2A6KB

Crystal structure analysis of the germline antibody 36-65 fab in complex with the dodecapeptide slgdnltnhnlr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
222
structure length
218
Chain Sequence
b'EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSVYYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Germline antibody 36-65 Fab light chain
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
molecule tags Immune system
total genus 36
structure length 218
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6kB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6kB02
3HPLA 3ULVH 3N9GL 3MV9A 1RUKL 1VGEL 2FB4H 2QLVB 3SJVE 1A6TB 4PS4H 4LARH 4OF0A 5DJ8B 3QNXA 1QSFA 3O6FA 5TF0A 3WIFB 5KZCB 4ZFOL 4F37K 3F58H 2WBJD 3QBTB 1RVFL 4QTHA 3LH2H 5F9JB 1ZLVK 2F19H 3U46B 5AAMA 5C8JB 2I9TB 1KN2H 2EDKA 5IWLA 1UVQB 2O5ZL 4JGUA 3CH8A 4UTBH 4GQ9L 1NKRA 2FEEL 4JDTH 1UJTA 2I24N 4X7FC 5BZDB 2R23A 3V4UL 4D9LL 1MCOL 3O9WA 2XNAB 2XRAL 2XOTA 3CFBA 4K8RL 3H8NA 4MWFA 4PLOB 2WW8A 3TA3A 1QUNA 4U6TA 2EIZA 1A14L 5A3IC 4KHTL 3EHBC 2E6JA 1CFVH 4HEME 1EHAA 1BZ9B 2DQHH 4PREB 2ICEB 1HK6A 2VWEE 4PJHB 3ZE2E 4U05A 3F7VB 3PWUA 3UTSA 3LVEA 5FDWB 5LG1A 2NX5E 4HX1B 3WNKA 5MEOB 3C6SA 4OF3A 4S1QL 4XPFL 1IC4L 3L3HA 4KQ4L 1IGIH 5F72S 4PJAB 3MODH 1JYXA 2IF7A 3ARGD 3PWPE 4HWBA 3FQTA 2JJUA 1F5WA 3OJDA 1TFHA 4DVRL 1ZVYA 3NABH 1X5IA 2CSPA 3CLEH 1TETL 4LEOB 4LASH 4M43H 3C09C 3B2UC 1WZ1H 5L88L 4M1DH 4QWWC 3LS4H 3GRWL 43C9B 3B9VA 2H6PA 4R8WH 1F90H 4R4FL 3EZ8A 4PRBB 5E8EB 1DJSA 4ZPVB 4KGLA 5JLZB 4MA7L 4H88L 5IVXE 5C0AB 4X9IA 2XZCL 5IW1A 1BQHG 4POUB 3MLRH 5T1KA 2I26N 1PYWA 3VMNA 5GGQL 3DYPA 1IEAB 2XN9A 4Z0XA 2GTWA 5IM7B 3JVGA 1ZMYA 5FGBA 3VFNA 2RQ8A 4F7TA 3MZTA 3H2WA 5FUCE 2CRMA 5JMRA 4L4VB 3QFJE 2XZZA 3CX5K 2CR3A 1IGJA 3RZCB 4LLAA 1RD6A 2Y25A 2XWJA 3HI5H 3M8OL 3S3SA 3QAZC 2VDQL 3HRZA 4FXKA 1I7RA 2HVJB 1RJZB 2FR4B 4FN0A 3Q3GA 3DVNB 4Q6YA 1WC7A 3QQ9D 4BFIA 3QIBD 3TFKC 1CR9H 3HZMB 4JPWH 1NBQA 1AFVL 1V7ML 3KHQA 4KZEH 1ZT4A 2C1OA 4IRJC 3X12B 1LP9B 1MFEL 2CDGB 3KPTA 1A9BA 3H9HB 4HEPG 4QO1A 1NGPL 4L3ED 4S1DC 3T4AA 2V9TA 3Q6GL 5JDJA 1FJ1A 5I8OL 4ZO8A 3RY6A 3MCG1 5L2JB 4G8GB 1LE5A 1EAPA 3C6LC 4MDJB 4WHTB 1F13A 3CSPA 4N9OB 3GSOA 3O6KL 5IW6B 5I16B 4KPHH 4CU7A 4Z7QE 5DQ9A 1FL3B 1TZIA 2BOBA 2J3SA 5J1AB 5DDHB 1XF1A 3K0WA 3WIHA 4D9RE 3FFDA 1BGXH 5IHUL 3N1FC 1ZT1A 3O3EB 5INCA 2ZG2A 1Q0XH 3UTQA 1OY3B 2QQLL 1LWRA 4WV1C 1A64A 5GIRB 2BJML 2CIKB 4OCXH 5CEXA 3GSNA 4GRWB 2HAZA 1E28B 4Q0XH 4TVPH 5DJAB 1DQML 2HRPH 3QHFL 5BQ7B 3G6DL 4M6NL 4OM1H 1A7PL 1UQSA 3CLFH 4Q6IA 3B2VL 4XMKH 1KTLA 5C6PB 2VLLA 3UJIL 1D9KB 3HLAA 4H8WL 3OXSA 3STBA 3WSQH 3RIAF 4WI3A 2FH6A 3LS5H 4KUCF 4L29A 1YNTB 3UZEA 4FQJH 3TM6A 1L7TL 5DTFA 5IT2H 4F2MB 4OLYL 2OCFD 3DV6A 1AGCB 4TULL 2MNUA 5CKAA 3L7FA 1U3JA 2QHRH 1ZHLA 2LVCA 3SCMA 5LBSL 4JN1H 3V5KB 1S7QA 2IAMD 4Y1AD 1OT1A 3KNBA 3L95A 1L6XA 1WICA 4DEPB 2C3GA 1ZT7A 5J6HB 1FDLH 4KJQC 3GMRA 4FXGB 4JQXA 3I2CL 4LCUB 3KPQB 3HZVB 4DUWA 3OAUH 1GPOH 3OKNB 3UX9B 4P2QE 1X5GA 3VRLE 1M7IA 4LSVL 2OS7A 3P3YA 4LSTH 1KB9K 5BVJB 3REWA 3BI9X 3VXMB 4RZCB 5CP7B 4PJBE 3W5NA 3VFRB 5B21A 1MWAH 5K9QG 1FCCA 5EU5A 1L0YA 1MRCL 4KROC 4F7PA 3T1WA 4G9FE 1TMCB 2OBGA 1JBJA 3QHZL 4OZIE 2XA3A 4MGXA 3SPVB 3ULVF 1OOAA 3EO0A 5DA0B 5D2NB 1CN4A 4XCFL 5LCVH 4OZ4B 2VLJA 4L3AA 3GIZH 3HNSL 1RIVH 4X9GA 4ODSL 2NY1C 2K1MA 1DQJA 2VDML 1PZ5A 2VQ1A 4GKZB 4LLVA 3TN0B 5DI8B 4JFYA 3HAEG 2KBGA 1AO7D 4DK3A 1C08B 3DTXB 1IL1B 1R5WB 4WFHE 1JFQH 4X7SL 4PJ8B 4R9HA 2EIDA 4FQQA 3KDMB 4HULB 5IOPB 2EH8L 3MR9B 3G9VA 2DYPB 1Q9OB 2YUXA 1RZFL 3T0EE 1C12B 3GBMH 1JGDA 2VABB 3I3BA 4XVSH 4NNXB 5DJCB 4S2SA 4X6EB 1DL7H 4NPYA 3CDGA 2P5WE 1NCBH 5DT1H 4J1UB 4Q97A 3MNVA 1QKZL 4YHKL 5CD5D 5IFHL 3ZE0E 5DK2B 2JIXB 3OAYK 4YZFE 1U8QA 1VFAB 3L3GA 5FAAA 5TQ0L 1QNZH 4X99A 1KOAA 3UTTD 3DX8A 2XQBL 3C60A 4G6JL 4CMMA 3RY5A 4BKLA 1KJVB 3BEWB 4NOBA 3IJHB 3JUZA 2EXWC 5EZJA 3GJEA 3FB5B 1LO0H 4NQDB 2E3VA 4R96A 1MF2L 3VFPB 2VXUL 1U36A 4HKZB 4CBPA 1VCAA 3MJ6A 4OCSL 4LIQH 3OKLA 1Y6NR 4OM0L 4C4KT 3QDAA 1K3ZA 4HLZG 4NQTA 3QULB 1P9MC 5F7NC 4EBQL 3L1OH 4NO2B 4X6DF 2I9LB 1VDGA 3NN8B 1N4XH 4HSQA 4KZDH 5EORH 3RPIB 1S5HA 3PV7A 4EI6A 2SEBA 4E0RA 1A6VL 4X7TA 4E41A 1T66D 3GSVB 3TO2B 4AY0A 4MD5B 5FIEA 5BMFL 4FQPA 1P7QD 3G6JA 5DQJB 3NACL 2H32B 2Z35B 5E00A 4ZUWA 3QXVA 4LRNH 2GK2A 3QI9C 4LSPH 2FZ3A 5GGTL 1T22A 1ONQA 4S0SD 3V0AC 4L8DB 1G9ML 3HR5B 4ZO6A 4PTUB 4XXDB 5ICZB 1XF3A 5D71H 4FTVD 3KWWB 2CJUL 1HNGA 3G5XA 3CK0H 3K74B 2FBJL 2VXQL 5IQ9B 1D3CA 1JTTA 1TXKA 1RJYB 1QBBA 2DLFL 2QR0B 1RZ8B 1F3JA 3KYNB 4PGZA 4UU9A 1G7IB 1U92B 4RGNB 3C5JB 4LPVA 1U2CA 4PY8J 4X6CB 4Y2DD 1HOCA 1XGYH 5IBUG 3BUTA 3D39A 1N64L 2D0HA 3PJSB 5C09E 3LMJL 1QRKA 4HBCL 4JJ5A 3ARFC 3DO3A 5FO7A 4GW1B 3JSSA 3JV4B 4YBQC 1B4JH 4K07A 3FRPA 5HI5D 1E6OH 1T80A 3WDHA 4Z7WF 5CSZB 2AV1B 2R0LL 1CLZH 2QADB 3U9UA 2AKRB 3RDTD 1BEYL 4MDIB 1M7DB 5F1IB 4LVHC 5JO5A 3MV9B 3HCVB 2ADGB 3L3IB 4HK3N 4PJGA 1J0IA 2EDQA 3O6FB 3S4SG 4ZG1A 3ZE1E 2X4UB 1OAYH 2NY2B 5TPWH 1ZLWK 4ONFL 4GMTH 5I71C 3BIAX 3MACH 4XCEA 1MRDH 4N1HB 3BZ4B 3MJ7B 1EFXB 4G5ZH 4JKPL 5D7KD 1Q94B 3VDBA 3BPNB 1R3HA 3T0WA 4FNLH 1AQDA 4X0KA 2BVQB 2YRLA 1H5BA 3KPPB 3BT2H 1MFDH 3AB0C 1ITBB 1OB1B 3FN9A 3CFBB 3VGAB 4KAQL 2Y5TA 2FD6L 2VO5A 5E1AB 4DFIA 4YHLL 3ZKXC 5I2IB 1MHEB 3CSYA 1SJVA 4U1LB 2G9HA 3HR6A 4Y4HC 3MRKA 4H0HB 4LPTA 4ODBD 4X8JA 5ACLA 3MBEA 4JVWA 1MHHA 2AJUH 2Q86B 4MD0B 2VDRL 3S98A 3GMLA 3TBVB 3LN9A 1JPTH 3VXNA 2P7TA 3KYMA 3MV7A 1JNHA 2NZ9D 1NQBA 4HUUB 4IOIA 4MZ3A 4U6YA 2WBWB 5BZWA 1YA5A 2YA1A 3B43A 1V7NL 3S96A 2NY5C 4P57A 1MFBL 2EECA 1U8JB 2B1HH 5EOQL 2A6DB 3NCYS 3PDDA 4FHBD 2P8MB 2ZNXA 4EN3A 2Y23A 5HHXH 2W9EH 2OK0H 2EDWA 2C1PB 3MRNB 1AXTH 1OAUH 1UH2A 1X7QB 3W0WA 1RQ5A 3SDDA 5CJ8A 3IDUA 1OTTC 2JCCF 3UP1A 5KZCD 5T1LA 1U6AH 4KGJA 4KV5E 3W9DA 3GKWL 3KXFD 5I1KL 1PYWB 2HKFH 2NY3B 3P4NB 5JW3H 4PJCE 3FO0H 2DBJA 3D85B 2FATL 4XMPL 1WITA 4OKVB 4WU7B 3L6FB 1JZ4A 1QLFA 5KSAB 5ILTH 3O8XB 4FG6D 1WFNA 1QFWI 1XGTB 3LQZA 3RWGA 3C5ZA 1QHPA 5ERWA 1VESA 1MHCA 1J05A 1F02I 2XYCA 1CT8B 1BQSA 1HH9B 4ZNEA 3X14B 4LOUC 1XGUB 1QOKA 1CDCA 4Z7UE 4OZHF 1FN4B 4H1LG 1QFUH 4I5BA 3QDME 5HYIA 1JTPA 1K5NB 3BGMA 3I6LD 4PJXB 1KJMB 5EULV 5AZEL 4MA8H 1EMTH 5BV7L 1A47A 5FYLD 2YWZA 4S1SH 1YEKL 1DBBL 3VGDA 2R4RL 3ARDC 1A9BB 4C58B 1X4YA 2OI9C 4JM2A 2A9MH 5TF1H 2FH8A 5ITFA 5F96L 5GRVL 1JWUA 4GSDH 1FJ1B 4I77L 3KYKH 2CQVA 3U6RA 4RMVA 5CJQL 3RVWD 1OHQA 4P5KA 3MUGA 3O11A 4NGHH 4JPKH 1IQDA 4JDVA 3IDIB 3D25B 1OGAA 4Y8DC 5EOCH 5GRWA 4Y4FA 5H8DA 1I3GL 1AIFA 5E8OB 1XR8A 5I74B 4MQ7A 3S35H 4JANA 5FHAL 2DQDH 2O5XL 4FS0A 4Y2OA 1HQ4B 4MNQE 4LRIC 1UB6B 4ZFOA 4GFTB 2Z31A 1H9VA 4M9PA 2QQNH 1S9XA 5B38G 5KSUB 5D7LB 5ITBL 2K3TA 1GGTA 3NIGF 4KRMB 2R0ZL 4YPGB 5KVFL 4P2OC 4RAUB 5KVGH 5D2LB 5CP3H 3SBWA 2VLLB 1IGCL 4WU5A 4UQ3A 1CVRA 4L4VD 3DPBA 3IDXL 1UA6L 1IQWL 3RA7H 2VAJA 3H9SE 1Z6JT 3RZCD 4L8BA 4HZLB 4LVNB 4AH2A 1Y0LA 2MTPA 5E6IB 2V5SA 5E5MA 5B39G 4YNYA 1MAKA 1ZHLB 4FQXB 3DXAA 1UKQA 1OF2B 4OSUL 3ZKQD 5F97E 1J8HA 2ADJA 3MRJA 1LO3H 4DJMA 3GMRB 3GMOA 5I1LB 4HIHB 4JFFA 4Z9KB 1NAKL 1JHKH 1M7IB 1FNHA 2H3NA 3ZKND 1ZA3B 2I07A 4JHZA 2UVEA 4PRPA 4LCCC 4RMSA 3P9LA 5TE7L 4JRYB 2NMSA 4XBGB 5I1IH 2WWMC 4GG8B 1KEML 4PRHD 5HD8D 3X11B 3P0VL 1FVCA 1NH6A 1SBSL 3BD5A 4G8GD 4JQVA 4XCNB 3ET9F 2VTFA 3BP6B 4TVSa 3WLBB 2UZXB 4YK4C 1AR1D 4BELD 4GAJH 3RU8H 1FYTE 1G7HA 2BNQE 3BESR 4X4YB 4TQEL 2NYYD 1FVDB 3U0PB 4P5TD 2IJ0C 2NY7H 4QTIH 4TNWK 4UIMA 3RQ3A 1AGDB 4OGYH 2CKBB 2PNDA 1MNUH 3QWQB 4PR5A 5D9SA 3FT2A 5HHQB 3FKUS 1T1ZB 1KCSH 4KJWD 5D1QB 3BIBX 4MNHB 4ZAKD 1R3LA 3DSFL 2CLRA 1OPGL 2DLGA 5J7CC 5F8RC 1CDJA 1RUAH 3HHRB 3FO2B 1M4KA 5DGRA 5KVDL 3IFNH 5CEZH 3VXUD 2D4DA 1FVEA 1TCRA 3BW9A 4WNQB 3WE6B 1XF4A 2D9CA 4M5ZL 4TSCL 5GZNC 3L3KA 4NKDA 3MA9H 4C56D 5IB4A 2A6IB 1FAKT 3AS1A 3AY4A 4DGIL 1MFNA 3ZDZF 1UM6H 4O2FB 3GMNA 4M1CD 4OLEA 3QT2A 5AZ2H 3OWEA 1NCTA 5KAQG 5DLML 4RFEB 1J8KA 3DWTA 1FFPB 1WZKA 1P69B 3VXPB 4JHAH 3ARGC 4BKLB 2EDRA 4F8QA 1EEYA 3GJEB 3ORJA 3S88H 4OBRA 2VUYA 2E9WA 1WJ3A 2BY1A 4EDWH 3BRDA 1A4KA 1EDQA 1VFUA 1BBDH 1FHGA 3VXMD 5EU3A 4N68A 3HPJA 4LKXB 3OKLB 3SKMA 1VERA 4L8CA 2PYEA 4K7PH 5TE6H 4PGDB 1I7UB 3CNKA 5IFAL 3W5MA 5T5FL 1T20A 4U1HB 1IVLA 1NGZB 4HFUL 3RWHA 5GGRY 1RZKH 2AGJL 1MLCB 1S5HB 3RWIA 1CIUA 1EHLH 4MAYD 4Q9RL 3TJEH 4G6FB 1A3LL 2PTUA 5HSFA 1NC4A 3DGGA 1MCNA 1I9EA 4MQTB 4LHJB 3BZDA 3T77B 2FO4A 5E00B 1S7TA 2FZ3B 4JFEA 1WFUA 5IB2A 4RMUA 3O4OC 4JFDA 4NQEB 4PJ8D 4XZUA 4OGXH 1RJCA 4P4KC 5C71A 1AD0A 2YD6A 4HKBB 4KK6D 1PDKA 2DYPD 4GG6F 3QO0A 4W6YB 2ICES 2H2PD 4J3XA 1UEYA 1VACB 2YMXL 4O9HL 1KV3A 1Q72H 4AM0B 3IVKB 5FK9B 4PGJA 2DI9A 4GMSH 3QQ9C 4Y7MA 4GRLB 2F54A 1KIUA 4XP6H 2VLRE 3MO1B 5E08H 5D5MB 1IGFL 2LVEA 2JIXD 3CU1A 5BO1L 1EIBA 3QA3B 1MJJA 4EUPA 2VITA 5I18L 1YPZB 2I27N 5TE4L 3S37L 1DSFH 3TNMB 4UT7L 3OR7A 3NCYP 4DZ8A 1BWMA 2ARJA 4Q7DA 1SVZA 4NQDD 2X70B 4JJ5B 5MP6L 4RFOH 5DS8A 5FA4A 1HILA 2IEPA 3HG1B 4YC2C 3MJ8A 4X6DA 1KTKE 4QRQB 2VXVH 3FQXA 3N06B 3U9UB 3WFZA 4DW2H 3FHAA 4JRXE 3EYQD 3HE7B 4HMCA 1OAKL 3CXHJ 2BSTA 3TYFB 5IQ7L 1I3VA 4LLDA 4LFHD 4JFPB 3HS0A 4OD1L 1NCUA 2OTUB 3TC9A 3JTTB 4Z7WE 5KOMC 4P2RB 3BDYL 5GGRA 4KKCD 4JB9L 4DUXA 1LMKA 2WNGA 2AJXL 4JAMA 2XA8L 4N0YL 2EEDA 3SGEH 4RRPG 3IAGC 2C7UB 2BNRB 3SE9L 1HHIA 3CC5A 2V7HA 3VXSA 4IS6A 1F4XH 1FZJA 2CDFA 1Z9SA 4N0UA 2H2SC 5FO8B 3D87B 1AQDB 3MGAA 1U3HB 1NUDA 2VLRA 1CICC 4ZTPL 1LEGA 1YEGL 3BVNB 3WD5L 1Q8MA 4OCRH 4ZOBA 5IHZA 4Y5XC 3MNWB 3VWKC 1E4XH 4MXWH 4MJIB 4X4ME 5C08B 5DRZA 4KH2A 3REVB 1V05A 4NKMB 2GJ6E 4QRRE 3OKDB 1BAFH 1PEWA 2DRUA 2G9HB 5C7XL 4XPHH 4IOSD 1FLTX 4WO4B 4D94A 5E99L 1BQLL 1BQUA 3BGAA 2NY6C 3MLYH 2WK2A 4RGND 4BK4A 3MREA 3RBGA 2B7DT 2UWEE 2BERA 1XGPA 3HE6B 4F3FA 3VXNB 2YSSB 5D7IA 3G6AA 3MV7B 1JNHB 3E1F1 3DUHA 2VRAA 3TVMC 3F6LA 4FFWC 1ZWIA 3MV11 1J0KA 1A6PA 2VDLL 3T2NH 3MLXL 3B8SA 2OYPA 5MERA 1S3KH 3UO1H 2QADD 2XQYK 4RMRA 2MMXA 3O6LL 4OD2B 1JPST 3BSZL 4L9LB 1VEPA 3MV9D 2DBLH 2N56A 3U79A 1NCDH 1MIML 3MLPA 3LKRB 1QSFD 3O6FD 3MRLA 4RIRA 1XCQB 3NH7H 4U2ZA 2XTJE 4XC1L 4ZUSB 4BH8B 4WJ5B 3WJJA 4YDLB 3H0TB 2NY2D 3IF1B 1ZHBA 3MLVH 4QOKE 4UDTA 2MOVA 2VZSA 3RVTC 4KHXL 1KGCD 4ZTOL 4YHZL 3D0VB 5C07B 3TF7C 3O0RL 2HT4D 4BYHA 1NMAL 3H3BC 4PRDA 1FIGH 2OR7A 5DURB 5LGJA 5JHDB 3O9WD 2G2RA 5BVPH 3GSXB 1EO8L 1I85A 1HCVA 5F7DB 5CILH 5CD5C 2NQCA 3L5WA 3VD9A 4NKIL 4OZGF 1JNLL 2DQGL 5TDPA 3TBTA 1A3QA 5D7JB 1FZOB 3WNOA 5EUKB 4O02H 2Y36L 2EYRA 4HC1L 5HGDA 5JORA 5F21B 5FECB 1HEZB 1G84A 1LD9B 5E0QA 3V5HB 5FYJE 4JO2H 3JZ7A 5H94B 4PJIA 5CWSB 3KPRE 3L3DB 4PP1D 4JM2B 1FZMB 3GSRA 1DN2A 1G6RB 4LCIH 3MV8A 1NGQL 4U6XA 5EA0H 1UXWA 5EIIB 3C5SA 3IKCA 3H3KA 2D03H 4Q9BA 1MWAA 1DVFC 1T7ZA 2AJSL 3I75A 1KNOB 4F9LC 3ULUD 3C2SA 1DZBA 1FIEA 1I8IA 3P4LA 3KLAA 3FB6B 4D0CB 1KJ2H 1U8OA 3QDJA 5KANG 4CRPA 4AEIH 1U8IB 4LF3A 4PJ7A 4JVPA 2DM4A 1LNUB 1T66C 1AIFB 2VDOH 1XR8B 3E6FA 2JCCA 2R56H 1ZAGA 5IIEA 1BJ1H 2DQTL 4B5EA 3IRZA 4ZFOB 5FHBL 4PRIA 3NFSL 3MLTA 3TH4T 4XP5L 8FABA 1C7TA 3GZKA 2X10A 2NW3A 2NY3D 1TPXC 4NM4L 5IG7A 3J8F7 4XPAL 3D85D 5EBGA 4CW1B 5IB5A 4MNGE 3MGTA 2WQ8A 3BE1L 1Z9MA 4BSVA 3BP7B 2DWEB 1DQQB 3U7YL 1U8MB 5KSAD 3O8XD 3B3IA 3NIGE 4X6FA 1GZQB 2X4QB 3EDDA 1T1XA 1UB5B 1YZZA 4OZHA 4U1JB 4K94H 5EU6A 2R2EB 1YN6A 2J4WH 1UGNA 3DI3B 4YNYB 1RUQL 5TGBA 3N1QC 1OTSD 1NFDA 4P9MH 4NNYA 3O45B 3GJFH 3VFOA 3ZSSA 2B4CC 7FABH 4YBLC 5DMIL 4G80B 1GVIA 5DVMA 4ONHA 2FHFA 5IV2A 3QUZB 1S5IL 4JPIA 3QNZB 2HWZL 1JIBA 3U7WL 2EEAA 2GY5A 4A6YL 1BD2B 2YPKA 3PHQA 1C16B 4FABL 4F58L 1A9EA 3NAAL 3UMTA 1M1SA 1VPOH 4KKLC 4WI2A 1CXHA 1FO0H 3P4OA 3HI6H 4H26B 3EFDL 1OAZL 2X4OB 2Y7QB 1IGTB 2VNCA 1J5OH 2VH5L 5HY9A 4YHYC 2Y5EA 3FMGL 3QFDB 4R3SB 3BPCB 3K8LA 3CH1B 5FKPA 5E2UL 1S9KC 3BO8A 2CIIA 3FT2B 4AEHL 3A6BH 3ZL4L 1AY1H 2H26B 3OB0K 1NC2A 4KK8C 4IRJA 2C26A 2WLYA 5DK0B 4F9PA 1W72L 5D7LD 1S7VB 5HGAA 1T4KA 3F62A 1AQKL 1WCBA 4HH9A 2MHAA 3D3VE 4M62H 4JZNA 5FOJA 3C6LA 1LEIB 5E1HB 4Y5YB 1INDH 5MHSD 3TGXA 3DURA 2Z8SA 1A7QH 1FVEB 4NJ9L 4QHNA 3TNNB 4Z8FH 1FLRH 3LB6C 3GBNH 4QY8A 1F3DH 3FFCA 1NGYB 1MVUB 1UWGL 1FNSL 5E6ID 4XTRC 3SDXA 3IETB 5F9OL 1T1WB 5GGUA 3VXQB 4FQXD 3CZFB 3SCMD 5KJRH 1CCZA 1A1OA 4WV1A 1UWXH 5SWZB 3SKOB 4ZD3H 4OCYH 1TJGL 1VADA 4DN4H 1U8LA 5C0RH 5DVLA 1QEWB 1NBVH 4LNRA 4ZUUA 2D7TL 3PGDA 2VR5A 3RUGA 1KG0A 3ZDZE 4LU5L 4Y19B 1IM3B 4N8VB 2ICWA 1W0VB 3AVEA 4JFHD 4X4XA 4ONGH 1XCTA 1I9IL 3MNZB 4QRPA 1P84J 3EIFA 4JRYD 4E42B 1HKFA 3EJZC 4EXPX 5TH2A 3SKMB 4OBSA 5ENWB 1M71B 4HGMA 1NDGB 1DQDH 4IHOA 1IAIM 2YHGA 3CFDB 5DD3H 4GXVH 3OF6A 4MB5A 5CGYC 5J6GA 3F58L 4L9DA 2FJHA 3TT3L 1U58B 1HDMB 2VLJD 1Z3GL 1Z0MA 3FN3A 1FP5A 4U6VL 2D7OA 5FA3B 1ED3A 3DGGB 1RMFL 5KS9B 4NRZA 1DN0B 1IAIH 4PLJD 1JK8A 1GC1H 3O2WL 3CU7A 5FKAB 1WWBX 4OQ1A 1S7TB 1KACB 4FG6C 4NN7B 3TYGH 4PIRF 4PP2B 2DOCA 4X7DC 3V7AE 3CFKB 3MXVL 4R2GB 1AXIB 2AABL 4KDVA 4N90D 5HHVH 5HYSA 3WS3A 5IMLB 1NGXA 1I9RL 3PQYB 2FGWH 3FONA 3QIUB 4GG6E 1MLBB 1YUHA 5L2KA 4GW5B 5SWSA 4Z95L 1OLZA 3HZYB 4JHWH 5TQ2H 4GRMA 4WFGD 2J8UB 3GMPA 2VITB 1RFDL 2BFVH 1KN4H 1Q9WA 3MODL 4G9DB 4RGOH 3MRMA 4HWEL 1SQ2N 1ZS8B 3M1BA 4V1DA 3VE0B 1N6VA 1BFSA 3MJ9L 3IU3A 4JLRA 3V6FA 4YAQA 3CLEL 4RMWA 4XNYL 2IWGA 2W0FB 5LQBL 5GS1B 4O5LL 5ADOL 1QSEA 4XH2B 1YEFH 2Z0BA 5GRZA 4G42B 5FA4B 4OT1H 3T04D 3LS4L 1GHFL 4L5FL 1GRWA 1ZA6B 3QQ3B 4I0PB 4XX1G 1K4DA 5GS0C 3KYOA 1NEZB 4LDOB 2CO7B 1F90L 4I2XA 3R4DA 2ZSWB 4X80H 5ISZA 3NTCH 3MC0A 4L4TB 1S7WB 3NPSB 5JUEL 2E6QA 1EZVX 4UUJB 3KPMB 5GGRB 1HXYA 5H2BB 2R2BA 5BRZA 4K55A 4D0DB 3UJJL 3DIFA 1RUPL 3RHWK 1CD1A 4G6FD 5EBWB 1K3IA 2DIJA 4CKVX 1NCAH 4XPBH 2R4SH 2P5EE 2ZCLL 4GBXC 3FAXA 3E3QC 1T3FA 4QHUA 1W2KT 2IANE 4Z5RB 4ZS6D 4XC3H 3WXVL 4N0CC 1XEDA 1D5XA 2VE6A 3HUJE 4TPRH 5E2WL 1PG7X 4NQED 1LEGB 3RZCC 1P1ZA 3HC0B 5HHMB 1JHTA 1P9MA 4DQOL 3IJYA 5J9PA 4CVXA 2AV7A 2W60B 3O4LA 1UZ8B 5DRZB 4P5MA 3TO4B 1FE8H 1Y6KR 4NRYA 5C0CA 4K7FB 5DMGC 4JPWL 4P99A 5CJOH 5E9DB 4GRLD 1T0MB 2PTVA 5JXED 3PL6B 1XR9B 4BUGA 2AW2A 3U0WH 5DJ2B 4XVTL 2EICA 3IDNB 1UH4A 5CGTA 4MQXD 5HYJA 3QI9A 1NKOA 4KRPB 3QXAB 4HKJB 5D7IB 2A0LD 3LD8B 2J6EL 3E8UH 4ZO9A 4QYOB 2XZAH 3MRDA 1R24A 3A6CL 1Z9OA 3MOAH 1I1YB 4PD4J 3CPLA 4UINL 4F80A 1OD9A 3ZDYF 3HG1D 2YWYA 2EH7L 3QDGE 4YXKL 1OCWL 3AMKA 4JO4H 1ZLUK 2WWKO 4MHHG 2ESVA 6CGTA 1VGKA 3JBG7 1XGRA 3HE7D 3QEQE 5FM5O 1N3NB 4M6OL 3VXOB 2XKSA 5CBAA 3C08L 4RIRB 3BWAB 3WEXA 4P2RD 1LQSR 5DEGB 2YK1L 3PGFL 4UDTB 3S8WA 4GAGL 1EERB 1AHWC 4PJEE 1IFHL 2BNRD 4NM8H 1FORL 4TSAH 5D1ZB 5K9QI 3V4PL 3IGAB 1X5HA 2GJJA 3ARFA 1D9KC 3WSQL 4G7YL 4JG1H 1G7JB 1INQB 3LS5L 3QJFA 3KPSB 4RISH 3PP4L 3R1GH 1U3HD 2RFXA 1MJUH 2M8XA 1MCSA 3EZJB 3C2AH 2VDKH 5GS3A 4N1EA 2HVKA 5JQ6L 2J12B 3V2AR 4OQTH 5JNYA 4KRLB 3T08A 3OR6B 1TQCB 3LRSB 2JTDA 4MJID 3GK8L 1EH9A 4D3CH 4ETQB 4PB9L 2EYTA 2Y07L 2D7QA 3NZ8A 5CEZE 3O41A 3C8KA 4WO4D 4PJDF 3WFHA 4EIZC 3BXNA 3QWRD 2R1XA 4OZGE 3BKYL 4XWOD 3U9PH 4KTEH 5CUSL 5IMMA 1ND0B 4KK9C 3U0TA 2X9WA 5GRXG 1YMME 4JN2B 5FM5M 4CNIB 1BBJB 4P3CL 5ACZA 3WKML 3T8XA 3MV7D 1TQBB 4JO3L 5DQDL 5LKNA 2YKLH 4YDKL 3T4YB 4Z78B 3T0AA 2VLKB 5EWIH 1DBAH 5IJKC 4P49A 1S9VA 3NGBB 1A1NA 1KIQB 4KDTC 1T03H 4AENA 4UQ2A 3ZT6A 2H8PB 1EHNA 1X9QA 4Y4HA 1S9YA 2B4CL 5E2JA 3W0WD 1H0DB 1MH5A 2WUBL 5IIEB 1HWHB 5FYLH 3TN0C 3MGOB 4R97C 5CBEA 2V17L 3BKCL 3GO1L 2PKDA 3DRQA 1RZJH 3BAEL 1B3JA 2L4OA 3UXFA 3STLB 4QHMB 3SE8H 3J7HA 5IB5B 3VGFA 3I6GB 5C07D 3MGTB 3TH2T 4C59B 3QUML 1MCPH 3EJYD 1NMBL 2AXGA 3ES6B 1NCCL 1MI5E 1OAQH 1HZHL 5FYJL 1ZK9A 3ABZA 3G5VA 5ANME 5DURD 5DT1L 1KSRA 5JHDD 2QSCL 5IJVB 3QPXL 1CL7I 3CVIL 2V2XB 5GISL 1R3KA 3LRGA 1MY7A 3VFSA 4WW2C 1MVFA 1SM3L 1A7OH 4M5YL 2A1WH 4XNXL 2VC2H 1CGWA 2FBOJ 4NNYB 3G5ZB 4HBQA 4AIZB 1ZLSH 3UPRA 1SJHA 3PABB 2YPLA 1G7QB 1CVSC 2KPNA 1RZIA 2MQCA 4W6XB 1U8HA 2DQUL 2HH0L 2C4FT 1IILE 1QRNA 4UNUA 5FUOL 1RHFA 2PYFA 3I02A 1HXMB 3Q2CA 1JJUA 4JM2D 4WCYH 2HT2C 4OIIL 3LHPL 5CHNA 5B8CA 1QFWL 1N8ZA 5E4IA 4JFQA 5LAXB 4OGAD 4KJPD 2NZIA 1DBJL 2ATKA 4GQPH 2IG2L 1FBIL 4HFWB 4Y16B 3WUWA 1NUFA 2DQEH 3UYRL 4S1RL 5CJBA 4ZDHA 4XP4H 3R8BB 3BD4A 4J3VA 1J0HA 1C5CH 4KKCC 4CU8A 1X5XA 2X89A 5AG8A 2JB6A 4NCC2 2F53A 4XPTL 1X4ZA 3TJHD 1OP5K 4GUPA 1XZ0B 4CVUA 1IBGH 4LRNL 5FOBA 5JXAL 5K93A 4EEEA 4OLXH 5BS0A 1UKTA 4LCWE 4PJFA 1PG7W 4WHYH 1KJ3H 2DQJL 4HT1L 1HH6B 1QSZA 2VQTA 3FOLA 2ID5A 4FFYH 3RGVB 1MREH 1EHXA 5GGVL 1W0WA 2NX5B 4H5SB 1MQKL 2OSLA 4MMZC 1M05B 2DWDB 4PG2C 5F89A 5KSVA 4K8RD 4YE4L 1BF8A 1HKLH 3F12A 1MOEA 1Z2KA 1KXTB 4RGNC 2AS5M 2MSPA 3A67H 1F4WH 3GFUA 3H3PL 3UCRA 2MCG1 5IEKA 2ZUQB 4LRIA 4JFXA 2FEDD 4J6RL 5EU4A 1U8LB 3SY0A 5TDNB 3TWCH 1J8HD 5BV7B 4EKXA 1NBYA 2GTZA 3QUZD 3RUGB 3UYPA 4CVWA 2X1WL 5GSVB 4P2OA 3IS0X 3BMVA 4U3CA 5C0IA 2DLTA 5DRWA 1XCTB 2GY7B 5JR1H 4Q9QH 1DP0A 4QXGL 3V52L 2QADC 5F7EL 4LQ1A 3RWJB 2F58L 1NAML 32C2A 5CEYA 4K9EC 4MB3A 2BNUB 2KQMA 1HSBB 1YDPA 3EOTH 2MKWA 5EZOH 3ZYIA 4PJ5B 2BC4A 2BDNL 5HI4D 1R3JA 2BRRH 2NY2C 4C83B 3PHOA 3QFJB 2X4NA 4MJ4A 5C0BA 1CD8A 4OFIA 1O7SA 2XPGA 2Q6WA 2IQAB 5DHVB 3QXWA 3BQUC 2R2HA 4FA8A 3VD4A 2FEEI 2H1PL 2AI0L 5EUOA 3UZVB 3JV0A 3OV6A 1GZPB 4ENEC 1BZ7B 2HLFD 1KXQE 5GS0L 1FG2B 1V3MA 1X5LA 1UM4L 4KROB 4EDXB 4ZNCD 2OTWA 1XGQA 2GK0B 5H37G 1YNLH 2RCSL 5T3ZL 2WBJA 1B6DA 4Z0BL 3LKNB 2IGFL 4YDIL 2GEEA 3K2MC 5HDQH 2OJZH 3KPLA 3RI5K 4LHUB 4XT1C 5ECJE 1NMCC 5SWZD 1CXFA 2GKIA 2IALB 2GSGA 2OJEA 2EDLA 4WHCA 3IU3B 3HI1B 4NN6C 3NZHH 1ADQH 1UWEH 2CD0A 2GFBB 5CAYB 3ULUC 4A6YA 5FGCB 3S6CA 4Y19D 4R4BA 1OAXH 1WBYB 1ZEAL 4QRTB 1QLRB 2NNAB 1JGEA 3B8YA 4K3GA 5ACMA 3UTZB 4WFFE 3CXHK 3O6MH 1MCJA 1U2HA 1KCRL 2X1OA 2ZUWA 5HHXL 1N2RB 4HK3J 3T3PF 1I9JL 3WL9B 2MPAL 3UEZA 2PYED 3PV6A 5C0DB 1G7LB 1Q1JL 5INDA 1TTFA 5DGQA 1IKNC 1HYRC 3G5YA 4NP4L 1JYWA 3KLSA 4PJHF 3MMEA 5IKCB 1F8TH 3SO3B 1T04A 3PWVB 3S5LB 3DIFB 2NY3C 3MRGA 4QHLA 4W4NA 3ARGA 1D5BA 4JCMA 3DARA 4EIGB 4RWYH 3BN9D 3N85H 1TENA 1JF1A 1MEXH 4MQSB 3VI3F 1ZOXA 5SX5K 2HT3D 5C6TH 2F5BL 1P4IL 4JFED 3BX7C 2O61B 4OZFB 3LN5A 4KMQA 2F15A 6FABH 3F5WA 4RNRA 1F58H 1BOGA 5J9PB 3BP5B 2A77H 3QIWC 1P4LB 5ADPH 1OTSC 2AV7B 2R29H 3L3JA 1BZQK 3MLUL 3PQYD 4GAYB 1K8DA 3RBSA 1WF5A 4Z7VE 2NXZC 3QIUD 4Y0GA 4PJBB 3CFCH 1TTUA 3EOAA 3KPNB 4PRNB 4B7LA 1MHPH 3VH8B 1K4CA 3OKEB 2A9ML 4YDVB 1N6QH 5AUMB 2EYSA 4OZIB 1LO4H 5HYJB 5F7UA 1CF8L 3QH3A 4OCWH 4YDJA 1U95A 4ELME 3TP4A 4QEGA 4P4KA 2DKUA 3UJTL 1QLEL 5C0EA 3X13A 3RVUC 1K6QH 1CWVA 1CFNA 1KJ2A 4P46C 4G6KL 1CZ8H 1ZANL 4I0PD 4X5XB 3Q1SL 3EDKA 5DD1H 3MA7A 1YJDC 1Z5LA 4F57L 2W91A 3PWNA 2O5YH 4U7KA 3AREB 3D69A 1S8DB 4L4TD 3QEGL 1ERNA 2AP2A 4KTDL 4JREB 4L8SB 3ROLA 1CLOL 3ZDYE 4POZD 5EBLB 1N7ML 3NFPA 5DMKA 4L3EA 3T0EB 5HBBA 4HJGA 4K3EL 3FRUA 4KTYA 3DO7B 5KVGL 4LSRH 4Y1AE 2XV6B 1CBVH 2P5WB 4WGWB 3VXSD 5I1JL 1FAIH 1UXSA 2BRQA 2IBGA 4MS8C 5F6HI 4OLVH 3GMMA 2CMRH 4I3GA 3LKPA 1JGVL 4NBZB 4LHQB 1KPRA 3DX6B 2NTFA 4OJFH 4XVJH 1QBMH 4LVNC 2YPVL 5HHMD 3WLWD 5SV3A 3NCJL 4K9EH 4JHBA 1INEL 4FQIL 4LVHB 5LXGL 4J23A 3B9KC 4FQXC 5ID1A 2QKIA 4JPVH 2GJZA 1H8OA 2IFFL 3TO4D 3GJFA 1QP1A 3ESUF 1WLHA 5EBMB 3S34H 1B4RA 2AERT 2AK4E 3MRRA 5BW7C 5E9DD 3VFGH 4LSQH 2DQIH 5I71B 1JE6A 3PL6D 2FL5B 3BKJH 5IROC 4QLRA 1T2XA 5IMMB 4FQ2L 3MLSH 4Q2ZA 3U48A 1QBLH 3MRCA 4KRPD 3T8XB 3RPKA 1D6EA 4WI6A 1AO7E 1CICA 5FO9A 4GAJL 3RU8L 4MJ6A 3GMQA 2F8VA 4Y5XA 3HKFA 1MCFA 3D48R 3EO9H 3GKZA 1WAAA 3VWKA 4QHKI 1KFAH 2IAMA 4O58H 1X5AA 2ZCHL 4HCRL 3TT1H 4X83A 4GKSB 1ORSB 4BJLA 3LAFA 5F7YC 3U1SH 3WNLA 1HQRB 4W6WB 2IPTL 5JIHA 5CBEB 3L5JA 1D5ZA 4M61A 2CRZA 3R06B 1GCFA 4F15C 4HJJL 5D1QC 1E6JL 3SDYL 5E8PA 2CUIA 4PGCB 1U8NB 2PW1A 4G6AD 2AJ3A 4KI5E 2C3HA 3UTTE 3ULUH 3ISWA 5D1ZD 5BCAA 3TVMA 4HV8A 2ZUUA 1XMWA 3BUYA 4HZAA 5CMAB 3MBXL 1DFBH 5TDOA 2GUOA 4J4PD 5GJSH 3VDCA 4H0GA 3BH8B 4G8FB 2AK1H 1FFNA 4KQ3L 5E5UB 4YO0B 5DD0H 5C09B 3VFSB 5E2VL 4MA1B 2YC1B 4LLYA 4OAWB 4ODHL 4PJDA 5KAQF 5DJ6B 3C9NB 1BMGA 5DUML 5F9AC 1CGSL 3MYJA 1PZUB 1IKFL 4PG9A 2WUCL 4LLMB 4CADA 1RZIB 1RZ7H 1NSNL 2OZ4H 4JY5L 4PRAA 3PWJA 4BSWA 1WZLA 1IAKA 1U8HB 3D6GA 1WVZA 3UAJC 1NLBL 3T65B 2WIIA 1YN7B 4LMQI 2Y4SA 2W65A 1U91B 4U6HB 2P8LA 1MJ7H 2A83A 4D0BB 2B20A 3BMWA 5HGBA 3WUWB 3LKOA 4WUUB 2VLKD 3MRFA 4X98A 4JFZL 1TZGL 1RZKL 1ZLVH 4APQB 5DJ0B 3S36X 3M07A 3VW3H 5A3ID 1DQLL 5C3TA 1JRHH 5A2IH 3MCKA 2R0KL 3ROOA 3MFFA 4NWTL 1A0QL 1MFCL 1AKJA 3VFWA 3FTGA 4Z77B 5D1XC 1CDHA 4BH7A 1OGTB 4HQQH 3HFMH 5T5NG 1IRAY 4ZS6C 2VN7A 3ARDB 4PJFB 2OI9B 4LSSL 1NCNA 1B6UA 1F11A 5JIKA 1DVFA 4F9LA 3VFUA 4KMLB 1Q72L 1EAJA 5IVZA 1KT2B 4MAUH 3IJSA 1MRFL 4ETYA 1I75A 3B2UD 1FL5A 3SGJC 2QHLA 3QEUA 4QWWD 4HIEA 3JWOC 2R69H 4HWZA 5JXEC 1KLUA 1JWMA 4KI5C 3EKCA 2Q7YB 1LO2H 1QSVA 2DMKA 4KVCH 1T0NA 3GSNH 5JHLH 5EU4B 2A0LC 5L9DL 1QACA 4LQFL 3N1GC 4ODUB 1P84K 5KTEL 3BGFC 2HFGH 4WI8A 2DQFB 2OL3L 4FTVA 2BSRB 5C0IB 4DVBB 1RU9H 4ZOEA 1NANI 3IDMB 4ODTH 3AS3A 1FPTH 3VFTB 1EBAA 5E8DH 4MA3B 4CJ1A 5B22A 1JNNH 1RJLA 5CEYB 3HE7C 2ENSA 1ZV5A 4Y16D 3WFBH 1JWSB 4PJCB 2QQKL 1YDPB 3O3AB 2Z93A 1R3JB 1CI5A 4I3SL 1YEIL 3PXHA 4N9GA 2CDEB 4UZGA 4X6CF 1PKQA 1WIPA 2VKXA 3LDBB 5CD3A 4MJ5B 4MLIA 3GUTB 2R2HB 1NC2D 4IRJD 4Z7UB 1VFBA 2V6HA 1Y6MR 4HS3A 4LCCB 4IRSC 5EO0A 3HZKB 3QQNA 4YHIB 2IMNA 3QDMB 4OCRL 4XAKD 3X17A 3RDTA 5HPMB 3QXUA 3RGVD 2ZCKH 3DETD 4MXWL 5D8JL 5GGVY 4UIKH 4P3DA 3G08A 2OTWB 1ES0A 2DMCA 3V5DB 4D8PA 2NX5D 3L3OA 3OXRA 4XPHL 3V8OA 1KCUH 2Y6SC 4WO4C 2FDBP 3V0VA 5K9JH 1FNAA 1SY6H 2N7AA 4HIJA 1RY7B 3KPLB 4XWOC 4JQIL 1WZMA 1JPGB 1QVOA 3HE6C 4HK0A 2LAAA 3H6JA 2ZWLT 4LSUL 4M7ZB 3FT4A 1G9NH 4DN3L 1FFOA 3KS0J 1FGNL 2WINB 4A6YB 5ESQB 3VG0L 4R4BB 3IDJA 3KXFE 5IR1A 3IFPA 3ARVA 4WWKB 4G6ML 4JZJB 1I7ZA 3FQWA 4QRPD 4MNQB 1A3RL 3IU4L 1LO5B 4HF5L 2VERN 2Q76A 5HYSG 4L9LC 2BX5A 3AAZA 2OR9L 3QQ4B 4I4WA 1Q0YH 1XH3A 4HIXH 4CJ0A 3EYUL 1KLFA 4PJ5D 5EFIB 1J1PL 3ECBB 4H25A 1T83C 1OWWA 5D6DC 2GT9A 4I1NB 1EXUB 5EC1A 3MLVL 3GHEH 3QFJD 3AM8C 5I30H 5AG9A 3QR2A 4P48A 5ICYB 4HUKB 1D5BB 5EZLB 1UJ3B 5DR5L 2Q3ZA 5HHPA 4M7JL 4KC3B 4DKFL 5GRJH 2FNBA 1CD0A 3BKML 1W72B 2IADB 2HJKA 3QCTL 3GBLA 5BVPL 4K2UH 4Y8AA 2EIEA 1SJEB 2VSDA 5MENA 4M8VA 4GLRI 3OHXB 2XZQH 4I9WE 5ALCL 4KROD 3VI3E 4OQTA 4MXVF 5DJ8A 5D7JC 2OR8A 4WI7A 2E7LC 5HYFA 1JGUL 1OARL 2I5YH 4M7LH 1KXVC 4G43B 43CAB 4CU6A 3U4BL 3QUXC 4GOSA 5I1GH 1RK0B 3UC0L 2ZOKB 3U46A 4TRPL 2I9TA 3P4MB 2RAMA 4WEMB 1UVQA 5HVFB 1IGMH 3V7AG 1R6VA 4OLWH 1DCLA 1JF5A 2X4SB 2B2XL 2EYSB 5F3HB 5D7SH 4FZEL 1FYTB 2YD9A 2BNQB 5BZDA 12E8L 4OGAC 1VKXB 4KJPC 3O4OB 4E5XB 4HPYL 3T0BA 2XNAA 3ME0A 2E27L 2MWCA 2ZKHL 1QSED 3C8HA 3RNQA 4U1KB 1EGJL 2D31B 3I6KB 1CFNB 4F37F 1PFCA 3BHBB 1WIOA 1BZ9A 4PREA 2GHWB 4KFZC 4DKEH 2ICEA 1P4BH 3JWOH 4PJHA 5E7BA 3DHJA 3F7VA 3UDWC 2AJYL 3GIVA 4HX1A 2M2DA 5MEOA 5E94B 3VFVB 1D5IH 2UVFA 4PJXF 4UV7H 3CVHL 5BRZD 5HI3C 1NL0H 3B9DA 4PJAA 1W8OA 4UT9H 5C0JB 2P43B 4PV9B 1T2QH 2EXWD 2YD7A 2EDTA 3RWCB 5B4MC 1MPAH 5CINL 2DKSA 1JI2A 4JM4L 4LEOA 2UY6A 4GS7C 1FSKC 5DA4A 4MCZB 4WENB 4FOMA 4YC2B 1S9WA 1KPRB 2HJFB 4TOYH 2NTFB 4KKAD 43C9A 3OAYH 4OUUA 5I76B 3F65A 2AJZB 3HNTH 4NN5C 1UYWH 5CJXC 4HXBH 4PRHE 5E8EA 4MB4A 4G8GE 4ZPVA 5JLZA 3O4LD 5J57B 4MX7B 5C0AA 2ENYA 3U36A 2KZWA 3NFNA 2DI7A 5ALBH 4BQ9A 5IW3A 2OMNA 5FYKD 1AP2B 5JA8B 1IEAA 3LN4A 1GSMA 5IM7A 4RMQA 5KVEH 2BSSB 3V6OA 2VMFA 4KY1H 3LQAL 1I7TB 1C5BH 3HMWH 1DBMH 5D2LF 3TCLB 4L4VA 3WO4B 5HYJD 2X1QA 5D96C 2ITDB 3VJ6B 1D6EB 2VDPL 1CDIA 2DI8A 1QZ1A 1CICB 3R8QA 2FWOB 3RZCA 5DRXB 4J8RB 3QG7L 3OJ2C 4P9HC 3QCVL 3SDAB 2HVJA 2X9XA 1RJZA 2FR4A 4ODVH 1XT5A 3DVNA 3LY6A 3VXUE 4G8IB 5C2BL 5F3BB 3HMXA 3ARED 3UTPE 4XCCL 2Q8BL 3HZMA 2IFGA 4UT6H 3WXWL 4C56E 1F4YH 3CDCA 1RPQA 2NY6B 1XF2B 4M61B 4AQOA 3X12A 2R8SH 3T0XA 2NXYC 1IC7H 1LP9A 2CDGA 3H9HA 1AE6L 1N26A 4JRWA 3T0ED 4F7MA 1URLA 1A5FH 1R3IH 4YQXH 3QJHB 1MAMH 5L2JA 2P44B 4XCYB 4PUBH 4MDJA 2P5WD 4Y5YC 3VXRE 3WUZA 3VCLB 1OP9A 3QRGH 1JGLL 5IW6A 3KR3L 5I16A 4YBQD 4DCQB 4WUKL 2HMID 5HYQA 1GH7A 1FL3A 5J1AA 4AL8L 1T0PB 5DDHA 1YEHL 5KW9H 3O3EA 4X9BA 4DKAA 3RWEB 4LLYB 4NDMB 4ZD3L 1F3RB 1GGBL 1J12A 3VWJC 5GIRA 4Z76B 2CIKA 3EYFB 1R0AL 5T1MB 1E28A 1EEZB 5DJAA 4UAOC 5BQ7A 5DHYB 4U0RC 2VDNH 4CVZB 4NZJA 1LDSA 1FZKB 4JRXB 4U4BA 4ZSOA 1D9KA 3GSWA 4Z7WB 2P8LB 4FP8H 4OLZH 3ZTNH 5K9OB 4NQXA 1YEEH 4F8TA 1YNTA 1OL0A 1WEJH 4GXVL 4H20H 5HGBB 4F2MA 3FL7A 4L1HA 5KOVC 5DJYB 4AG4L 1AGCA 1ZLWH 5DC9B 2EKJA 3BRGC 5FFLA 4NZUH 5GGSY 3MCKB 1BFVH 5I1CL 1JF6A 2V2TB 4Y4HD 1WGOA 5J6HA 4FXGA 2DTMH 1AKJB 4LCUA 4BFEA 3KPQA 2XFXB 3HZVA 2R0WL 4FZ8L 3OKNA 1RURH 3GB7B 5HHOE 3TYGL 2XT1B 4NN7C 5BVJA 4N5EC 3SGDH 2D7MA 1G6RH 3VXMA 3QXTA 4YJZL 4RZCA 2XXCB 5CP7A 3VFRA 1F11B 2GJ6B 3FHQA 4QRRB 2X6MA 1GGIH 2FSEA 4ZXBC 3RL1B 1DVFB 5HHVL 3IFLH 3NIDF 4R2GC 4H8WC 5MEPA 3VFUB 4XBEH 1N0XL 3DUSB 1A7RL 4XP1H 4IIQC 1QTYT 4WY7H 3SPVA 5IESH 1S7SB 3PNWB 2UWEB 5IJKA 5D2NA 5SX4I 4OZ4A 5EU7E 3N9GH 1RUKH 4JY4B 1VGEH 4KDTA 3M17B 5CS7A 3JWDC 4C57C 4LMQE 1JWMB 1A1MA 1CFQB 5EC2B 1JNJA 5F6HJ 4I18C 5C09D 2YXFA 3TN0A 1OTTD 4JO1L 4JGMA 1C08A 3G6JF 4XP9L 3DTXA 1IL1A 3LSOB 3STZB 4PJ8A 3RVVC 1ADQA 3VDAA 5GS1C 2NLJB 2O5ZH 3KDMA 4MXQC 5IOPA 2A38A 4GQ9H 3MR9A 2HTKC 2DYPA 2C3VA 2IC2A 1Q9OA 1KYOJ 2OX5A 3DOSA 4KJYB 4G8EB 3V4UH 1C12A 4D9LH 2VABA 3S36H 4NNXA 1MCOH 2XRAH 5DJCA 4K8RH 3V4VL 3NTCL 1A6UL 4X6EA 1I8MB 2ORBL 1CL7L 2JE8A 3NA4A 4NFDA 4J1UA 3NPSC 2P47B 2J2ZA 4QOKB 4WUUD 1A14H 3KYAA 2FX9L 4POZC 5DK2A 4NQSB 2JIXA 4LOUD 4KHTH 4APQD 2Q8AL 2GW5A 1VFAA 2HJLB 1PLGL 2IPKA 4HAFA 4PLNC 4N9GB 5EG6C 1JN6B 1DE4B 2B1AL 4QRUB 3MOBL 1KJVA 2F53D 3BEWA 4YBLB 1NCAL 3IJHA 4M93B 2E9BA 1B0GB 1UCBL 4NQDA 1C1EH 4S1QH 4XPFH 1IC4H 5CD3B 3NIFE 4KQ4H 4QHKJ 3VFPA 3ARDD 3KPOB 4HKZA 4HUNB 3FT3B 4DVRH 3WLWC 2X05A 3QULA 1GGCL 1TETH 4LL9A 3QUMB 4NO2A 2ZUXA 4MHHI 1Q9LB 5L88H 2QSVA 3G08B 2I9LA 2HTLD 1FRGL 3NN8A 4NZTL 4AEEA 3L3OB 3GRWH 3RPIA 3KPRB 4BZ1L 2FO1A 4R4FH 3V0WL 3BJLA 3PL6C 3GSVA 3TO2A 4MD5A 4MA7H 4TYUA 4H88H 3RKDD 2Z4QA 1MJ8L 1IZKA 2XZCH 3CJJA 2UYLB 2H32A 2Z35A 4G3YL 3U2SA 3MV9E 4HK0B 1DLHB 3MFGB 4KRPC 1QSFE 5GGQH 3LD8C 15C8L 1DEEB 4L8DA 1LK3L 3HR5A 4PTUA 1I8KB 1SMOA 4XXDA 5ICZA 4P2OD 5JIPA 5LWYL 4IOFC 1TJHL 4PTTB 1AGEB 1KGCE 4JO4L 5IQ9A 4OV5B 1T89C 1QD0A 1JHLH 1RJYA 5I8EB 4OCNC 5EH1A 3M8OH 2QR0A 4I4WB 5E4EB 1RZ8A 3KYNA 1XH3B 1G7IA 1U92A 2LE9A 4N0RA 4YWGL 3IDGA 4MNGB 4X6CA 4O4YL 1BLNB 1VEOA 3FB7B 1KB5L 3PJSA 5D1ZC 1AFVH 1V7MH 2YD5A 4FQ1L 1MFEH 1NGPH 4LLUB 1KPUB 2HN7B 2W92A 3F7RA 3Q6GH 4GW1A 3JV4A 3R1GL 3UTSE 1LHZA 5I8OH 5GXBB 1G9MC 3WHE0 5CSZA 2AV1A 5HJ3B 3QDMD 4LK4A 2BY3A 4LNVA 2AKRA 4MDIA 1M7DA 5F1IA 3O6KH 3HCVA 2ADGA 3Q48A 3L3IA 3QWOB 1TQCC 4NBXB 3P11L 4PYHA 5EO9B 4N0FB 4JR9L 2JJSC 2X4UA 3H7BB 5IHUH 3P77B 4RCAA 2MQ3A 3B5TA 4K3JL 2X7LA 2XY1A 3U9PL 4KTEL 2QQLH 4MXVE 3E6HB 3BZ4A 2BJMH 3L5XH 3MJ7A 1EFXA 3KGRA 5I66B 3GI8L 1Q94A 2OP4L 3BQUA 3EYVB 4HUXB 1DQMH 2X4TB 3OGCB 1TQBC 3G6DH 4M6NH 2BVQA 1A7PH 4PBVC 3KPPA 1OB1A 3B2VH 4DGYL 2X44D 5AWNL 4YFLF 3UJIH 4H8WH 3MUHL 3RNQB 2XN9E 4WWKD 5FB8B 5E1AA 1OM3L 4MNQD 3NGBC 4JKLA 1NAMB 5I2IA 1L7TH 1MHEA 5GZND 4U1LA 4OLYH 3WFEH 4W81A 4TULH 4TUOB 1SJXA 2CK2A 5HVWA 3GIVB 5LBSH 2YBRB 3CCHB 5GZOD 2Q86A 3D3VB 5FYKU 4EUPH 4MD0A 1RZJL 2NR6C 3TBVA 3PIQB 2X42A 2YD3A 3SE8L 3I2CH 1RHHB 4HUUA 2FJFB 4JM2F 5T3XL 4LSVH 2HLAB 3QXDB 3LEYL 2PO6B 3TBYB 4P9HL 1IEBB 1U8JA 4LLWB 3OGOE 1U3ZA 3TA3C 2A6DA 1S9WB 3VMOA 1YEDB 1HSAB 2P8MA 1MRCH 5J3HD 3QZWA 4OUUB 3I9GL 1K8IB 3EOBB 1FH5L 2ED9A 3QHZH 4OD3H 4OIAA 2C1PA 3MRNA 1X7QA 1ETZB 4IDJL 1IKNA 4XCFH 4NHCH 3WKNA 1VHPA 3NA9H 4U1MB 5DYOB 3U36B 3HNSH 1R5IA 3NFNB 3SOBL 5I15L 4ODSH 3P4NA 2VDMH 2EDBA 3S35X 1HINL 1KTDB 3LN4B 1AXSB 2OZ4A 3D85A 2VB5A 3RWDB 2VZOA 1MFAL 4UILL 4OKVA 3ZSTA 3GNML 3EOYG 4WU7A 4GBXB 3L6FA 5H37H 4X7SH 5KSAA 3O8XA 2BNQD 1XGTA 2ARWA 1JV5A 3BP4B 2EH8H 5DD5L 4JDZB 3CMOL 1CT8A 2BOCB 4P4KD 3E2HB 4Y16C 1HH9A 3X14A 3D2UB 1B88A 1O0VA 1XGUA 3L9RB 3QIWA 2A9NH 1FN4A 4V2CB 5KSBA 5MHSE 3WN5B 4M6ML 2W07A 3HC3L 1K5NA 1QKZH 4YHKH 5IFHH 3UBXB 4PJXA 1KJMA 2HFEB 3WV0A 4M6AA 1FCGA 2J5LC 4YFDB 5ETUB 2XQBH 4G6JH 1KIRA 2HA1A 4F7MB 1JVKA 1IC5H 5F6IC 2FCBA 1G9EA 1Y18B 1MF2H 2VWEC 3SDCB 4Z7OF 3RGVC 2VXUH 1EA9C 1MCDA 3DETC 3T3MF 1E27A 4GG6B 2FHCA 1ZE3C 2F5AL 1JCKA 2NY0B 1IJ9A 3IDIA 3D25A 3MRHB 4OM0H 4W70A 4F7CB 5HYQB 1P6AB 1BIIB 4JFHE 4EBQH 4ALAL 2C5DC 4OFVA 5E8OA 1C8PA 3K1DA 4HUVA 3O3BB 3RRQA 1HQ4A 2ZUQC 1UB6A 3O81A 1A6VH 4NO3B 1U93B 5DUPL 5KSUA 5D7LA 5BMFH 5TJWK 5BV7C 1JPFB 2VLJE 3NACH 4YPGA 2E7MA 3RTQB 4FFVC 1AHWB 4RAUA 5D2LA 4NCC1 3L7EB 1AGFB 1B9ZA 4NWUL 5J89A 4ZSOB 5GGTH 5GPRA 3T0VA 2DDQL 4X5LA 1L9NA 3GSWB 2H2SD 1F97A 4PB0L 1T6WA 3ARSA 4NQXB 2GITB 2G60L 1CICD 2CJUH 3FN0L 4HZLA 4BK5A 5E6IA 3VD7A 3IXAB 3LOWA 5I17A 3JWDL 2C4XA 2FBJH 1FFRA 2VXQH 3B9KA 3CFJB 4FQXA 2P5EB 3VWKD 3MRBB 1OF2A 5D93B 1JZ7A 2DLFH 5FUCC 2VZVA 5IGXL 3HUJB 1SEQH 5BW7A 5I1LA 4HIHA 1H3UA 1FNGB 4U3HA 2NY6D 1S7UB 4NZRL 4YXLH 1CDYA 1ZA3A 1BFOB 1E4KC 3JXAA 1N64H 4JRYA 1F6AB 3LMJH 5C0NC 4XBGA 4ZFZB 4GG8A 2HKHL 5I0DA 2FSEB 4HBCH 2Z91B 3X11A 4KMTL 4XCNA 3VA6A 5MEPB 3TVMD 3BP6A 4FFWD 5ICXA 3WLBA 4PBXA 3BDXA 4OTXL 1N59B 5L8KB 4AMKL 2R0LH 3MLWH 4X4YA 2E7HA 1BEYH 3V6ZB 3FB8B 1MCRA 1A22B 1FVDA 4K7PX 3U0PA 4TTDC 3NIDE 1NJ9B 1CDUA 1BVLB 1AGDA 1A1MB 1SY6A 2PR4L 2CKBA 4R97B 3CD4A 5HHQA 1T1ZA 4HUMB 3K8KA 2YRZA 4ONFH 5D1QA 5KS9F 3QDGB 3Q6FB 2CH8A 4MNHA 4X7EC 5IF0B 3IS1X 2JELL 3SQOL 1I3RB 3RVTD 3FO2A 4XNQB 4JRXD 2C3VB 4E41E 3D0LB 5F70A 2V7NB 1CXLA 2YN5A 3GDBA 3WE6A 4WNQA 3G6JE 2AAVA 1QYGL 5CCKH 2FJGB 2GQHA 4PLKC 4KAQH 3CX5J 2FD6H 2A6IA 2PXYB 1A7BA 4PJEB 4I3RL 3EDEA 4O2FA 3QG6B 3ILQD 4XX1E 4WW2B 1RIUL 5IEHB 3SO3C 1CFBA 2IPKB 5GGSB 3V9FA 3QHTC 3FQNB 4RFEA 1FFPA 1J88A 4XNUL 3VXPA 2J8UF 1MCEA 4J3WA 1AKJD 5JIIA 4GAFB 4J7RA 2IBZX 4MYWB 1TDQA 5IHBA 1LVEA 5K59F 2WWKT 1OSZB 4KKAC 2H9GB 4WI4A 4LKXA 2GJ6D 4YX2L 4QRRD 3TIEB 1WTGT 1DVFD 1V7NH 3D39E 4PGDA 1I7UA 2R29L 4NO0B 5EOTB 3VXTB 1MFBH 1YC7A 5EOQH 4U1HA 4Y5VB 5I1HH 3EYSL 4LLQA 1NGZA 3DMMB 5E70A 5JDSB 1MLCA 1YMMB 1MUJB 4V2BA 3QISA 2F74B 2ILLA 4HS6B 1DQTA 1SEBB 5FUZL 3BZFB 1JZ8A 1AH1A 2Z4QB 5A43C 35C8L 2X4PB 3ARRA 5D72L 5DMJB 3T77A 1CD9B 3U2SB 4Q58C 4BFGA 4NSKA 3L5IA 3GKWH 4AT6B 4PJGE 5I1KH 2J8HA 2Z92B 3CXDL 4XMPH 4NQEA 2ZJSL 1U3YA 2D0FA 3GSQB 4HKBA 1K6QL 4ZYKB 1AI1L 3K4AA 5I19L 1VACA 2DD8L 3BPLB 4AM0A 3IVKA 5FK9A 4U1GC 5LGKA 4ZQKB 5CIPA 3AREC 3VFMB 4XRCB 3B4NA 2CPCA 3D18B 3ILPB 1KENL 3TIDA 4GRLA 3ARBC 4QOKD 5JXEA 4JREC 3MO1A 4L8SC 1T21B 4O51B 1UENA 5L7XL 4I8DA 5D5MA 3MROB 2CUHA 3V79C 3ARPA 3IDGB 3QA3A 2HFTA 2DAVA 3T0EC 1YPZA 5A2FA 1PG7L 1MI5B 5AZEH 3TNMA 5HPOA 4WI5A 5ANMB 4YGVB 1YEKH 5AEAA 1DBBH 4YEFA 3PDGA 5DJDA 2R4RH 2X70A 4TSBL 5D7IF 1D5MA 2JLLA 1ZGLB 3FZUD 5E7FA 5F96H 4I77H 3HG1A 2HMIC 1OT2A 1QBML 4QRQA 4KKLD 1YYLL 2WAHA 1ZTXL 5CJQH 5DC4B 3R0NA 1JZ3A 3MV7E 3HE7A 3TYFA 4U0QB 5FYJD 4JFPA 4ZFFB 1LILA 4E9LA 1WISA 2OTUA 3JTTA 3S34L 4P2RA 3KPRD 1I3GH 1FNEB 2EE9A 3RAJL 4IEFB 3VFGL 1GOGA 2X7LB 5FHAH 2O5XH 2C7UA 5JMOC 2BNRA 4XBPB 3RNKB 3W0WE 5C9KA 3QB7C 3P9WB 5ITBH 3BQUB 2GSIB 3O2DA 3QNYB 4KK8D 5FO8A 4AIXA 3SE4C 1H3WM 2R0ZH 4L1DA 3TZVB 5KVFH 1U3HA 3MXWL 3OPZL 5SWQA 1HI6A 4UV4L 2OL3B 4A2MA 3BVNA 1IGCH 1CGXA 3VGHA 2O26U 1OSPL 5JPMB 3MNWA 3NCBB 1A6ZB 5J0BA 4MJIA 3IDXH 1IQWH 4XXCC 5C08A 3REVA 4PJ9B 4NKMA 2CGRL 3OKDA 3LB6D 4LCWB 4NKOB 2ZSVB 4YR6B 4WO4A 1YEJH 3OB0H 2YUWA 3QWRA 2AEQL 1PX4A 1FGVL 3EFFB 4GKNB 4XTRD 2A6JA 4OSUH 5D70H 1NMCB 4ZNEE 5J13B 3QCUL 3HE6A 4BA8A 4HWBL 4MLSA 5JZ7D 4PJIF 2YSSA 4NNPL 1XIWB 2DL9A 2UZIL 1MELA 2ATPB 2E7CA 2RB8A 1NAKH 4NN6B 4FRWA 1CE1L 1F2QA 1IEHA 1RUML 2QSTA 1IAOB 4HGKC 5TE7H 1G0YR 5BXFB 4YUEL 1PBYA 1CLYL 1KEMH 4P4RA 3TBWB 3P0VH 1X5YA 1SBSH 2MJWA 3GHBH 4FQLL 3EJZD 3QZWB 5MEND 4U1SA 5ESAB 4OD2A 4L9LA 1N5AB 3AMLA 2WANA 3LKQB 4MA1C 4PJ7F 3LKRA 4U1NB 4TQEH 5CGYD 1XCQA 3I50L 4M48L 1R5IB 3EDFA 4YHOL 3O3UN 4BH8A 4ZUSA 4WJ5A 4FQCL 9CGTA 3NCMA 2PF6A 1T83A 3H0TA 2ZG1A 4B41A 3IF1A 1OGAE 3G04B 3AM8A 5JOEA 3HNVL 4R0LB 3D0VA 5C07A 4R7NB 2HYMA 2BVTA 3ZKSD 1UEMA 2YS4A 1T5XB 3LEVH 5I1AB 5GRUL 1F00I 1OPGH 3OAZK 5JW5B 1PSKL 1I1AB 1JV5B 4OZFH 4RBPK 5A16B 1GAFL 4ORGB 5F7WC 3BEVA 1TJIL 3O3DB 1CTNA 5JHDA 5KVDH 1DBKL 3GSXA 4YIQB 4I0CC 1IT9L 5F7DA 3TBSB 4APQC 4M5ZH 2B0SL 3QIWB 4TSCH 4ZUVB 5D7JA 1FZOA 2E7LA 4HKXB 5KSBB 5EUKA 4DGVL 2LU7A 1IMHC 1NFDF 5FYKH 5T1DH 2NXZB 1HEZA 4DGIH 3RVXC 5FECA 1LD9A 2VIRB 4P59L 3V5HA 3HC4L 5H94A 3X3FL 3D3VD 5T5NF 4ELKB 5DLMH 5CWSA 5HGHB 3L3DA 1KIRB 1WIUA 1V8HA 2AXHA 2E8ZA 2R39A 5DSCB 1FZMA 1FQ9C 1G6RA 3DXAE 5CZKA 5L6YL 2M1KA 4EOWL 5EIIA 2QTEA 1GIGH 1YQ2A 5CJ5A 3HB3D 1UG9A 1KNOA 3WHXA 4UNTA 3QPQC 4HUWB 1J8HE 1E27B 2WM0A 3FB6A 2HTLC 4D0CA 2PO6D 3LZFL 4JFFE 3WIHL 2ERJC 4P46B 5ID0A 2V2WA 3ZT5A 1U8IA 5GS0D 3QUYC 4M00A 4PRPE 1ZVSB 2UUDK 1LNUA 1YY9C 4Z7OE 3T3ME 1LO2L 3NCEB 4HG4J 2APVA 1X6LA 4GW4B 3RKDC 4HUVB 5TFSH 3UDWA 3CUPA 4HFUH 4LAQL 2AGJH 1KTRL 3GSNL 1IARB 5C0AD 5T3ZD 1YNKL 4Q9RH 2VR4A 5FF6A 4RA0C 4EVNB 3OBAA 1A3LH 1DUZB 2ZZUT 4OF8A 4CW1A 4UTAL 4WHYG 4RQQB 3BIKB 1IAMA 4GBXD 1I4FA 3SHSA 1CLCA 3BP7A 2DWEA 1DQQA 1U8MA 5IFJB 3P0YH 4N0CD 3ZE2F 3LV3B 1WBXB 1GZQA 2X4QA 1UB5A 1B90A 1PGRB 2YN3A 4U1JA 2DQCL 1NLDL 2R2EA 2YMXH 3D2UD 4O9HH 5F9DC 3W11C 5CJXA 5I17B 3K80A 3B9KB 1BQHB 1B2WL 2I60L 3O45A 3SDXF 1JPSL 2DN7A 4G80A 4PGEB 4QXTB 4WIQA 5DMGD 1IGFH 5BO1H 3LDBC 3QUZA 3KAAA 3QNZA 2IH3B 1F6FB 5I18H 1KELL 1BD2A 3SE3A 4BZ2L 3CVHB 1C16A 5TE4H 3SKJL 4CDHA 3S37H 4QXWA 4UT7H 3RUGF 2L0DA 5MP6H 4Z7VB 3SDCD 3W2DL 1G7PB 2KH2B 5ICXB 4H26A 2EDEA 2P49B 2X4OA 2Y7QA 2NY0D 3PGCB 1IGTA 3GRWA 2B5IB 5BOPA 1J1OL 4BQ8A 2BXZA 3WNPA 4M02A 3QFDA 4R3SA 4HPOL 3BPCA 1PVHA 1N5YL 1OAKH 2J88L 3CH1A 5IQ7H 1BM3L 1AJ7L 4OD1H 4ELMB 3F7YB 2PYEE 3BDYH 3ULVE 4JB9H 1TVBA 4M7ZC 2XA8H 2H26A 4N0YH 5MENB 1ZSDB 2X4RB 4JKMA 4F15B 5DK0A 1KYOK 2EIBA 4M3JA 1S7VA 1CXEA 3SE9H 4N8CL 2EEBA 3P73A 2DJSA 2YD4A 3RTQD 4NJAH 4ZUTB 2FIRT 4WWKC 1ZLUH 3MSPA 1LEIA 4Y5YA 4JZJC 3WFDL 1EK3A 1EX0A 1D9KD 2NY5H 4CAGA 5BOZG 1KIPB 1OQOA 3TNNA 4ZTPH 4UBDD 4KUZH 5T33L 1YEGH 1J10A 2A74B 1A6WL 1TNMA 1Q0YL 3WD5H 1C5DB 1NGYA 4JFEE 5EIVA 1LEKB 1MVUA 4JFDE 3TPUB 5GZOC 2F8XC 3IETA 5F8QC 1T1WA 3UBXI 3VXQA 3CZFA 4ZOAA 5C7XH 5DWUL 5I8KL 5SWZA 3SKOA 2DM2A 5IK3A 5E99H 1K9TA 4LEXL 1QEWA 1UJ3C 5DEZA 5E2TH 4Y19A 1IM3A 2XY2A 5F88B 4N8VA 2ZOLB 2F54E 5DEFB 2W38A 1W0VA 1LE9A 4KK9D 3MNZA 2QQQA 3NPZB 2WMPA 4E42A 3FO9B 4NQCA 5J3HC 2EO1A 4NIKB 5ENWA 1M71A 2AK4B 1EEUA 1NDGA 5ESVB 5F1NA 2Z8VC 1U8KB 2VDLH 3CFDA 3K2UL 1FV1B 5K59E 1YYML 4LLQB 2CLVB 2CK0L 1A21A 1U58A 1HDMA 3O6LH 3BSZH 1A7NL 3OKKB 1T5WA 4R7DB 4X6DE 1MIMH 5FA3A 4LVOB 3WJLC 1AO7B 1HE7A 3GI9L 4XC1H 5KS9A 2X40A 3OZ9L 5D7SL 3TN0D 5D1XB 1DN0A 4L4TE 5AD0B 2JF1A 4NSKB 2ADIA 5FKAA 4XAWL 4K71C 2NW2B 4TUKL 3QDGD 4HS8L 2IQ9H 4WEUD 4KHXH 1A6AB 4ZTOH 4YHZH 2ZPKL 4ZXBA 4PP2A 4C54A 5C0GB 3CFKA 4M03A 3O0RH 1NMAH 5IMLA 4IIQA 3VXSE 4B50A 5BJTB 4GH7B 4WDIB 4DKEL 1AD9B 3PQYA 1EO8H 3DX9B 5CIPB 4N0UE 2IPUK 3QIUA 4LFHG 2PXYD 2BK8A 3TIDB 3VRLF 1GOHA 4NKIH 1JNLH 2DQGH 1MLBA 4GW5A 1NFIB 4I18A 5MI0C 2Y36H 1VFOA 5AYUL 3HZYA 4HC1H 3HAEB 4TN9A 2J8UA 1NCWL 1RULL 4PJBF 1DUYB 4G9DA 3CSGA 4UDUB 4TTGA 4W68A 1ZS8A 3VE0A 2DLIA 1S7RA 4XWGL 4HMEA 1CGYA 2W0FA 3BGFB 5DJDB 5GS1A 1D5MB 4XH2A 1QQDB 2MCPL 4G42A 1NGQH 1ZA6A 3TCXA 3QQ3A 2HT2D 4I0PA 2AJSH 1NEZA 2PTTB 2E9IA 1UYWL 5JOFB 2YZ1A 2ZSWA 5D7IE 4L4TA 2BSED 1S7WA 4NO0D 5E5RB 4XMLL 4YXHL 4FXLA 4UUJA 3PP3K 3DMMD 4NUJB 3KPMA 4WEBL 5H2BA 4BQBA 4OI9A 4D0DA 3KLHC 4IDLA 1CK0L 3ZT7A 2DQTH 5EBWA 4Y4KB 5FHBH 3ZYJA 3NFSH 3WIIL 4R26L 4XP5H 3VRJB 1MCWW 3WO3B 2AXJA 4Z5RA 3WO4C 4R90H 3QO1B 2CUMA 2JK5B 5K9KB 4NM4H 1S7XB 1AGBB 3CDYA 4XPAH 4IRSB 5SWQB 1HI6B 3ZE0F 1A2YB 1U8PB 1EZVY 3HC0A 4YZFF 1CIDA 2ZUVA 4TVPE 1PW3A 3SDAC 3U7YH 4XNZB 4PYGA 2W60A 1UZ8A 1X3DA 1OP5H 3TO4A 2EC9U 3EO1B 1FNLA 3RHWF 1H15B 4K7FA 4NQUA 1I1RA 5E9DA 3N50A 1RUQH 1CU4L 1T0MA 4Y2DB 2PETA 1D6VL 5J1TC 2OLDA 3A0OA 3PL6A 4YHML 3RZWA 4XI5C 2A6JB 1F6LL 1XR9A 5DJ2A 2AEIT 5DMIH 3IDNA 2FX7L 1H3PL 3WFCL 1OLLA 1MAML 4QNPF 5HXMA 1MI5D 3QXAA 4HKJA 1S5IH 3FOMB 1B0RB 2HWZH 3U7WH 4QYOA 4BM7A 4A6YH 3WHE1 1I1YA 4FABH 5EO1A 2RHEA 3NAAH 1RIHH 2GIYA 5JW4Q 3DHMA 2E9JA 4P4RB 4PJIE 1RAMA 5IB1B 2BVUA 2LFGA 4NYLA 4DZBA 3ZO0A 4NRXB 1T89A 2JB5L 5DXWA 4U1SB 3UPAA 5HVHB 2X1XR 3MV8E 4KVNL 1CDBA 1ZHKB 3EFDH 1OAZH 1JI1A 3O2VL 1N3NA 5C2UB 2RJMA 2VH5H 3VXOA 4IMKC 1YQVL 3FMGH 2PUQT 3BWAA 5IBUB 4FMKA 3KJ6L 3OKOB 1IM9B 3BPOB 3NCFB 5DEGA 3DRTB 3QDJE 5E2UH 5F44A 2DLHA 3MRQB 3S97C 4PJ7E 5D1ZA 3ZL4H 5FM4A 1EFXD 3IGAA 2JCCE 4O2CB 1W72H 3BQUD 5GGTA 1INQA 1G7JA 1AQKH 3KPSA 3EAKA 3B6SB 4J4PA 3TZVD 3EYOB 3F6IA 1EJOL 4PRIE 1WEJL 4XGZB 3BEVB 4ENED 1MSPA 3CFEB 1QFOA 2FIKB 4NJ9H 3ILQC 4NZUL 3S4SB 4A2LA 4POYA 3OR6A 4F7EB 3LRSA 4ETQA 4PJ9D 5E6ZA 1JUFB 2XKNB 1UWGH 1FNSH 3QUXB 5F9OH 4YGAB 1X5FA 2LU3A 4GJTB 4OZHE 4LPXA 5CZVL 4PFEA 1TJGH 1ND0A 5EU6E 4WTZA 1KB5B 4JN2A 4X4ZA 4CNIA 1BBJA 1NFDE 2D7TH 3AXLB 2PN5A 2PCPB 4LU5H 1KBGL 3RWFB 3VD5A 4XBEL 4FQHB 1I1FB 3T4YA 3WHXB 2Q1EA 4HW6A 5D4QA 4Z78A 1I9IH 3K7UA 2VLKA 5IESL 4XPGL 1MIEL 3QEHA 1I85C 5ID0B 2V2WB 3W39B 4IMLB 2VXSH 1KIQA 1G7MB 2W9DL 3BH9A 2H8PA 4OLUL 1NPUA 4MCYB 3N0PB 1H0DA 4LIQE 2AJVL 4PGBA 5HGGS 3MGOA 3CUPB 3KXFB 3TT3H 1LDPL 4NO5B 1Z3GH 4G7VL 5FF6B 3D5OF 4U6VH 1UM5L 2AEPL 5FCSH 1M7XA 4ISVB 3H9ZA 25C8L 1P53A 3X3GL 1V5JA 3LKSB 1ZHNB 1RMFH 1GL4B 4PJFF 3STLA 4QHMA 5IB3B 3O2WH 1MCHA 1SYSA 5EZIL 3I6GA 1MCBA 5JTWA 3S36L 1I4FB 1HIMH 4WTWA 4GT7A 3ES6A 4QXUL 4GS7B 1FSKB 4M7LT 2XTJC 2P24B 1I1AD 5GSRB 3SKNA 3MXVH 5IJVA 2AABH 5GRVK 3DBXB 3MLZH 3THML 4NN5B 1J1XL 2V2XA 5DC0A 5JOPD 4XAKE 2BVOA 3QIWD 1I9RH 2VL4A 1TIUA 5IMKB 3G5ZA 5DZLA 4AIZA 4OCMC 3PABA 1G7QA 3SGEI 2NXZD 2KZ1B 4M93C 1C1EL 1YECL 5SX5H 4Z95H 3OKMB 1F4AA 1J11A 3FFCE 4MZ2A 1RFDH 4HWEH 2CKNA 3FZUC 3SJVA 3WCYA 1HXMA 3SDXE 4QRSB 3MJ9H 1KLGB 3EGSB 5CLTA 1U9KA 5D96B 5LAXA 4XNYH 5LQBH 1QR1B 4O5LH 5ADOH 3GEWB 3GM0A 1GHFH 4HFWA 4L5FH 4Y16A 3UYOD 1E4XI 2O93L 4KV5F 4XHJD 1V3LA 3RUGE 3RVUD 4H1LB 1CE6B 3P9MB 4P46D 1TZHB 1MCWM 4NQVB 5E6YA 2HG5A 3AU1A 4PJCF 3INUL 4QRPE 5GHWL 2B8OT 5JUEH 3WDJA 1XZ0A 4ERSL 3MRIB 1TVBB 1KEGL 4ZS7L 3P30L 3UJJH 1BWWA 1RUPH 2NXYB 4WFFD 4PJ5E 1EUTA 3LIZH 1NDMB 2A6KB 1HH6A 3P73B 1EO7A 4D2NA 2ZCLH 4QGYA 4S0TD 4Z7UF 5LGHL 1UACL 2D7PA 3FCTA 4M9OA 3RGVA 5EUOF 3WXVH 3RX7A 1ACYH 4MS8D 4DTGL 2ADFL 1BX2B 2NX5A 5E2WH 1JHLL 4H5SA 3DI2B 2P46B 1M05A 2DWDA 2E7BA 4DQOH 5E4EC 3BYTA 5J1SC 3D9AL 4K3DL 3PWPA 2W59A 1PY9A 2AXFB 3B9KD 4L3CA 4OB5L 4Q74A 2P48B 2XG4A 4WTXA 2FX8H 5DVKA 5B38B 3VWJB 4HJ0C 5JZ7C 3VRIB 5IMOB 1VEMA 5IK3B 2JJVA 5TDNA 4UB0H 3FQUB 4UAOB 4M1GL 4F9PC 1HYSC 4NT6B 5GSVA 5CZXC 4U0RB 4M3KB 4XVTH 4JEGB 4PRHB 5L2KE 1LE9B 5SWSE 3MCLL 2J6EH 3T2OA 5IVXA 3DVGB 3ULVL 3A6CH 4NQCB 2OTPA 3RWJA 2FB4L 3MQIA 2D3VA 4PS4L 4V1DE 4LARL 4UINH 2BNUA 4OUOA 1HSBA 5F1NB 5B39B 2OXHA 2EH7H 4YXKH 4BFBD 4P5TB 1OCWH 4P2CG 5FGCE 4PJ5A 2BY0A 1H3GA 1TVDA 4TNVK 3T1FA 1QSEE 3LH2L 1OW0C 2BVPA 4C83A 2F19L 5C70A 3QFJA 2H45A 1T5WB 4M6OH 3DX7B 1KN2L 2BZDA 3L5XL 4I2XE 3C08H 4ODXB 4UTBL 2IQAA 5DHVA 5ISZE 2EXYD 4JDTL 4ZAKB 2ADIB 4IRZH 2YK1H 4WW1B 1ORQB 5JA9A 3PGFH 2RIKA 5D1QD 4GAGH 1E4KA 1IFHH 2X9YA 1FORH 4JGJA 5F93C 2VISA 1GZPA 3AROA 3V4PH 3VXUB 1BZ7A 5BRZE 4ZXBB 4KK5C 2JJTC 1FG2A 4G7YH 3MUJA 4WRLA 1DDHA 2YD1A 4C56B 4EDXA 3MRPB 3PP4H 2GK0A 4IIQB 1CFVL 3MZGB 4DUVA 1CQKA 2BY2A 2DQHL 1REIA 1M6OB 3WFEL 2ICWJ 4OIBA 5JQ6H 4JCLA 4F33B 2IH1B 1WWAX 3LKNA 3U82B 3ULSB 3ZYZA 2UZYB 1BJMA 4RX4D 3GK8H 4I18B 4LHUA 4PB9H 1L7IH 1CGUA 1N6UA 2Y07H 5DK3A 2VKWA 1IGIL 3VXRB 1GJIA 2IALA 4O2EB 3O4LE 1YY8B 3HB3C 1S7RB 3HI1A 3BKYH 2GFBA 5CUSH 1T1YB 3NABL 5C0CE 4ZODA 3VGBA 3V7MA 4LASL 3V95A 1WBYA 4M43L 5FYKE 3IFOB 4QRTA 1CFSA 1WZ1L 1QLRA 2PO6C 2NNAA 3UAJD 4P3CH 4M1DL 3WKMH 1QA9B 3UTZA 4JO3H 5DQDH 4YDKH 1N2RA 4R8WL 3BZEB 4OD3L 3WL9A 3VG9B 2AK4D 5C0DA 5HYJE 1G7LA 5D6CB 4NHCL 3NA9L 3RI5F 3U83A 1XF5B 4MAYB 3DROB 2ARJQ 4TUJB 3MLRL 3QUKB 5IKCA 5KN5B 5HYEA 2B4CH 2YEZA 1JMXA 3PWVA 3S5LA 1OP3K 2WUBH 2YD2A 4ODWB 2V17H 4WHDA 1NBZA 3BKCH 3GO1H 2ESVE 5D1XD 1DANT 5I6XB 2WP3T 1BVKB 3BAEH 5EPMB 1D7FA 2O61A 5I8CB 1HCFX 4OZFA 3PWLB 1JTOA 3HI5L 3DSNA 3E2HC 4LAJH 5DO2C 3QUMH 4XVUC 3FRPG 2GCYB 1NMBH 2QSQA 2J8OA 3BP5A 2A9NL 1NCCH 2OQJB 2R2CA 1HZHH 4RGMB 1P4LA 5FYJH 4UOJA 1WWWX 1P2CB 1NGWB 4P2QA 3WN5C 2QSCH 5HHOB 4GAYA 3QPXH 3CVIH 4B0MM 1CR9L 5GISH 3EJJX 3LPFA 4PJBA 1SM3H 2CLZB 4M5YH 4KI5D 4XNXH 4KZEL 1MAJA 1QFWM 3KPNA 4PRNA 5F1SA 3VH8A 4CL7A 1E4WH 3OKEA 4YDVA 4G9FA 1WBZB 5AUMA 2CR6A 2E5EA 4OZIA 1KPVB 1IC5L 2VL5B 1PQZB 5E8NB 2DQUH 2HH0H 2BMKA 4QT5B 3SDCC 1DEDA 5FUOH 1CG9B 1GOFA 5L0QC 5EO1B 5HHNB 4KPHL 4OIIH 3LHPH 2NY0C 1QFWH 1SYVB 1C7SA 4QNPE 5IVOA 1MCKA 4YHNB 4X5XA 3ZKMC 1B0WA 1BGXL 1DBJH 4NYLB 4DZBB 2IG2H 1FBIH 3ARWA 1BREA 1WAAF 1Q0XL 3AREA 3UYRH 4S1RH 1S8DA 3ARBA 3DYMA 4L8SA 4OCXL 5DUBB 1CDGA 5EBLA 3P0GB 1CYGA 4Q0XL 4TVPL 4XPTH 3T0EA 2HRPL 4EI5B 2MFNA 3JUYA 2EE2A 4OM1L 3DO7A 2XWTB 1T7YA 1RK1A 3CLFL 4Y4KD 3RTQC 5JXAH 3RX5A 4XMKL 1HHGB 2P5WA 3GGWB 4OV6F 1X5ZA 3DV4B 2DQJH 5J06A 4UBDC 4HT1H 4N8PA 4MJ2A 4FQJL 3DX6A 4IRSD 5IT2L 4P23B 4WWID 2VN4A 1X4XA 2J7LA 2VZUA 5GGVH 2QHRL 4RAVA 1MQKH 4JN1L 3U4EB 5C08D 5D93C 4YE4H 3PHSA 1SEQL 2Q7NA 1FDLL 2FYYB 2Y6SD 5EBMA 4YBHA 3OAUL