZF 2C1OA 3AM8A 2AJVL 4PJGB 5DDHA 5D2NC 3UBXB 3PQYB 2RFXB 3ZKSD 1HKFA 1SYSB 3S37H 1S7WB 3WO4B 1YEHL 3RI5F 4LCUA 5J1TC 2P5EB 4PY7A 1ZHNB 1SY6L 2J4WL 1RZIA 3EYQD 1KPRB 1T7VA 3B5HA 2UZXB 4KRPD 3HZVB 4R2GC 5C0DA 5SWZB 5LQBH 1U3HB 3MRLB 5DVOA 3MROA 5CMAA 2UY6A 5E9DA 1XIWB 2DQJL 5CILL 1WWCA 5HYJA 4HKZA 1RZ8A 4LSVH 3R1GH 5IB4B 3CFDB 5CKAA 5FGCE 1FNEA 4BK4A 2EEDA 3ZTJG 3GIZL 4WUUD 2XQYK 4C56B 2IANE 4KKLD 4UQ2A 4JHBA 5HHME 2GSIA 1CQKA 4P9HH 4C83A 3BEWA 3MLTA 1CICD 1NGWB 4HX1A 1LEIB 3MA9H 3FB7A 2VL4A 2H6PB 3GBML 3QFJB 5L2KB 1NFIB 2ADGB 2E7MA 4ZTPH 4MQSB 1DUYA 3RTQD 4J2XA 2OCFD 3QAZB 3QISA 3P4MA 1QNZH 4ONFL 1NFDA 1T80A 5ABDE 1X9QA 3D9AL 3RTQC 1OB1A 2QHLA 5ERWA 5KVFL 3GB7A 4YFLI 3IXAA 5EU5A 3V0VA 1B2WH 5DTFB 1CK0L 1NFDE 2P5EE 3LS5H 3VFRB 2V6HA 2YWYA 4PJ9C 1E28A 2OK0H 3O45A 4KK6C 1IEAA 3KXFB 1XGRA 3PDOB 4PJ5B 5D7KD 3GMMB 4G7YH 2AS5M 3HE6B 1O7VA 3BKJL 4FQQB 3VI4E 2IEPA 3MRRA 5D7IA 5FGCB 5TPWL 1GJIA 4GMSH 4JEGB 3H7LA 2YPLA 4QHKI 4PUBH 1CLYH 3HB3D 4K9EL 3IS0X 1J1XH 4Y19E 2O5XL 2CK0H 3B9KC 1U8IB 3BPLB 1S78C 5SWQA 4K3DH 3VFWA 4PP2B 5DT1L 5A40E 2X1PA 4PREB 4JPVH 3OSKA 1FL3A 3OR7B 2D31B 1AD9A 1KN2L 3SY0B 5TQ0L 5AZEL 5CFHA 1GC1L 1NDMB 3MC0A 2HRLA 5HHXH 4C4KO 1P2CA 3N0PB 3LEVH 3BW9A 4JY5L 4LLUA 1JK8B 4PP1C 4RFOH 3C60D 3RNQB 3WYRA 2J12B 4ALAL 4QXUL 1MI5E 1WWBX 1AGEA 2Z92B 4GW5B 4Y19A 3HI1A 3HG1D 4P9MH 4HMEA 2L4OA 4ZXBD 4NO3A 4RGMC 5EIIA 4RGOH 3TN0B 3HNVH 5F3HA 1B88A 2LV4A 5J7CC 3EO1A 1T0PB 3WLBB 2DS4A 4GFTB 1ZLVK 3S96B 5I76A 2FLRT 4Q0XH 3I75B 3JBG7 5I1DB 1FZMB 5T1MA 1KLGA 4Y16B 2VIRB 3AUVA 4HS3A 3OX8B 3SGEH 3QI9A 1LEGA 3IB4A 4X99B 3K7UA 4DKFH 3V6OC 2GITA 2FH6A 1XCTB 1QFWM 1A64A 2ZCLL 5I0ZA 1RURH 2AXJA 3C08L 4Y1AE 5D5ME 4G6JH 3ARQA 5CIPH 2FX7L 4UIKH 3T3PF 3TGXA 4HEPG 4ETQB 1Y18A 5IVXB 2I9LA 2NY0D 2YD5A 3EZJB 1MOEA 5B21A 4Z78B 2FX8L 4J8RB 2E9IA 3HMXH 1KJ2B 3ZE2F 1LK2B 4M6NL 4LCYA 2NY5C 4X6EA 2VISB 4PLOB 4UT6H 3KLAB 2R1YA 4NO0D 1Y6KR 2IADB 2IWGA 3ZKXC 2F54E 4JFZH 2A77H 3KNBA 2F5AL 2EDKA 3S6CA 5ACZB 4P2RD 2JIXA 5DD1L 4MA8H 1TVDA 3RP1A 1C7TA 1CFSA 1QLEH 2UWEA 3BUTA 3MODH 2NY4B 4ZSOA 4IHOA 3VDAA 4MAYC 5D7JB 1I8LA 2AEPH 3NFSL 3F7YA 3TBTB 4IOSD 2HJFA 4U1LA 4I0PD 1KBGL 2NY5L 3TH2T 3BDXA 3M1BB 3QULA 1NGXA 3RVWC 2IPKA 4BZ2H 1JWMA 2HJKB 1IL1A 1ZSDB 3TA3D 3UTSB 5DWUL 4P5TA 2A73A 3SKNA 4R0LA 4U0QB 2ITCA 3S35X 4NO5A 1RZFH 4GW1A 1K85A 3VI4F 5CEYA 1KC5H 4EQ2A 5JIKA 3GJEB 4AEIH 4WEMB 5D1XA 3THMH 1BPVA 3TJHD 5FCUL 5CWSB 4X6BB 2J4WH 4HHAB 1C5CL 4JJ5B 4K94H 1PY9A 4LK4A 4HGMA 1DVFA 4UILH 2FEEL 5TE7H 2BHUA 5BZWA 1C16A 5K59E 3D25A 3P4NA 1BF8A 5DO2D 1DBML 4JKPL 1XR9B 1AQKH 1KG0A 2MCPH 4R96A 3GNML 5C0IA 2BNQE 5TDPA 1KBGH 2NY5H 2I60H 1W0YT 2R2BB 5CEZD 3LQAH 1QFWI 1YYLL 2WLYA 4PGEA 3RKDC 4LPYA 4YXHH 4YQXL 5IMOB 5DT1H 5TQ0H 5IMMA 1JNNH 2VDOH 3RGVA 1FZKB 1T1YA 4XNUL 3BIAX 4ODSH 4RX4D 1I85C 5DGQA 1XH3A 2XNAA 3U36A 4F15B 2Y23A 1I1YB 3K4DA 3V4VH 4KMTH 2E27H 4PJHF 4PRAA 3PWJB 5HHQA 5IG7A 3QG6A 3MRDA 5BZDA 5DD5L 1CBVH 1MREL 5E2VL 4ONHA 4LOUD 1CT8A 1WFNA 1AGFB 3SCMA 3BMWA 4KUCD 1QA9B 3FT3A 3VXSA 3REVB 4PJDB 4TQEL 3BQUA 3CFJA 1SJHA 4K8RD 4K9EC 2R0LL 1OOAA 3FAWA 3M45A 1LO4H 2QQQA 4MJ6A 2DLTA 1DQJB 1MVFA 1VB9A 3NH7L 3RWGB 4Y4FA 1FN4B 5HHVH 2JCCA 1UJ3A 5C6WH 4FQXA 1L7TH 4OI8A 2V2TA 1SQ2N 9CGTA 4CADA 1QBBA 3MX0A 2A6JB 5D6CB 4EBQH 4WI6A 3VWKC 2VDRL 4XHJC 4KXZI 2V2WA 2R29H 2E6QA 3SCMD 2OJZH 2OP4H 4QRPE 4WY7L 5JOEA 3BHBA 1EO5A 3U2SB 3G6JE 3ESVF 4WI3A 1ES0B 4OD3H 4X80L 2DRUA 4PJ7B 3E8UH 4DFIA 4YWGH 4CNIB 3DO7B 2YD3A 5DYOB 4G6AC 3EZ8A 5K93A 4KTEH 5FDYA 1S7XA 2DM3A 2L7JA 3BEVB 3IJSA 1B4RA 3B4NA 4KFZC 5F88B 3GMPA 1FFNA 4MNGB 2A38A 2H26A 1RZJL 4I5BA 4WCYL 5J11B 1SHMA 5BV7B 1Q9KB 4OZIA 4XC3L 4ZOAA 2K7QA 4ZFZA 3MRBB 4FHBD 4X8JB 5I1GL 2GY5A 3UBXG 4QRPA 4MXVE 1JNHB 1C7SA 4X8XA 2CMRL 2GEEA 4JVPA 5I8EB 1D5BA 4NN7C 1NGQH 2P5WA 3F6IA 2BOBA 5FHAL 4PTUA 2OLDA 5IQ7L 5DVLA 3JVGC 4TYUA 3HTLX 4A2MA 3H42H 4IEFB 1MCQA 4PJ9D 3X3FL 2VMFA 5HGHA 4QRTB 1NL0H 5EUOE 1A9BA 2W60A 4TUJB 5J13B 2J88L 2Q6WB 3NIDE 4RFEB 4CJ0A 1SBBA 5LAXB 1S7UA 2YD8A 1RY7B 1WWAX 5I6XB 4LU5H 1A3QA 4MB4A 4WFHD 1QBML 2ZUQC 4HLZG 2FECI 3SGKC 4XNZC 1D5ZA 1N5AA 4OZFH 1EGJA 2P5WD 2AI0L 1T03L 4PG2A 3BH8B 1M05A 1NCCL 4PJEF 1FZOB 2I60L 1FL5B 1YYML 4S2SB 4OD1L 2A77L 3HC4L 2UYLB 4ZTOL 3AREC 4OZGA 3ZYOA 1I8IA 5IW6B 1NKOA 4PRBA 4UNTA 1JF1B 4ZS7H 2VLJE 3BI9X 2BVEA 1IBGL 1AGCA 3SJVA 1JZ7A 3Q5OA 5SX4I 1I8LC 4LLYA 1M7IB 4K3JL 2GAZA 4PPTA 1GGTA 1UA6H 4R97B 2B0SH 5GS1A 2HT3C 4OCSH 1FZJA 1QSFA 3V0WL 1UM5L 1P4IL 5GGQL 2BK8A 3QNXA 3V9FA 2IJ0C 1ZAGA 3UDWC 4ZS6C 5DI8A 3C6LB 1C08B 5CUSL 5BRZB 5IFAH 4PYHA 2KH2B 5DHXB 2HG5B 3I9GL 1RJZB 3ME0A 3HZYA 4LSQL 4HIJA 3F7VA 2IF7A 1KG0B 3BZ4B 3SJVD 1MCKA 2CDGA 4FQIL 4P2RA 3PGDB 4U6HB 2DTSA 4L8SA 4CAGA 3VJ6A 4XWOC 4L9LA 3UTQB 4MD0B 3MV7E 5D1QD 2DQDL 4PJHB 5JXEA 3IAQA 3FZUC 3VWJC 5LWYL 5FDWB 1ZVHA 2BP3A 5E00A 3TT3L 5JO5B 4OF0A 2DQHH 1UH3A 1YYLH 3MV7A 3KYNA 5JHDB 2M1KA 5E94B 4QY8B 3ILPB 1G7LA 4HDIA 2DIBA 1F11A 3GKZA 1FNHA 3UPAA 5B8CB 3CVHA 4IMLA 1FYHB 1HCVA 1A0QH 3K8LA 1U8QA 3QXAB 1TZIB 1QBAA 2Y5TB 1TVHB 1R3LB 1WZKA 4U6YA 1LK3H 3OQ3B 3WIFB 5F89B 4JPVL 5FUCE 1MHPL 4MNQD 2E5EA 2C1PA 2YKLL 1VKXA 2EE9A 5E24E 2Z31C 2R2EA 5DJ2B 5DR5H 2UZIL 4K7PH 4OIAA 3ZHDA 2YD4A 1I8KB 3LY6A 1EEZA 1X4XA 2ZUUA 5BV7H 1XZ0A 1KPUB 4KQ3L 3IF1A 1G7MA 1TTFA 4XVTL 3SDAB 4CBPA 4GG6A 1OAKL 4J12A 2BDNL 2I07A 5CP3H 1Q9KA 4OZIB 3PHOA 3DX9A 4R9HA 1CGVA 3QQ4B 3SDCB 5B39B 1QOKA 1Y18B 1UXSB 2VR5A 3ZTNH 4MMXC 4LP4A 4HSQA 2X89A 4XPHL 2A6KB 5HGAB 1LD9B 4QKXB 4HF5H 4MZ3A 1S5HA 2LU3A 2PW1A 3FB6B 3LSOA 3VXNB 1GZPB 3S98A 1X5AA 4MD4A 4F3FA 2CKBL 3R0MA 1M71A 3ARYA 1PG7X 5FAAA 4AEFA 1CZ8L 3X11A 1I9JH 1RMFL 3W11D 4NWUL 4LIQH 4ZUUA 5BVPL 3WLWD 4HKJB 4O02H 4X7SL 2ED7A 4XHQA 5DEFB 3VXSD 4FS0A 1EFXD 4OD2A 5I6XC 3WLWC 1VERA 2ESVE 2X89D 1ZVYA 4FQLH 5JLZB 4LLYB 2GCYA 1CGUA 1YN7B 2ZUSA 5ID1A 2CLZB 1EHXA 1NBVL 4Y19B 5EFIB 5C08B 3SO3C 1ZA3B 5C3TA 3QEQA 4OB5L 3CJJA 4F7EA 3B3IA 4OGZA 3IGAA 4XTRC 1FJ1A 3TO4A 4ZSOE 2F5BH 3Q6GH 1KSRA 5GRYA 4DQOL 3DECA 5DVNA 5EZJB 4YHKH 3WS6C 5KOVC 3K46A 5TFSH 5J1SC 5GSRA 1WZ1L 1SVCP 1ZHLA 2ZP0T 5D7IE 1BFVH 4BQCA 5I75C 1DBAL 2Z8WC 1EDQA 4MD4B 3UZVB 5E4EC 3VRLF 4UV4L 4M6OL 5GSVB 3LB6D 3MLSL 5FUOL 1QZ1A 4YH6A 3O4LB 4HKBA 4FFZH 4JDZB 3QB7C 3V6FB 4XXDA 5GS0C 4YR6B 5DRNA 4ACPA 1YEJH 3ESUF 5EUOF 3WFDL 4OD2B 2BCKA 5DJYB 5GHWL 3BRFA 4GRLA 3QDJB 5C0BD 3MR9B 4QOKE 4R4ND 4NN7B 3FQNB 5MEOB 4AH2A 1K4CB 1CI5A 1ZANH 4Q9QL 2XA8H 3V2AR 1ONQB 1JIBA 2OJEB 4LSDA 5ID0A 4GQPH 1KPVA 2IBGA 3GIZH 4P2QD 1G7JA 4BH7A 2BVOB 1A7RL 4NJAH 4IDLA 2PW1B 3FB6A 4L29B 4X5LA 1KELL 1PZ5B 5C6PB 5CZXC 3FO1B 3QRGL 1YEFL 5B39G 2EC8A 2HFEA 4CW1B 1HSAB 2CMRH 4UZGA 5C0BA 5JZ7D 4TSAL 5MEQA 1HILB 4FQXC 1QEWB 4J4PD 4X0KB 3D3VA 1CYGA 3QHFL 1HHIA 4NZDA 2E7CA 1SYVA 4LHJB 5DJ6B 3EHBD 2GUOA 2FLBT 2F19H 5FYKU 4NO5B 5D2LB 4QXGL 1GZQB 2Z0BA 4UIMB 3QA3A 5E00B 1EAJA 1J1PL 3V4VL 4ZD3H 5L8JB 2Y5EA 2HAZA 2X42A 1QRKA 3O2DL 5E8EB 3T65B 4H25B 4NZRL 3IDGB 3SGEI 5C0FB 4KK8C 2PNDA 3DUUA 2V2TB 4DTGH 4Z0BL 2F54B 2YC1A 5C0DB 4MA3A 4XB7A 2BX5A 5A2KH 1S9VB 4MDJA 1U41A 3PJSB 1YYMH 1CD1B 4URTB 4PGDB 4UDUB 3QA3B 3GMLB 1YY9C 3CFJB 4OLZH 2ATKB 4ZFFB 4QHLA 5HY9A 5D2LF 3BZFB 3Q1SL 1JGVL 4NM8H 4ODXB 1YUHB 1FFRA 25C8L 3V7MA 1FGVH 2X41A 2GAZB 3OJVC 4HT1H 2P7TA 2VABB 5F7LB 3EO9L 5ADPL 5HHXL 3P9MB 4KRPB 3QIWB 4U1LB 1EK3A 3O81A 4LMQE 2GHWB 3KPRA 2L0DA 4G8EB 1WIOA 1BZ9A 4DCQB 1OTUD 3GJFA 4X80H 2CGRH 4OV5B 4PTUB 1BBJB 3TPUA 3ZT7A 1D5IH 4N90E 3PHSA 1N8ZB 1UM4H 4XNQB 5HHPA 4EJ1C 4NOBA 1OARL 3LD8B 2NY0C 2W91A 3KPOB 1WFUA 4J3TA 4YLQT 4RBPH 1CDUA 4JFDA 2D7NA 5EUOA 3V5HA 3GKWL 4RFEA 2KZ1B 2ORBL 1YEGH 1LP9A 1Z0NA 2BSRA 2AGJH 4E0RB 4LKCA 3IVKA 1C16B 4PRID 1JHKH 1H3TA 3DTXA 4NKDB 2VZUA 4UV4H 1GHFL 3RY6C 1IILE 4L5FH 4L4VE 4LQ1A 4HKJA 3LRHA 4LQFL 4UIMA 2VE6B 1N2RA 3ULVH 5GJTH 1U93B 2FO1A 1QFWL 2DJSA 4GKSA 3L7FA 4WI2A 4WO4C 5BRZE 2XZAL 2DBJA 4GG8A 4AY0A 5LGHL 5EOTA 3W9DB 4APQC 1UM4L 3IYLW 4EDXB 3DBXA 5C0BB 1QRNE 5GGTA 3ARRA 5C9JA 4HCRH 3WMSA 3MBED 2WUBH 5ITBH 3V6OE 2HN7A 2CKBA 3CZFB 4NN6C 1VEPA 2C7UB 3DGGA 3MBEC 4IHOB 1BM3L 2E7LC 1T4KB 2B4CL 1EHNA 4U1KB 1WFOA 3QCVL 1BQUA 3KPOA 3B9AA 3NFSH 4ZTOH 5H35B 1UWGL 4I77H 1S7SB 2FB4H 1Z6JT 1BFOB 2OR9H 1MHCA 3HC0A 4LLAA 5IW3A 5HYJD 2BFVL 4QHMB 5I15L 1QR1A 1P84J 4XPHH 2C3WA 2QKIB 1AD9B 1G1CA 4XCYB 2BCKB 2YBRA 5FHBL 1A47A 1FO0L 4OJFH 1EHLH 2P4AB 2XXCB 2A6JA 3BKYL 2FSEB 4TUKH 1S8DA 2NY2B 2QL1A 2JTDA 5F8RC 3M8OL 1NAKH 1GH7A 1T5WB 1HHJA 4X6CA 1Q9WB 1IGMH 2A9NH 1JZ2A 4GBXD 3OKEA 2FX9H 3FQUA 3VFUB 1E4XL 5A2IH 4PJ7A 2V9TA 3KYNB 2WAHA 3KWWA 2EKSB 4QNPE 5CIPA 1S3KL 4PGEB 1CLOL 3A6CH 1A6VH 4XWGL 1WC7B 1H3PH 4N0CC 3BP7A 1KJ2H 1YNLH 4QRSB 4PRAB 5MEND 2VNCA 3WN5B 1AIFB 3D18A 1VKXB 2KDGA 1I1YA 4M9PA 4F58H 4GMTL 3MRGA 4ELMB 3ARGB 4HT1L 4U6YB 4QT5B 1OB1B 2LQRA 1G7IB 3MNWB 3EO9H 3IFOA 4Z7OF 4XPTH 3FO2A 2N4IA 2A6IB 4WTZA 3VFGH 4DEPC 3K0WA 4FFVC 1MCEA 3MOAL 1RIUH 2D7PA 1D6EB 2VDLL 4FXKA 5HGGS 4ZNEE 1SEBB 2EEAA 3FO9A 2XG4A 5TQ2L 1NC4B 4PRPA 2BC4B 4CDGC 3EAKA 1WBXA 4ZUSB 4Q9BA 4U1HB 3UPRB 3FTGA 4P5KA 4WI7A 1MAJA 3ZDYF 4RFOL 4PJHA 2X40A 1LO5B 2D0HA 4HC1L 4Y5XA 1A8JH 2HJLA 4KDTA 4DGIH 5DUBB 5GISH 4JO2H 5IBLD 7FABL 4G42B 3ZYZA 2DLHA 1HI6A 4QRRB 1YMME 3OZ9H 5HY9B 1FZOA 2ATPA 3UZEA 5I1CL 3ECBA 2JB6B 5L2JB 2HTLC 3FFCD 3HS0A 3VXME 3O4OB 4XP4H 1F6LL 5D71L 3DMMB 4ONGH 3MRJA 4TOYH 5IOPA 1E6OL 3SE8L 4MHHI 3PHQB 5EULV 5DJZB 1VADB 2BRQA 1LDPH 3V5DB 4MA3B 1U58B 1X6NA 5J8OA 3D0LA 4LAJH 1NGPH 4HK0A 1T1WA 4PJDF 3PHQA 4U2ZA 3W82A 4IRSC 4OKVA 5D7LB 4ODBD 2E27L 4P49A 1NAMB 4YXKH 5D7JA 1MCCA 1XF5A 2AXHA 4W6WB 1J0KA 3HS0B 4HHAA 1CLCA 2VXQH 2XKSA 2NY1B 3VCLA 3IDIA 4LBEA 2P8PA 1H15A 4ELKA 4AMKL 2JF1A 3TV3L 1HQ4B 2AEIT 5GSRB 2JJTC 3VXTB 4JFEB 4TNWK 4Y4HD 3C6LA 1LO5A 2VDML 2FIRT 3T0DA 3HRPA 2E3VA 1LK2A 5C6TL 1GVIA 4KKAD 4U6XB 1LE9A 3JUZA 3RAJL 2VXUH 4QLRA 2FRGP 4M1GL 4JY4B 2ICCA 4Z95L 3CXDL 5C0RL 5D7JD 5E08L 3P4OB 5FECA 1WLHA 4NO0A 3EUUA 1JYVA 1JYNA 1KLUA 3WJLC 3RUGA 3D87B 4JPIB 2OTUA 2GQHA 3BUYB 1JTOA 1Q94A 2W9DL 1AH1A 1KOAA 3C60C 1NAKL 3X11B 3G5XB 4RZCB 4C58B 4YIQB 1E4XH 2HFTA 1JV5B 5J0BA 1D5ZB 3CX2A 4XH2A 4YPJA 2NZ9D 2EKJA 1CF8L 4QGTA 1Q9WA 4QXTA 1G9NC 5MHSE 2WUCH 1QLRA 4P4KC 1TJHH 5IFHH 2P48B 3TC9A 4RISH 2C4FT 5DJ8B 5F7DB 2CIKB 1P7QA 1ZKAA 2YRLA 1A6VL 5EBWA 3SDXF 1AGEB 2NTSP 1BAFH 2Z92A 1DBBL 4Y88A 1W0VB 1YMMB 1IM9A 5BS0E 4P46B 3SHSA 3T0EE 2JLLA 5L0QB 3A6OA 5GGVY 4QHUA 3WL9B 5L6YH 1K3ZA 1XGYL 2A2QT 4BZ1H 5DRZA 1UKSA 1CE1H 1ADQH 3VD7A 3LEXB 1CT8B 5C0AB 2ORBH 4IRJB 2VDKL 3VH8A 4U49A 3BWAB 4F7TB 5CEZE 1U2CA 2EIZB 1N3NB 3QUXB 5DTFA 3SQBA 5MERA 3WEXB 5IVXE 3ARBB 5TQ2H 3KYKH 1NQBA 6FABH 5GZNC 3WKMH 4QWWC 2C4FU 4WFGE 1YN6A 5SWZD 2VYRE 3MLXL 1BWWA 3D85D 1QFWH 1UJ3B 2WIIA 5GS2D 2LFGA 1BX2A 4X98B 4PJCA 2PCPA 4RGMB 4MXQC 3MRRB 1UG9A 1WAAF 1I75A 3QO0A 3Q3GA 5MEPB 4O58L 3CVIH 1XCQA 1CGSH 2P44B 4OI7A 3RGVC 1QHPA 3VI3E 2X7LB 4MAUL 4OZHF 2EYTA 3T4YA 5ITBL 4MA7L 4PJEE 3A67H 4K3DL 1KJ2L 2D4DA 3RVWD 1OLLA 3AAZB 1B0RB 4LCCB 4OZGE 4UOW0 2G60L 3D1MC 1MCNA 1KN2H 5TGBB 3U36B 2DQFA 5ICZB 4HW6A 2MMXA 1Z2KA 1ROWA 1EVTC 1FVEB 4FQQA 1KTLB 3TA3C 4OT1L 4NQEE 1JTTA 32C2B 1XGUB 4EOWL 4M7LL 4Y4FC 4E41D 2FSEA 2ICEB 3BHBB 1FH5L 4WEUD 1V3LA 1CDBA 1J86A 1RUAL 4HPYH 4X4XA 2AKRA 5ESQB 4WO4A 3RA7L 5GGSA 4XVTH 5H8DA 4ODHH 4Q74A 3R06B 3FFCE 1Q94B 1FAIL 1PX3A 2HT4C 4LCWA 4O4YH 4QF1A 4MAYB 2H32H 3RUGB 4K23L 1A6UH 2BNRD 2KL6A 4Y1AD 3OKOA 3QFJD 2AEWA 3UAJD 1C5DA 1OAXH 1PG7W 2ZG2A 3GJFB 1EH9A 1F4WL 1FVDB 5HDLA 1ERNA 5FKAA 5L2KA 3VGBA 3G5ZB 4G9DB 5AD0B 3L3GA 1N0LA 3RWJA 5M94B 5F71A 1R6VA 3CZJA 1SMAA 2CK2A 4YAQA 2PYEA 4MJIE 1A2YA 4OZIE 5ALBH 1AD0A 4BFEA 4HBQA 4IM8A 4G7VL 5IHUH 4CVZB 1NGQL 3SDAD 5JW3H 1YNKL 4JZNA 3C2AL 1AD0B 3AY4A 1X3DA 4NWUH 5DK0A 1IEBB 4FQJL 3O6FA 4NQEB 5ADOH 4JFPA 2DICA 2K1MA 2IQ9H 1P7HL 3RUGF 5E1HB 3ZYJA 5HDBF 1RZIB 3UJTH 3MNWA 1HXMA 1L0XA 2MPAH 1CF8H 3LB6C 5EU3A 4CU8A 4M6NH 4N9GA 4P4KB 5EOCH 4LASL 2NY4D 5ACMA 3MLUH 5L7XH 2CO6B 3EDEA 3PL6A 5IBUB 5KSAC 3TZVC 2QSQA 1MWAA 3FTGB 4P5KB 5GGTL 2AKRB 1BLNB 3F58H 5IFJA 5L0QC 3C6LC 3KPTA 4YDIL 5GRJH 3QIUD 2HG5A 2BZDA 2JCCE 3MJ9A 1JWMB 1OAZH 4OSUL 5BRZA 4YDVA 3NIDF 4ZDHB 5HYEA 5TFSL 5IJKC 5F97E 4FMKA 3IDNA 4ZAKD 3VRIA 3OF6D 3ECBB 1HHHA 1O0VA 4J3OC 5AD0A 1AGBA 1B3JA 1UB6B 4HULB 4Z18A 1MH5A 4RNRA 5I1EL 2GYSA 2Q7YA 1T83C 2GSGB 4JJHA 5FV1L 1PY4A 3PL6C 3TWCL 3AREA 4ONOA 3O6FB 2EDOA 4ZQKB 2ICES 1I9RL 4B0MM 2VSCA 4LCWE 4WW2C 4TTDD 1NCNA 4JFDE 1WEJH 4Y4HA 5HHNB 1J0YA 4ODXA 1A6TA 5HYJE 5DC0A 5CBAA 1HQRB 4OUOA 1LP9E 2VXQL 3MRKB 1PBYA 5ID0B 4X6DB 1IGML 4MCYB 5E6ZA 3VXQA 1J8HD 5DS8A 2XPGA 4FXGA 1XCQB 3V7AG 4WI5A 3EFDH 4DN3L 3JV6A 1R3KA 1RI8A 3ARSA 1ZLUH 2VQ1A 1CD1A 5FO7B 3ARGD 1EV2E 1H8NA 4DW2L 5I17A 4DQOH 4D3CH 2HKFL 4MJ6B 4M7JH 1MVUA 1HKLL 5F9JB 2YUVA 3TIDA 3V6FA 1BJMA 1L6ZA 2Y6SC 4LPTA 4GW4B 1ADQL 1Z5LB 3RJQB 5JDJA 1B0RA 1JNHA 2JJVA 2AAVA 4NCDA 5MERB 1JF6A 3KPRE 4W6YB 4J8RA 1FLRL 5GGRA 1KIUA 3CFEA 5C0CE 4JO1L 1QR1B 4WEBL 3FCTA 1NC4A 5C92A 4NQSA 3QWRA 1PSKL 4PJEA 1MHEB 3VFWB 4QXGH 5DD3L 4ZXBC 2OZ4H 4G8GE 3MV8D 3BEVA 4OBRA 2GSGA 3CMGA 3OKEB 2YA0A 5JHDE 4D9LH 3P77B 4R26H 2OQJB 5FGRA 1S7QB 3X3GL 4HXAH 4KJQC 2VXSL 1VENA 2ADGA 3UBXI 3MQIA 1MI5A 4TQEH 3O6LH 1MHHA 4FTVE 3HPJA 2MQCA 3OJDA 4GXVH 3ARBA 4UOJA 5DJAA 1DEDA 3DBXB 1PFCA 1OTUC 3S96A 3S35H 5HDQL 3PP4H 2XTJC 1KULA 4P2CG 1NCTA 5E2TL 2HFGH 5D8JL 1DN0A 2JJTA 2GTWB 2BDNH 4NO3B 1T66C 3IXAB 2B20A 3TIDB 3FN0L 2ZCHL 4UU9A 5MEPA 3EJZD 4JFXA 5ACLA 2VTFA 3X14B 1UXSA 4DUVA 4FQJH 4QHUB 4WFFE 1NC2B 4XXCA 3AFLA 1J0HA 4J3XA 5TDNA 1TZHA 2OMBA 4ZMAT 1KGCE 3SPVA 2C1OB 4DVRH 2FX7H 1R5IA 1HQRA 1A7NL 4H0HB 1I4FA 1ZWIA 4RIRB 2JK5A 3C09B 5E8PB 3BN9D 1QQDB 3QUKB 1U3JA 2APVA 4NN5C 1NEZB 3GB7B 5HHMB 2GK2A 1JGUH 4NKMB 3FT2A 1ZEAL 2CXKA 3QXAA 3EDJA 3CVIL 1CFSB 4RMRA 3RWDA 1ZGLA 3KJ4C 2X2YA 5FKPB 3SE9H 4UUJB 4YHZH 2VDPL 3RDTD 4QYOA 3VFPA 4MZ2A 3RUGE 5FA4A 2H1PL 3CIQA 4G6KL 4PTTA 3MV8E 2J8UF 3LOWA 1E4XI 1JPTL 2EICA 5TE4H 3GEWB 4YE4H 2O5YH 5A2FA 4EI5A 1NANH 5K9KB 3SN6N 3ARUA 3TFKD 4LLQB 4R8WH 4YK4B 1HZHH 1K8DA 2ILLA 5E8NA 4XPGH 3HAEG 4M62L 3G6DH 5CJQL 3L3DB 4HKZB 2X4OB 4N8PA 5IV2B 1J12A 3ZE0E 1J11A 4NQVB 1TVBB 5EWIH 4PY8J 4P2RB 4U6HA 1FIEA 5F9DC 5I74B 5CINH 2WV3A 4ELKB 3ROLB 3O2WH 2CLRA 1H15B 2Q3ZA 2NW2A 1XR8B 2KZWA 1O5DT 4Z77A 5CHNB 5IROC 1KCSL 1BEYL 5A2LH 3MPCA 4PFEA 5SX4H 1JGEA 1LEIA 1HHHB 3L5HA 3PIQB 5C0CB 3SDYL 5KVDL 2MJWA 3D69B 1LEKB 2I27N 2MCPL 4YDVB 3NH7H 1WBXB 1T3FA 4ZUSA 4LVNC 1X4ZA 4HIIA 4TRPL 5JW5A 3L5XL 3ALPA 4KV5F 2VDQL 2YUWA 2AJSH 4TSBL 3VXRB 5FB8A 5E1AB 4NJAL 4G9DA 3EJYC 4G8GB 2UY7A 2H2PD 5HI3C 2BSTA 2F54D 4NGHL 4MLSA 4HMDA 2RR3A 4ERSH 1A6WL 3OGCA 3U1SH 1KTDB 5IVXF 2N7BA 2HFEB 2W0FA 2QQNL 1MRCL 2IADA 3O2WL 1DUZB 3KPRB 4OD3L 1FYTE 4Y5XC 4MWFB 3ES6A 4F57L 1IRAY 1DANU 4NBYB 4QRSA 4N0UE 2E7BA 4JM4H 1WC7A 1F4AA 3O0RL 4HXBH 1TETH 3GSUA 4LHUD 1H5BB 4PGCA 4PIRF 3NMEA 4JHWH 3OKKB 4Q9CA 1CLOH 1I1CA 3A6CL 3VXMD 3FHQA 5BRZD 5TDNB 3RGHA 5EO0A 2DOCA 5E6IC 4KRPC 2CH8A 5D96B 2YXFA 3MJGX 3ARXA 5EPMA 3PP3K 4JKKA 4CW1A 1S7TB 1ED3A 5JOFA 3QEQB 3U4AA 1TTGA 2YC1B 1LDPL 4NC1C 2Q6WA 2DQUL 3KXFE 1TCRA 1T7WA 5HGHB 4S11A 2BC4A 1JPFB 5E5RB 1CGXA 4G5ZL 3KLSA 1FO0H 4OJFL 3OKYA 1S9KC 5EU5B 3QEGL 4ZUUB 1XF1A 4JCMA 5I8EA 3VFMB 3HPJB 1RK0B 2DIAA 5AZ2H 1B0GB 3WSQH 3HMWL 3NCMA 4WTZG 4XP1L 2JB5H 1BX2B 1TETL 2CDEA 1JYXA 3NZ8A 1J8HA 1S5IH 2V17L 5BJTA 5IW1A 3L3KA 1RIHL 2FO4A 3KDMA 4EOWH 5KVMC 1DBKL 5DYOA 5C08A 3RHWK 1DANT 4G7YL 1MFEL 4CN6A 3ARGA 4M4RA 3ZMRA 4ELMF 4WFFD 3MLTB 4ORZC 1FPTL 4KTYA 4P3DB 5E2UL 3LDBC 3NACH 4KI5C 5T3ZE 1A5FL 4KWUA 4QCIB 1S7XB 3IJSB 3REWA 4NCC1 4FXLA 3NCFB 5HPMA 3QUYC 1QPPA 1UB5A 3TVMC 4H0IA 1UZ8A 3RNKB 5D9SB 4B50A 4DAGL 4K3JH 5EZJA 5EN2B 3QDGA 3HZVA 2BSSA 4CJ1A 5F21B 5LKNA 4KK9C 2P45B 1PYWB 3LQAC 1XF5B 4P2OB 2PO6D 2OJZL 3P3YA 1DBKH 5HYSA 4KQ4H 5T3XE 4JAMB 2IH3B 1IAMA 4HWZB 4UT7L 5KSUB 3MGTB 3ZKND 5CZVH 3UROR 3QUYA 3HC0B 3L3JA 4RGOL 4Y7MA 2ARJQ 1U8JA 5D2NE 4H1LH 2VWEC 4HV8B 5I1JL 5KN5B 3GO1H 4UQ3A 3RAJH 3KPPB 3U0PB 2AXFA 4U31A 4PGJA 3C6SB 4M93C 5GRZA 1AI1L 4Q6IA 5T5FH 1MCJA 2C7UA 5FECB 4G8EA 1BM3H 2D7QA 3R8QA 2UVFA 1YEDA 2YPLD 4KAQH 1R0AH 3FT4A 5FYJD 3RWFA 4GAGH 1U8QB 3HE6C 1CFNA 4IIQA 2GCYB 4KUZL 1JGLH 3BN3B 1OHQA 3VW3H 3DGCR 2LAGB 1NEZG 1FZKA 3DYOA 5DF0A 3WJLA 5IB1B 1Q8MA 4UIKL 1U95B 2XICA 1RV6X 3BDYL 4KZDL 4IOFD 3VFOB 4N0FB 15C8L 5TE7L 4EUPA 1KPRA 4BFGA 1BBDL 5JA9A 2VZ3A 1CFQB 1GGCL 1TPXC 3TH4T 4EIZC 1FRGL 4XC1H 4X6CE 1JPFA 2CLVA 1NAMA 2HTKD 3PF2A 4KQ3H 4KXZH 4JRXE 3C5ZB 5I9QC 3WFEL 2IAMD 3IDUA 5IROA 2FX9L 1G6RA 3FRUB 5E6IB 3QUMH 3K74B 2JCCB 1YJDL 3P2TA 1DVFB 3DI3B 5IM7A 5EC2A 4JJ5A 2Q76A 5J9PB 3UTPD 3N50A 2HT2C 1WCBA 2VO5A 3IJYB 1G9MH 1A4JB 3QDMB 1SYSA 3BZFA 5E08H 1QR4A 4EN3A 3DVNB 1YNTB 4NDMA 3S97C 4NHUB 4BZYA 1SM3H 2ATKA 2R0WL 3MUJA 5I74C 1CFTA 1BIHA 1JMXA 2OM5A 3VGDA 5EIVA 3M17A 4NGHH 2X4PA 1QNZL 1CL7H 1ZT1A 5DUBA 4JGMA 1CGYA 4UNVA 5I1LB 1OAQH 3VRJA 3LEVL 5IGXH 2XV6B 5KW9H 5LG1A 2BHZA 4Z7UB 3I2CL 3U9PL 5IWLC 3OXRA 2D03H 1NBYB 1OSZA 4YJZL 1NGYA 5DD3H 1ZA6A 4QRQA 2ZWLT 2FJGB 1MHCB 1N6UA 4IDJL 3MFFA 1ORQA 1IKNC 5D1ZD 3D48R 4R26L 4HUVB 4HXAL 3S37X 5KSBB 3QNXB 1CXIA 1IC5H 3MJ6A 1SVZA 1N4XL 5B22A 4DKEH 5F1IB 2XWBA 4PUBL 2ADFL 3DHJA 5ICXB 4POYA 1QFUH 4GMSL 2GFBA 2X4UB 2D7TL 4G3YL 3MUGB 3B2UD 5JW4Q 2DQUH 2WWMD 1ZS8A 5ESVB 4V2BA 3N85H 5GRXG 4PLJD 3WIIH 5HVGB 1IAOB 3B8YA 3FN0H 4M6OH 4EXPX 3SE8H 3MRNA 3FO9B 2D03L 4MJ4A 3V95A 1RMFH 4QO1A 4OTXL 1ORSB 3TA3A 3O3EA 4GKSB 3WKML 3BVNB 3Q5TA 3CXHJ 4RCAA 2J1KA 3FQNA 5MEOA 1BJ8A 1MCPL 1AO7B 3MRBA 5HVHC 1GGYA 4JN2B 4F7PB 5JORA 5GIRB 2FZ3B 3MBEB 4WHCA 5HI5C 3M1BA 2ARJB 5EOCJ 4MDIA 4WW1A 5BS0B 5F1OB 4KJYA 5EFIA 4I3SL 4MJIB 5F7FA 5I1JH 1DQDL 1RZKH 4L29A 1RUPH 4ZSOB 1JZ3A 1MJUH 3BKCH 3RBSA 3GDBA 1GPOL 5KBNC 3SKUD 2CUIA 5A1AA 1NLDH 2FDBP 4CRPA 3VGGA 5EO1B 2I26N 2SEBB 4MS8C 4BZ2L 3PQYE 4HUWA 3HNTH 1L6XA 4UDTB 1NLBL 4X8JA 2CR3A 3B9DA 1DBAH 3RRQA 1F2XK 3PWVA 1QTYT 2R56H 4G8FA 4TPRH 2BNQD 4C4KT 3MRNB 1MLCA 3X13B 1B6DA 5C08D 2WBJC 4RX4A 4N0YL 3UJTL 3C08H 5DGRA 3BE1L 5I16B 1F58H 1TQCB 1OQOA 1HEZA 5DHYA 3TVMB 1ZT7B 3HC4H 1EO7A 1T0MA 3EYUL 1BZ7A 2LU4A 4QHKJ 4U1NB 5DHVH 2Z9TA 3G5XA 5AEAA 3HAEB 2VXTH 1PLGH 1WVZA 4LIQE 3WE6A 1EPFA 2VOTA 5KSAA 2DYPD 4O51A 5T33H 4LNVA 5H35A 2CDEB 1JNJA 1MCHA 4Y5VB 5I30L 2HTLD 4R4BA 3QDJD 2OTPA 3T1WA 4JFZL 3VFRA 1U3HD 2EH8L 2EE6A 5ANME 2QHRL 3S8WA 1QLEL 4G43A 4MVBD 1T04A 1BVKB 1I7UB 1RJYB 3GUTB 3L5WB 3S88L 4QXWA 1U9KA 12E8L 5C09D 5B38G 1SJEA 3GSOB 3W9EB 1JI1A 5EUKB 4L1HA 2DYPA 3J8F7 4KK8D 2VQTA 3BPNC 1BBJA 2QSTA 1IAII 4LPVA 1U3HA 4QOKA 1FHGA 4U1JB 4WNQB 5C0GB 3MACH 4F3FB 1I8KA 2A1WH 4OCWH 4AEIL 2EDEA 3TPKA 5JW4M 1NGXB 2NZ9C 3P73B 1FE8L 3D39E 2XKNB 3IJYA 5IHZB 3IDXL 1KN4H 3LKOB 4HWBA 5J9PA 4J3VA 2VXVL 5E2TH 3ZSTA 2ZUWA 2XWTA 3PHOB 2EDLA 4I9WE 2VKXA 4OZGF 2Q8AH 4LDEB 2DB8A 3C5SA 3PWNB 3IFNL 3ELAT 1I3UA 1JHLH 1P1ZA 5LBSL 3LQAL 2DWDA 4L8BA 5IB3B 2JB6A 5D6DA 3UPCA 5F7EH 2R0KL 5JO5A 4P2RE 1NGYB 3ZKNC 3QO1B 3KPSD 1P1ZB 3GHBH 1MNUH 5IVXA 3FQWA 3MACL 5JXAH 4XBPA 3QHFH 2KUTA 3VA6A 4HBCL 4XT1C 3P9MA 5GZND 1JP5A 3QSKB 1UH2A 4AIXA 2P7TB 5KAQG 4YX2L 5DJCB 1CBVL 3GHEL 4WHTA 3AU1B 5IEKB 1YMMD 1U8LA 4OCXL 3OX8A 1HN1A 3FHAA 3NOIA 2UWEF 4K9EH 4UINL 1NMCB 4LHUG 4K8RH 4P23B 4HH9A 1XR8A 1IKNA 4XBGA 4OFPA 2OL3H 3GIVA 4DKEL 2P49B 3U46A 1JCKA 1F4HA 3CNKA 3G04B 1FSKC 2MKWA 4PJAB 4XWOD 2E8ZA 4Z7VB 3EW3B 5DJXA 4EVNA 3B8SA 3FRUA 1KJVA 3O41B 5FM5M 4R4FH 2Y06L 4Y19D 3G6DL 5CJQH 3IAGC 4MMZC 5TF1L 5KTEH 3D39D 3H42L 4JDVA 5HSFA 1EHLL 1A02N 3LZFH 2EC9T 1P4LA 1X5YA 2XFXA 3BE1H 1IGYB 4LEOB 4QXUH 3WO4C 4FP8H 4XVJH 1QSFD 4MNHB 1FFPB 3JTSB 5LXGL 3QRFM 1ZGLB 3NTCH 4GRLB 1Y0LA 5ISZA 1KNOB 3VD5A 4LNRB 3E6FA 4ODVL 4ETQA 3HZKB 4NQDB 4UB0H 3CC5B 2HJKA 2A0LD 3O3BA 2H26B 1BZ7B 3IJHA 4HJGB 1ZE3C 2BY1A 5EU4A 3EOYG 2OZ4A 2FD6L 1CD8A 2CIIB 2EDRA 4NQCD 3L5JA 1JTPA 3RY5A 4TSBH 1OGTA 5FYJE 2H8PA 2QLVB 3O6FC 4HD9A 5EU4B 5DMKA 5DRWB 3QI9B 1EGJH 3SPVB 2BOBB 3BP5B 4JM2A 1BFOA 4JZJA 1I7TB 2P5WE 1EXUB 1EEZB 2F74B 4L4TB 1TJIH 3QUZA 4KGLA 1YECH 5HBBA 4GBXC 1BECA 4UU9B 4O00A 5BVPH 5J6GA 4WUUE 1NMBH 3C5ZC 2AV7A 4XP6H 5C0EA 5DSCA 3M8OH 4PRHB 3W0WE 5JNYA 1X5LA 4ZAKA 3LS5L 3ZKQD 4NHCL 4OTXH 1RPQA 1IKFH 3ZE2E 4N0CD 4MNQA 4JM2D 3OKLB 4TNVF 4RISL 1MJJB 4U3XA 1QFOA 3RVUC 3FB7B 1ETZB 1XGRB 1K2DA 1NGWA 5DZNA 1A3LH 4P5TD 2QQKL 1U93A 3BH9A 2Z31B 5EBGA 4GLRI 4NRXB 4HFWB 3DX6B 2EDYA 5F1NA 3C9NB 4BFBD 3ULUC 2VDQH 1AO7D 1RJLB 2B7DT 3BPLC 5ERWB 5T3XD 2B4CH 4JRXA 1A6AA 3SDAC 1P7KA 3PNWA 2BHYA 2WBJD 5IVZB 3P0VL 3HI1B 3QIWD 3ES6B 2C3HA 5JLZA 1S7RA 5JXAL 1EAPB 3LRSB 4Y4FB 3FO0H 4IOIA 1R24B 2ERJB 1OLZA 2WIIB 3TJEH 4NRYA 1FLRH 2YRZA 1KCVH 5T1DH 3UBXA 3ZKMD 4RAVA 3W39B 3GGWB 3QEHA 3DROB 2W9EL 4X6CF 1E28B 4HLJA 1MFCH 5F7YC 3ZZ1A 4HQQL 4GXUM 5KSAD 3ZHLA 1J05B 2YPKB 3LKRB 1IGIH 1U3HC 2BERA 4O58H 3MRDB 1XR9A 3JWOL 3SOBL 5D6CA 2CO7B 5E56A 4JM2F 3QNYB 4H26A 4P3CH 4PV8B 1KLFA 4GS7C 3ZL4H 4MJ5A 5C6TH 1QO3A 4ISVA 4HIEB 2X1OA 4MA7H 5LWYH 3ROOA 2R4RL 3MV9B 3QEUB 5E6IA 1D6VL 3HUJB 5EOQH 3CAFA 3AY4C 1DQTA 3S4SB 2AJSL 3QG7H 1BVLB 1GL4B 5DJDB 5IQ9B 3FRPA 1MI5D 1KB5L 5T3ZH 4JR9H 3SGKA 3B6SB 1IEHA 2Y06H 4HIHA 5IESL 3GBMH 5AUMB 4MCZB 2DLIA 4OLYH 2G2RB 3LRGA 1MRCH 1JV5A 4WHDA 3E2HC 5IHLB 4WU5A 4NRYB 1F6AA 3HZMB 2H3NB 1UJTA 5JW4R 2Z35A 4LSSH 3SOBH 1AKJB 5DUMH 4X9IA 1RVFL 1MWAB 2FD6H 3HUJF 1A6UL 5D1XB 4NPYB 4HDIB 4JRYA 2A1WL 4OCWL 4PJIE 3UTZB 5CEYB 2OK0L 2R1YB 4P4KA 2WMPA 4YFLF 3RZCB 3ARDC 4JLRA 5FYJU 4KAQL 1G9EA 3MGAA 1T1XB 3DSNA 3UDWA 4V2CB 4A6YH 3KGRA 1A6ZB 1WBZB 2NYYD 2BOCB 2PTVA 5M7QA 3EO0B 3IETA 1AXTH 1ZT7A 2PYEE 3CFDA 3IKCB 1MJJA 3SE9L 4G80B 5T1LA 4IJ3C 3NVQA 3NPSB 3PP3H 1IGJA 4NRZA 4DOHB 5KSUA 3I6KB 5LBSH 1KB5B 4J3SA 1YEEL 4HPOH 2RJMA 4FQHA 2J8UA 2W9DH 3RWJB 2G5RA 4LVNB 2B1AH 2YD2A 3LKRA 3GSXA 4OM1L 1QVOB 3EYVA 2ZOKB 5ICYA 2D7MA 3GBNL 4PG2C 3ARZA 5GGVH 4NC2B 4KRLB 3WHXA 1BQLL 4XNMB 4U05A 4FRWA 5EIIB 4KJWC 3HE7D 2R69H 4MNGE 1EJOH 3VXOA 3F58L 1SMOA 1CD9B 4OKDA 3QR2A 2NTFB 4KJWD 3VRLE 4JPWH 1A7BA 1MSPA 5CEZH 3VH8G 3DROA 5KVDH 3FL7A 4L4VD 4L9DA 4YBQD 5I1KL 3BISA 1L9MA 1IGFL 2ZZUT 4HS3B 4PJDA 1OWRM 4OLEA 5FFLA 1BD2A 5IIEB 3MOBH 4UNUA 2HT2D 4N8VG 5IVZA 4CMMA 2J8HA 2QTEA 4PRHE 3MJ7A 2N1KA 4JN1L 1E4KC 2ITDA 4KROD 4ZO6A 3V8CA 1A9BB 3DI2B 1NCAH 1RK1B 3AS1A 1WTLA 3DX6A 2V7HA 2V2XA 3N9GH 5CJ5A 1B4JH 5H37H 1JWSB 3BH9B 1JZ8A 3QI9C 2O93L 1J9CT 4NQCA 3KPQA 3JWOH 4Q58C 1NBZA 1MAML 5IMKA 3MYJB 5C07D 3QO0B 2R8SH 5I17B 2XTJB 4ELMA 1ZHKB 1T22A 4OZ4B 4XNYL 1CL7I 1QD0A 2D31A 1RZGB 5LGKA 4HUUA 3A67L 3IDXH 3VXPB 2IPTH 3VXNA 1UWGH 4I77L 4PD4J 3KLHD 3T0EA 3GK8H 2BY2A 3D3VE 2Y7QB 3MV9E 1RFDH 1A6TB 4P5MB 3ULUL 1YEFH 1A1NA 3LKQB 3G08A 2MCG1 1YQVL 1I1FB 3QPXH 1NFDB 1I7TA 5HI3D 3I9GH 3P77A 3B2UC 5CLWA 3DLQR 3TYGH 3GSNA 1FVCA 4XRCB 3WDJA 1NJ9B 3SE3A 3LKSB 5I8CB 3HE7B 2XT1B 4I18C 3GI8H 5EU6A 2P42B 3UAJC 3NFNA 1A4KB 1T6VN 3DVNA 1QP1A 4NZRH 3UJJL 4YHNA 3STZA 2W0KA 5KSVA 3G5VA 1IM3B 4PBVC 2HFGL 4FZEL 5J1AA 3ARDB 4BSWB 4ZFOB 5F1SA 2KBGA 5HDQH 3PP4L 4FQCL 1WJ3A 1LGVA 1JUFB 3K8MA 3T08A 3D85B 3O8XC 1UCBL 5E94A 3RX8A 4GRLC 4TPRL 2NX5E 5LGJB 1K8IB 4UQ2B 3VFSA 2P8LA 4NUJB 5J3HD 4NO0B 3W11C 3O11A 4JPKH 3B9VA 5LVEA 5JW4N 3AMKA 2B5IB 4JM2C 1IEBA 3W0WA 3GM8A 2YUXA 1MIMH 4GKZA 3I50L 4JZNB 5HHQB 3RL1A 1K8DB 3VGAB 5DJCA 4KRMB 1BIIA 4R6UA 3UJJH 4Q7DA 3VXUE 5CILH 3P4MB 2DQEL 1QSED 3S36X 1BD2B 2OTWB 4P2OD 4M9OA 5SV3A 3IRZA 1UB6A 4RBPK 5DMGC 2VH5H 4R90H 5E99H 3T0AA 1EERB 1RJZA 4MJ2A 3NFPB 5C3LD 1DEEA 2ZUYA 4ZAKC 3VXRE 4Z77B 2EH8H 2P8PB 2XOTA 4X6DF 5CLTA 2R15A 4P9HL 2XZZA 1YPZF 4HAGA 1GXEA 3W0WD 4G8IA 4ZS7L 4MJ5B 2NTFA 4A2LA 1U8JB 1JZ5A 3PABB 1MFAL 5IKCA 3ARDA 3FOMA 4ZO7A 1KYOK 3E2HB 3PWUA 4PJCF 3NN8A 2ZOLB 2AGJL 3D39B 3BSZH 3CUPA 4S1SH 4XP9L 5D5MF 1B0WA 5HHOE 4NQUA 3L6FB 2VL5B 3BQUC 2YRPA 4TTDC 1VA9A 3EGSA 1H3VA 1IAKA 3EYVB 1NGPL 5JUEH 1P4BH 1S9WA 3RTQB 4YDJA 1YEIH 1DL7L 4PTTB 5CBEA 3QJFA 4TUOB 1WCQA 3DURB 2P8MA 3UEZA 1BWMA 5CHNA 3WHE0 2AW2A 4OLYL 4HUKB 3WFBL 4EKXA 2DQFB 4GRMB 2W92A 3GBNH 1FL3B 3AB0B 3PNWB 4R0LB 1EUUA 2VAJA 3LHPH 2I24N 5DMIL 4M4PA 1XF2A 1MY5A 5I0DA 2AQ1A 5IHZA 5JOPD 4R7NB 1MRFL 5E8NB 1T5XB 1YPZA 3FONB 4OZFB 4YC2C 5EIQA 5MI0C 4FQPA 1K5NA 5FEBA 4LSTL 3T4YB 1WIPA 2FGWL 4K7PX 4GG6E 3RX5A 4ENEC 4WWKA 1IGTB 4M7KL 4OAWA 4MXWH 4XP9H 3GZKA 4XMLH 4Z95H 1T22B 5D8JH 4PLNC 2HFFA 3EFFB 5GGTH 4AEEA 1PKQE 4ZUWB 5F70A 3WIHH 3HRZA 5FYLD 4LCWB 3PV6B 2OS7A 3P0YH 4OIBA 2IAMA 3WLBA 5I76B 5ETUB 2E8YA 2YHGA 1XF3B 4JFEE 1KJ2A 1U3YA 4H5SA 3PUCA 1XF4A 5DSCB 1F3JA 4MX7A 5DA0B 3WUWG 1CFVH 3QUKA 1TZGH 2DAVA 4WW2F 5FO9A 1YY8A 3BGFC 3MOAH 3OXSA 3EJJX 4JM4L 4J23A 4H5SB 4KY1L 1YEEH 4IRSA 1U8OA 2HMID 3VH8B 5DJ6A 3MZGB 3CFEB 2YPVL 3N9GL 5D1QB 1MELA 4LHUB 2AJ3A 2VN7A 3HE7A 2CUHA 1YA5A 3QXVA 4O2EA 1VACA 1ZHKA 3VFSB 5BV7L 1LE5A 4YDLB 1ZHBA 2IH1A 5IQ9A 3UCRA 5F6HJ 1K2DB 2WQRA 1MJ8H 1PLGL 4MJID 3S4SA 4PP1D 2EYRB 1S7QA 2IAMC 4KVNH 4WFED 3H7BB 1R3IH 2F8XC 4ZXBA 1H3PL 2HT3D 2FGZA 5I66A 4P5MA 3IJHB 1BF2A 2XY1A 4M8QA 3CC5A 3GMQA 4H20L 4RDQF 5J4MA 1DN0B 2RBLA 1AXSB 1YZZA 4NUGH 5HVWA 3PV7A 4XH2B 3CDFA 4U1MB 12E8H 4JZOA 5CJ8A 4YIQA 4JQVA 4GW5A 4N8VB 5BO1H 2C3VB 3A6BL 3UJIH 1CIDA 2PYFB 2P5EA 3QI9D 2DJUA 3CDGB 4FABL 1HYSD 1CXFA 1IGYA 4MJIA 5I8CA 4H1LG 4RAVB 3WO3B 3DVGA 1JHTB 3O3UN 3BP5A 4ZOEA 3MCKB 4WWID 4M7ZB 3VFTB 4YHML 2EE2A 3VWJD 2W9LA 4DUXA 4OUUB 2APXA 5ESAB 1A1MA 4ONHB 5D1QA 5EB9A 1P6AB 4NOFA 3R8BB 4APQD 5FB8B 3BIKB 4LVOC 2UV3A 4K3GA 4LSQH 2E9JA 2H32B 2CKNA 3HNSL 3BP4A 2QQLL 1EGJL 5GGRB 4KROB 4OGYL 4RAUA 3ULUF 2Q87A 1J1OL 5EOTB 4DK6A 1HH9B 1U36A 5ESVA 3NIFF 3QUZC 5IBTL 2MHAA 3P11L 3T1FA 3L7FB 5KSBE 1J1XL 5AAWA 1R3HB 3MLPA 4UTBH 4P59L 3LKNB 4KU1A 4K7PY 4BKLA 4AT6A 2RQ8A 2ZUQB 2VL5A 1N6QH 4YHMH 2H3NA 1CE6A 4WV1C 3V0VB 4RZCA 5IB1A 2EH7H 1NEUA 2LU7A 1XGTB 2G2RA 3LHPL 5ICXA 4XAWH 1EX0A 2H2SD 3WBDA 3MLUL 5L7XL 3OB0K 4Y4HB 4CVZA 2OTUB 4R0LC 4YXKL 4HG4J 4GRMA 2VLJD 2C5DC 5BS0D 1KCSH 3PQYA 2NPLX 3O8XB 4JRYB 1HNGA 2WP3O 1H0DB 4OZFG 1AI1H 4AMKH 3C8KB 5EU3B 1MY7A 5DMKB 1E4WH 4PRNB 4HZLA 4RGND 4KJPD 1AR1C 4LLDB 2OL3L 1IC4L 1BQSA 4BSWA 3EYOB 5C71A 5J1AB 3L3OA 1YEKL 2DWEA 2VZTA 5CGTA 3RBGA 5MP6L 1JNNL 2VDOL 2I07B 1MCLA 1AR1D 3STZB 4P9HC 3PWPE 1N7ML 2D9CA 4NP4L 4EXKA 4GAGL 4WRLA 5DURB 2VDPH 2R0ZH 3U82B 3LPGA 1JFQL 5T3XL 2D0GA 1JPSH 3W81A 3V5KA 5TE6H 2WWMC 1K4DB 2GJ6A 4EI6B 5HGBA 5IF0A 4NNPH 1MRDH 4KY1H 5GGUB 3PWLB 1ACYL 3I02B 4HKXB 4KI1A 2D4FA 1FFOB 3T2NL 5IVNA 5HGDA 5EUKA 4PGDA 2AK4B 2EXWC 1F13A 5HHMD 1MIEL 5CD3B 1KV3A 5C09A 4BFIA 1GGBH 1PEZA 3HZMA 3IDYB 3V5KB 3VMPA 3GI9L 4NM4L 3TO4D 1VEOA 1MJ8L 4JGJA 4W4OC 2XA8L 4J3UA 5HI5D 2VH5L 4R90L 3VG9C 3BQUD 5IVOA 1G9ML 2NX5D 3LKNA 3WHE1 3G9VA 4DZBB 32C2A 3GMRB 1RUML 2BNRA 5LCVH 3OBAA 3GSQA 3N1FC 3T2PA 3DRQB 3TVMA 2PO6B 1EAPA 2QV2A 4F9LA 1X5ZA 5BOZG 5L9DL 2VWEE 3NCBB 2I25N 3R06A 3QNYA 3LEYH 5IMLA 3F65A 2Z35B 2COQA 1A6WH 1D5MA 3NGBC 4J6RH 4YHNB 3QUYB 4YGVA 4Z7UE 1KFAH 3C8DA 5MENA 5DK2A 1JNLL 1U8KB 3ETBF 2X7LA 4JFYA 1RIHH 2EIEA 1XGUA 5IK3B 3LEXA 5C0AA 3KPSA 4LLUB 1PYWA 5IBLC 1NCWH 2EDXA 5KS9B 1OD7A 1UYWL 3O0RH 2D7TH 4G3YH 4N8VA 4PJFF 5F7KC 4KVNL 1U6AH 1FNGA 1S7VB 4HWZA 4HS6A 3K80A 3BGFB 1A1NB 3RNKA 3KHOA 3HB3C 4JDTH 5KSVB 2UYLA 4I3RH 4S2SA 4Z7WB 4JR9L 4OZHE 5HHNA 2BVYA 4NC0B 1JGVH 4G8FB 4TVPD 4QCIA 4N0UB 5I71C 4GT7A 5D2NB 4KDVA 4PJGE 4XNXL 2EH7L 4AL8L 1CVRA 4IRJA 4L4VB 1DLFL 2Y6SD 2VE6A 4LF3B 1WFTA 3QHZH 1R5VA 1Q1JH 1EEYB 3LV3B 4LVHB 3UTOA 1MFCL 1OGAB 3L7EA 1P69B 3FFCA 5BW7C 1U8OB 5EOCL 2R69L 1ZEAH 4U33A 4YGVB 1RUAH 4HPYL 1YY8B 3D39A 2IALA 4M6ML 5C0AE 3TF7C 2A6DA 4YHZL 4WHYG 4NWTH 3NCYP 2VZSA 3MBXH 3BPCA 4I4WB 4NP4H 1J8KA 3O4LD 5CSGA 2EDDA 5F3BA 3UX9B 1AE6H 1T89A 1UA6L 3GSXB 4YNYB 1MPAL 4WDIA 3LH2L 4KVCL 4PBXA 4AL8H 2P5ED 1JFQH 2AXGA 5T3XH 4U1IA 5GGQH 4OCRH 4IOFC 2H8PB 2E9WA 3MOQA 4PRPE 3U7WL 4JQIH 4Z7UA 5D7KE 4YEFA 1FCGA 1NCDH 3WS3A 2ZSWA 2CIKA 5FGBA 1FIGH 3W5MA 4ODWA 5GS2H 3TV3H 4XAWL 1N59B 2J7LA 4HLZH 2CRYA 1QBMH 5GS0L 1AHWA 1MCWM 2PYEB 3WUWA 3OKKA 3QUZD 3UTTD 2QSVA 1HCFX 2MPAL 1JGUL 2V2WB 3PV6A 2IFFL 3B83A 1TXKA 3OAYK 5F96H 5FO8A 5DQ9B 4JHAH 4YZFE 3MV9A 5FKPA 2MWCA 1YJDH 3RVVD 1OARH 2FJFA 3OXRB 4LARH 2OSLB 4OCRL 4PV9A 5EC1A 1X5FA 3TBYA 1IM3A 3DRTA 2BNUA 2XA3A 5J12C 4XP5L 2DJ4A 3IU3A 2FNBA 3S88H 4H25A 2O5YL 2RIKA 3FOMB 1J05A 5L9DH 3U46B 4E41E 5FYKH 2JK5B 3PWLA 4NQDA 1A6ZA 1WBZA 5CGYC 3RZCD 5BQ7A 1Z9LA 1ZOXA 4OV5A 3QDMD 4WFEE 4GKNA 2YK1H 3GSRB 4XXCC 3CK0H 5GRUH 3SEPA 2P8MB 1IM9D 1EZVX 1J5OH 3PXJA 3LRSA 5I18H 1Q0XH 2RHEA 3P30H 2P24B 3TN0D 2N56A 2A9NL 4APQB 1XH3B 2XNAB 4JHWL 2ADIB 4KJPC 5KJRH 3RGVD 3TN0C 3IFLL 2VAAB 4C57C 1G84A 3HCVA 2DM2A 1F4XL 1TNNA 2C26A 1MREH 5E2VH 1WK0A 2DQDH 4NSKB 4LAQH 1M7DA 3D0LB 2NLJB 3O8XA 3VXPA 1BFTA 2VN4A 5HHOB 3S35L 4QOKB 3TT3H 3MRHA 3N1MC 3WFHA 4JFFB 1LDSA 1YNLL 1QLFA 2K3TA 5IV2A 2LAAA 1T7ZA 1OF2B 4JB9L 1CU4L 1EIBA 3GSVA 3L3HA 1IC4H 3FO2B 5L2JA 5IEHB 4GMTH 5HVHB 4MNQB 1J0JA 3MLWL 5E8OA 3RWDB 3SKOA 4XX1E 3AXLA 4LRNL 3V0WH 5L8KB 1A1OA 3TNNB 1P4IH 1QKZL 5JIHA 3H9SB 4JCLA 4HAFA 2Z8RA 4YX2H 4P2QB 1OD9A 5D7LE 5DR5L 5FA3A 1A7QL 4HKXA 3N1QC 3TBSA 4Z7WF 4MCZA 1A4KA 1OAYH 1I8IB 5C07E 1F90H 4OCXH 4R4BB 3B43A 5SWSE 1CFTB 2WBWB 1N0XH 4RAUB 1A7OL 3WE6B 4BA8A 1XAUA 4RWYL 1LQSR 3ULSA 3CH1B 1D5XB 2NY3D 1B9ZA 1R24A 3IGAB 1SJEB 3F7YB 3TBTA 3QCUL 1WZ1H 1HHGA 1MJUL 1P7QB 3BKCL 3RVXD 2W60B 3DWTA 1U8NB 1KF9B 2XN9D 1KPVB 3C5ZA 3U7WH 1RHHB 3RVXC 4I3RL 1J88A 4M8QB 4CDHA 3CDGA 4N68A 5INCA 2MNUA 2A74A 4M1CC 2R23A 3CFCL 4KUCF 1WV7T 4U1JA 4UT7H 2VLRE 3QEGH 3MLVH 1LK3L 4GUPB 1LO3H 1UWEH 4XPFL 4XXDB 4BUGA 1YJDC 5CZVL 1N0XL 2O26U 4YHIA 3WSQL 1U8NA 3ZKMC 2KPNA 1I9IL 4D0CB 3HC3H 1TCMA 2IFFH 5F96L 5IR1A 2PYED 5IFHL 1NUGA 5JPNB 4LFHG 3CSPA 4RA0C 3MV11 1WBYB 4XCCL 3CH1A 3EYSH 3VU2A 1VACB 2DD8H 4KTDH 4PR5A 1OAUL 2X4RB 2UUDH 4LHUA 4R4NC 4WJ5B 3MLYH 3BPNB 4Y5VA 4HGKC 1ORSA 4KMQA 1LO2L 5C2BL 3L3JB 1CE1L 1I7RA 1NPUA 5J6HA 4X6DE 1I3VA 4K3EH 5JPNA 2H45A 4GAFB 4NQCB 1BZ9B 5C0BE 1OGTB 3CLEH 5D72H 2YD7A 5JNYB 15C8H 3QXWA 2YK1L 1BOYA 3KVQA 2CIIA 3ARBC 4F7MB 1I9JL 1QUNA 3R4DA 3H9SE 4FFZL 2NQCA 2VC2L 1UM5H 5KJRL 2PYFA 4B7IA 2C3XA 2DWDB 2F74A 1F4XH 1JBJA 3ZKXB 2WK2A 1AQKL 5KSBA 4HH9B 3SQOH 4JVUA 4X4YA 4Z7VE 2LABA 3LSOB 1F4YL 3ALWA 3ARGC 3LQZA 1S78D 4GBXB 4WU7B 3HCVB 1KN4L 3H9SA 4ZPTA 2X1QA 2XWTB 4Z7NE 5E2WH 1CLZL 1QSVA 5I73C 3UO1L 3SDYH 2ESVD 3ARED 3PGCA 3VWKB 1E4KA 3Q1SH 3KYMA 4NM8L 4XP5H 5DUPL 4ZDHA 3UYRL 1KT2A 5DD0L 3QXDA 4U7MA 3V52H 5EUOB 3V5HB 2LVCA 1TITA 4EUPG 3KDMB 2NY6D 4KMTL 1KTDA 4LHQB 4L8DB 5LCVL 2IBZX 4OF6A 3AVEA 3IAPA 1INEH 2YA1A 1GC1C 2NY6C 5C70A 1YY9D 4MNHA 3VDCA 1AY1H 3LZFL 5T1KD 4MQ7B 4JHZA 4JQIL 5H37G 3T8XA 1A0QL 3QQNA 2FWOB 3WFBH 3D5OF 3WIFA 1OPGL 4DCQA 2E7HA 2Y07L 2WIMA 3D3VB 4LGRB 4OF7A 4BJLA 4F57H 1I8MA 1FL6B 1AKJA 1FBIH 2NY7L 1BQHA 1RD6A 5CP7B 3MV9D 4JO4H 3KPRD 5E6YA 3SJVB 5BV7C 4F9PA 1P5UA 1I1AC 3N1PC 4K23H 2WUCL 1HOCA 5EOQL 5D70H 1TJHL 3ORJA 4YGAB 1QLFB 4X7DC 1UWXH 2R4RH 4ZPTB 3GIVB 1XGPB 3L95B 1F4WH 1HNFA 2A83A 3BKJH 4S1QL 1CG9B 2AJUL 4NHUA 3RZCA 3NPSC 4H20H 3L3GB 3QRGH 2BNUB 1A14L 2XZCH 4KH2A 2YXMA 3MLVL 2OR8A 1WIUA 3FQXA 2KKQA 4ZS6D 5SWZA 4EDWL 4ZAKB 4PRIA 2ED9A 2BMKA 5FYKL 3T0WA 1DE4B 4N1EA 1KYOJ 3FT4B 5HYSB 4WO4B 5F9AC 1YQ2A 3OR6B 3DSFH 1S7WA 4KQ4L 1ZGLM 2PKDA 1OSPL 2QKIA 3OGCB 3H3BC 1C5DB 1FC1A 4HCRL 4MB3A 4I3SH 1OTTC 1W72A 3I6GB 2B39A 3NCCB 5IB3A 3U83A 2NX5B 5IBUG 1MFBL 3H9ZA 4QTHB 1E4WL 1U95A 2VZ1A 5KSAB 1YC8A 1L9NA 1S9YA 1A3LL 1YNTA 4NDMB 4M1DL 4XC3H 3ET9F 3BRGC 3PDGA 4LCIH 4RRPG 4KK5D 1CGSL 2HWZH 3WXWL 3RIAF 1ZK9A 3O3AB 4PRBB 4K8RL 2DTMH 4JDZA 4KK5C 1ZT4A 4D0DB 5D7SL 2RCSH 2CRIA 5AWNL 4LCCA 5F7DA 1I7UA 1RJYA 2WINA 3GUTA 4RDQG 3WIIL 5SX5K 2YSSB 3RU8L 3QDJE 5F93C 1AP2B 4PB0L 3FQRB 3QT2A 1LO0L 2GJJA 1YEHH 1YECL 2JE8A 1YNKH 3TA3B 3H3KA 4AJ0A 5K9JL 3WV0A 1IGCL 2HVKB 3RVUD 3OG6B 1DN2A 3HKFA 1A9EA 1QKZH 1KENL 5HPMB 2FIKA 2Q1EA 5GRVL 3OGOE 3HC3L 5B3JF 3OKNA 4O5LH 1KGCD 2CGRL 1OP3K 3U4EA 2HYMA 1RK1A 1GSMA 2BNQB 4UILL 5FK9A 3T0EC 4EI5D 3BRDA 2FJHA 1U0QA 5HD8C 5E2WL 4P4RB 4OZHA 3EYSL 2J3SA 4HUXB 4N0RA 1ED3B 3BDBA 2DQTL 3VMNA 5F3BB 2ERJC 4OLWH 4ODHL 3GNMH 4I4WA 2R1WA 4LLVA 3JWDL 4Y8AA 1W72L 5DK2B 3MLYL 4NRXA 1NAMH 4GRLD 4Z5RA 4BQ8A 3SCMB 4X7CC 2WINB 4H1LA 1QSFE 1UB5B 3SE3C 4XPTL 1OTSD 1ZT4B 4D0DA 3K81A 2QADC 4DZ8A 5BOPA 4RMWA 4JG0H 3B3IB 1FNGB 3ILQC 1S5HB 4LOUC 4F2MA 3DV6B 3LKSA 1INDH 2CLZA 1MLCB 4JN1H 4R7DB 4UBDD 1E0OB 3WNKA 4MSWB 2HH0L 4FQIH 4OFIA 4S10A 2W0FB 2W9EH 5EPMB 1PVHA 3T0VA 1FE8H 4Z7QF 1JF5A 1LO3L 1SBSL 3QXTA 5KVEH 3X14A 3MCLL 2APFA 4QRUA 2XG5A 1RVFH 4L3EA 2EEBA 4NM4H 3G6JB 4M00A 2SEBA 4U1MA 2XWJA 1S3KH 2VZOA 3QIUA 4MYWB 3WDHA 1R5WB 1KTKE 5ENWA 4XB8A 3OZ9L 5I1CH 5EC2B 4YO0B 1DE4A 1ZA6B 5EH1A 4FFYH 2F15A 3BESR 4LPXA 1G9MC 2NY1D 3OV6A 1P84K 3AS3A 1ZS8B 2AK4A 5FOBA 2GY7B 3OAUH 2D9QB 4OV6F 5HVFB 4TULH 5C0JB 1KB5H 3KPQB 1JPSL 1LO2H 5C2BH 2PTTB 5INDB 4Z7VF 4G6AD 4TTGA 2R0WH 2RB8A 2X44D 3V4UL 4HBCH 1KCUL 5BW7A 3ILPA 4U0RB 3DJ9A 2ED8A 5F9WC 4TUKL 3JTSA 4MB5A 3BGMA 3TCLB 3DXAB 1CXHA 1AJ7L 1FYTB 2Z8SA 2DKSA 3BXNB 3R0NA 4OM1H 2B2XL 4HXBL 4AK1A 1L0YA 1WCBB 3VCLB 4PRDA 3PWPD 3X3GH 5A2JH 1UGNA 4G6ML 2MOVA 2AK4D 1I9RH 2EDWA 3I3EA 3DRQA 1R3LA 2J8OA 4L8SB 2BVQA 1H3WM 2ESVA 3C6SA 5GISL 4G9FD 4ZNCD 1ZT1B 4YFDB 1K3IA 3TLRA 1T21A 3U4BL 5H2BA 1ONQA 2OJEA 1R3KB 1TQCC 1LO4L 3D6GA 5F6IC 1JZ6A 4U6TA 4PJXE 4Y4HC 4HCRA 4YXLL 3GMNA 3MV7B 1LNUB 2CKBH 1OT2A 2ZCHH 1D6VH 1VFMA 1VCAA 3PG2A 5CCKL 1A14H 1DQLL 1HEZB 5DHYB 1BOGB 3NA4A 1I4FB 1I3GL 4G6JL 1T20A 4P59H 2KQNA 3H9HA 1JHKL 3FFDB 4JFDD 4Q9RL 4M8VA 3O6MH 3LEYL 1QACA 2LTQB 1D3CA 3TZVB 4H26B 3P73A 1A2YB 5ELIA 1TENA 3QJFB 5K9QI 4FQHB 2CLVB 1Z3GH 5BMFH 1B4JL 3NZHH 1L0QA 4LP5A 1KCRL 4NFDA 4LU5L 4X7TB 4JFFD 4WDIB 4NKMA 2HLAB 2B8OT 3KPNA 4D9LL 1DTUA 1VHPA 3MJ9H 4TVPH 1GOHA 2F5BL 2NY7H 4DKDC 5H94A 3QULB 1NCWL 3FB8B 4R3SB 1A4JA 4F7MA 3W9EA 3PWUB 4XAKD 4W68A 4P46C 3T0BA 5EC1B 5IJVA 4ETYA 1YDPB 5E8DL 3C8KA 5SWSB 1BVKA 1GIGL 1X5JA 1P7KB 1TJIL 4K55A 1BREA 2FEEI 3Q5YA 3P40A 4YE4L 3Q48A 4A6YL 1RUQL 5HYFA 4S1QH 2FIKB 4DGVH 1INDL 2FBOJ 4IOIB 1CIUA 1YQVH 3WUWB 2NY3B 4ODTL 4B41A 3QUXC 3THML 3ZDXE 4Y2DA 5BVJA 1TVBA 1NFDF 4BSVB 3WEXA 3BP6A 3BH8A 4WFHE 5FHBH 1UC6A 4Q6YA 3SY0A 3QFJE 3VFVA 1DLHB 1HXYB 3BKYH 3BP7B 4MQTB 5EWIL 1MWAH 1MQ8A 2GJ6E 4NQXA 3F7PC 2HVJA 5HDBE 1T5WA 1MAKA 1BGXH 4D0CA 2ZSVA 1XMWA 1IQDB 1A7NH 3JV5A 4YAQB 3MO1B 4NQTA 4NWTL 4G9FB 3QQ4A 5FF6B 3SDCA 5B39A 4YHPA 3V6ZB 5DA4A 3S9DB 1LE5B 3HUJA 3CPLB 4Q2ZA 5ITFB 2OQJA 1FN4A 5ALCH 3KPPA 4UUJA 2AJYL 3MRMB 5JHDD 4PJBB 2Q8AL 1JMZA 2PXYA 1BHGA 5EORH 3E3QE 1MHEA 3FKUS 1KJMA 4E5XB 2ICWB 3NABL 4LRIC 1ORQB 4JFYB 1WAAE 3SE4A 3RWEB 3ULUH 4OLUH 3RWHA 4U3CA 1VPOH 4GLRH 1JPTH 1T0MB 5GS3A 7CGTA 4W4OA 5FM5O 3U1SL 2J2ZA 2W65B 2YN5A 1NCDL 3D9AH 2CKBB 3SDCD 1H9VA 1OL0A 3UTSE 3E0GA 1EFQA 1UACL 3E6HA 2AABH 3KS0H 3SDCC 5FIEA 1ZHBB 3VXMB 1WZLA 1G7PB 5DRWA 1T1YB 4WTXA 1IGCH 3G9AB 4HS8H 1F3DH 1CS6A 4AM0B 4E41A 5C9KA 5EBWB 2Y07H 4OF8A 4F9LC 35C8H 4JDVB 5ISZE 1A1OB 3TNNA 1FNEB 3D69A 3BZEA 4LCWD 2Z93B 3CU7A 3HN3A 2FYYA 2CJUH 4BZ1L 4Y1AA 5JMRA 4JO2L 3G6AB 4PLJC 3O2VL 4LDLB 4LKXB 3GRWH 2NR6D 4YDJB 1OAQL 1I3GH 5EU7C 5EDXA 3TBWA 1C8PA 1KCUH 1NGZA 3MLZL 3SO3B 3MSPA 1CDIA 2X1XR 1KJVB 1ZV5A 4KTEL 3CK0L 3IFPA 5GRUL 3U0TA 2I9TB 4OZFA 2GJ6B 5HGBB 4NNYA 4PB9L 3RKPA 3S5LA 1GC1H 3IRPX 2R9HC 1DLFH 2A73B 2APTA 4WHTB 3TO4C 1ZTXL 3F8UB 4EI5B 5DC4B 4V1DB 4YPGB 3RWCA 3CVHL 3UTPE 4ZQKA 5CD5D 5E99L 4JZJB 4OGYH 4R2GD 1MRFH 3GI8L 2VRAA 1GGIL 4WUKL 1T0NA 1BZQK 2XZQH 4OCMC 2Z91A 4ZUWA 4GAJL 5IBTH 1P5VA 4PLKD 1RJCA 1WGOA 3P11H 2HFFB 3EFFA 4LSTH 3BEWB 1KJ3L 5FXCH 1A5FH 1U8HA 2NW2B 5EBLA 2X4QB 4PLKC 5F7NC 5F1IA 1GIGH 5EBMB 4TVSa 3TZVA 1MCWW 2XTLA 1CU4H 4KKCC 3GMLA 5T3ZL 2G60H 2G5BB 4C56E 1RZ8B 1F2QA 4JFQB 1G0XA 5KZCD 1XIWA 4R4FL 2B1HH 3L3IB 2VITA 4I48B 3WNOA 1Y0LB 4Z9KB 1G6RB 5C8JA 4JFQA 4M3JA 1D9KC 1P4BL 2C9AA 3BOVA 4L8BB 4CU7A 3I84A 1OP5K 4O2CB 4M7LH 1FFOA 2IQ9L 3BUYA 5E8EA 3T65A 3LQMA 4GKOA 4WW2B 2ATPB 4A6YB 1EMTL 3PJSA 2YPLE 3B9EA 1IKFL 4KI5D 4PS4L 4J7RA 2FX8H 3BIBX 1CXKA 4YDKL 1I7RB 5J6HB 2GT9B 4LLMB 1DFBH 4JFPB 4XP1H 2DF3A 2CUMA 2DI7A 1LMKA 2JELL 4KK6D 2PW2B 3OKDA 3DYPA 1FQ9C 5FM8A 1T6WA 3TO2B 2XN9E 1MLBB 1R3JA 1FNLA 1NDGB 1R3IL 4W81A 2AJZA 1A7RH 4KKAC 1E27B 3MXWH 2XRAL 5MP6H 4ODUB 4GSDH 4FFWD 2WBKA 1TJGL 2MTPA 3SDXB 4JO1H 3OHXA 4BH8A 2GT9A 3PGFH 5EZOL 3ZE0F 1E6JH