2A6KB

Crystal structure analysis of the germline antibody 36-65 fab in complex with the dodecapeptide slgdnltnhnlr
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
222
structure length
218
Chain Sequence
EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSVYYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Germline antibody 36-65 Fab light chain
total genus 36
structure length 218
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2005-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6kB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6kB02
5DT1H 4KKLD 2AJYL 4NRYA 3L5WA 3MRMA 3KPMA 1U41A 3ARDC 2ITDB 3HNSH 3U0TB 3DSFH 5DT1L 5EBWA 3CFDB 1OSPH 5E6ID 2YRZA 4ZUSB 4ZSOA 2RBLA 4JRXD 2ZCKH 3RPKA 3BFOA 1FG9C 4QWWC 4YO0B 1I75A 3ZKXC 4Z7NF 3MCLL 4PLNC 4HJGA 3S36H 1NCWH 2HJFB 3MLWL 1CDCA 4GBXA 2HMIC 2N4IA 2EIZB 3LKNA 4JFOB 3GFUA 3QQ3A 4RMQA 2MOVA 2OTWB 4ZO9A 4F8TA 1CLZL 1KIPA 2ZSWB 3TBTB 4KJPC 3NAAL 3V52L 2AP2A 3EZ8A 4QRSB 2H2SC 3VFUB 1I7ZB 3NH7H 1S7QB 2Z35A 4D0BB 1VENA 4O51A 4HJ0C 2YMXL 3P0VH 4BQCA 1U93B 5DMKA 5BMFH 3LEVH 3PIQA 2PTVA 3WFDH 1EHXA 1YEEL 3HE6D 4JKLA 5I18L 5I1LA 3MV7E 4ZPVB 4NZTL 1CXIA 3VG0H 4OM0L 2Y23A 4NNYA 2A2QT 5EUKA 4YHNB 1DEDA 4BM7A 3I75B 3RPIA 4RDQF 5EZOH 5FO8A 2MWCA 4LEOB 5CHNB 1E6OH 4FQJL 1BX2B 5EPMB 4JO4L 1DQML 1F2QA 3TH4T 4JFEA 1HZHH 3DMMD 4KWUA 3WL9B 2OMNA 4LVEA 2EDKA 4XAKE 4KV5F 5CJOL 1VKXB 2CXKA 2EIEA 1PKQB 1PZUB 4ODWB 4OZHB 3IFNL 1AXSB 2PXYA 4P5TA 4JANB 1NSNL 2ORBH 3QDJD 1N2RA 5GJTH 3TA3B 3UZQA 4NZDA 1I1AD 5HI5D 1I1AB 5D7JC 3RWJB 5CEXA 2M26A 2JIXD 3PJSA 3KPTA 4QHLA 4MXQC 4DZ8A 1ZE3C 4HWEL 4G8FB 1HYSD 5HDLA 3FB5B 4XP9H 1OCWH 4YFEA 1RAMA 2H9GA 3MLYL 3MBXL 2ZKHH 5BVPL 3SO3B 5EORL 1MHHB 3CK0L 4PUBH 4X6CE 2PO6A 3QEHA 2B4CL 3HMWH 1NMCB 3L6FB 4LCWA 1A6ZA 1AD0B 4HUNB 3F7VB 5AAWA 2Z31D 4FQQA 5DS8A 5IFHL 4NKMB 5D8JH 3KPRE 5JR1H 3TH3T 2HH0H 3MXWH 1MJ8L 3FQTB 5E08L 1ZHNB 1JF1B 3VDBA 1R3HB 4AZ8A 5GGUA 2PO6D 2Q8BH 3VXME 3BPLC 3JSSA 4OF0A 1WCBB 3T0WA 1DFBL 3IU3A 3RY4A 1PQZB 1LEIB 5I1GH 3REVB 5JPNA 5JDSA 1X5AA 1G7PA 4PRHB 3SJVE 1SVZA 2K9UA 4LKXA 1RMFH 3PV7A 2PNDA 4PFEA 4P59H 5I19H 1BWMA 5GS1C 4PLKD 1QLEL 2CDGA 1F5WA 2OQJB 1H5BB 1I1AA 5C0FA 3WNPA 5ACZB 3MNVB 2YXMA 1CICB 3T0XA 3BXNB 1D5BA 2Q86B 5F7EH 3GSWB 2Q6WA 1YYMH 3DO3A 4C4KT 3UBXA 3DROA 1DBBH 1J5OH 4XWGH 3O3EB 1JYNA 4FMKA 3HAEH 3QB7C 4NO2B 4F37K 1X5IA 1N4XL 3MACL 4WHYG 4P2YA 1MHPH 3N50A 3PHSA 3QUMH 1R24A 1QLRB 3X11A 1J8KA 3KPPA 1JK8A 1RUQH 3OG4B 4U1GC 1RQ5A 3WS6A 1PW3A 3MLSL 4YEEA 3ZDYF 1U3HB 5K9QI 4IIQB 1Y6KR 1JGUL 3BQUA 2DMKA 5EULV 1YJDL 4PJBF 2IH1B 5IQ7L 4HIEA 3IDGA 2ZUVA 4JQVC 3FL7A 2OL3H 4JFEB 3FB7B 2DBLH 2CGRL 4YHYC 5F7UA 5L2KD 1LEKA 4DUXA 5D7IA 4X7CC 4ZOCA 3DXAA 2EDFA 3LH2H 3OR7A 4L1DA 4Y0GA 3X3GH 2J4WH 3QYCA 1KLFA 5GGQH 4JFZH 4F9LC 5F7DB 5ISZE 1CXEA 5FUCE 3S4SB 1ZA3A 4LSVL 3S37X 3ZDYE 4GQPH 1ZLUH 2YPLA 4I2XE 5J7CC 2V17H 4R3SB 3RNQA 1BEYH 2AEQH 4WO4A 4E42A 5FO7B 2DYPA 2BZDA 3QWOB 4PYGA 5TF1H 4KK5D 4N8VB 1KV3A 3F6LA 4U1NB 2GJ6E 1OAYH 4ELMB 1XCQB 3U1SL 5C8JB 1NGWB 3KPQB 2VAJA 4HEPG 4BH7A 5KSBE 3NZ8A 2IWGA 4L4TA 3K8KA 3HC0B 3AVEA 3PWPD 2QR0A 3OJDB 1NC4B 25C8H 3BPNB 2NW2B 5L8KB 2GHWB 4OTXH 3T0EB 4XBGB 3KLSA 1INQA 2NZ9C 5EO0A 5D8JL 3KYNB 3MA7B 4JDVA 1PJ9A 1FG2B 1JNHA 3O8XD 1KB5A 1UYWL 4O2EB 1A7RL 3ULVL 1YC7A 4KJWC 3GSOB 1J0HA 4LFHG 1WISA 2ARJQ 4XVJL 1AQDA 2HJKB 4HQQL 4Z8FH 4X7EC 1RJYA 3C60D 3UYRL 4XP9L 3QDAA 2JB6A 1OARL 3IDMB 1A7OH 2FB4L 1M7DB 4X4YA 1NQBA 4LCIL 3UO1L 2VZSA 4F7CA 3CX2A 1HOCB 2V7HA 9CGTA 5HDBF 5DHYB 3DVNA 5E4EC 4RZCA 2FECI 4PBWD 2LVEA 3NABL 4PRDB 3QXAB 2H1PH 4U7SA 5F7KC 2I9TA 4ZUTA 5F8RC 4DQOL 3BWAA 3NGBC 3I3EA 4HWBL 1CLOH 4ODHL 1MFBH 3IVKA 3MLRH 3WIIL 3LDBC 1E4XL 2OP4L 5CEYA 1IGCH 3MO1B 5CSZA 4XWOC 1Z9SA 5J6HB 5EU6D 4G9DB 5HVHC 4MS8D 4ZD3L 3WIFA 2VLLA 3KPRD 3RZCC 2NY1D 3IYLW 2AXFB 4J8RA 4B7LA 2I07B 4N1HB 2J3SA 1I9IL 4I4WA 4Y5YA 3V5KB 4EVNB 2NY4C 1OWWA 3OKDA 5MI0C 3I50H 3VCLB 5EOQH 3RUGA 5IROC 1ULVA 4DGVH 5CILL 2DLGA 2NLJA 2AJUH 5CP3H 3AGVA 3SGKA 4GMTL 5H2BA 1QFWM 43CAA 1BF8A 1BFVH 1G7QB 2GT9A 3QH3A 4WGVB 3V52H 4FFYL 3GHBH 4ZXBC 2GY7B 4EDXB 3MREB 3RWFA 5ESQB 1CFNA 1R3JB 2ADGA 2XQYK 5J12C 3V5HB 3TNNA 4HUMB 5C09A 1AXTL 1X5KA 3SDDB 3RI5F 4XX1G 4ONHA 2RQ8A 1RIUL 2VDRH 5DJ6B 1QD0A 5GJSH 1MCJA 3QDGA 3TCXA 1TJHH 4Z7VF 4XB8A 2DDQH 1G9NC 2F19L 3L7FB 4C58B 5I1DB 3GUTB 3HI5H 3VXSB 1L7TH 5J57B 1PG7L 5IMOA 4ZQKA 2P46B 3F58L 3QO1B 4PGCA 3ROLA 5L0QC 4JZJB 3K2UH 4ZFFA 1UWGH 4GMSL 3MA7A 4M8QA 4LCCB 3VU2A 1CD1A 1NFDB 3MNZB 4FQXD 4LAQH 4IRZL 4WV1C 1QFOA 1EAPA 4EN3B 4KRPB 2WBKA 2W9EH 1EEZB 1U92B 1FNEB 3LN5B 4RFEA 3U82B 2ZP0T 2RFXA 2VRAA 1MWAH 1WFOA 2Z8VC 2E3VA 2ZWLT 4A2LA 3F5WA 2X4NB 2BSRA 4YXKL 2OXHA 4G8FA 4TVSa 3FFCA 4ZO7A 2ATKB 3A6CL 1BVLA 3IAGC 2LQRA 3CC5A 4XNMB 1T20A 3C2AL 1KFAH 3RGVD 4FQ2H 1F4YH 4U6VL 4RGOH 5I1HL 1P4IH 1HH6A 2QADC 4BZ2L 1T1WB 5DF0A 1ZANL 2D7QA 4X9IA 3MRPB 3OF6D 1L7IL 5DA4A 4GJTB 1UZ6F 4ZAKB 4R26H 2HRLA 2O61A 4RISL 3BQUC 2ITCA 1IGIL 4HS8L 3FQWA 4LVOC 3LOWA 1IM3B 3B2UD 1AJ7H 4BKLB 5C7XL 4XNZB 3T4YB 3QPXH 1KEGL 4X5WA 1T4KB 4U6HA 2RJMA 3GI8L 4JZJA 3P4OA 1YEDA 5AG8A 1YQ2A 2XZCH 1NUNB 3IDIA 3QUZD 1MI5B 4Z6AT 1UJTA 2DLTA 4FFZH 1F02I 1OGTA 1N6QH 3MXVH 1U8NB 5IVZA 1A1MB 1GAFH 4QT5B 2YUZA 1U92A 3BEWA 3O2WH 4JGUA 1P7QD 2WBWB 4PRHD 3BGMB 4TSCH 1LEGB 5CGMA 5I75C 3D39D 4MD4B 3UZVB 1BIIA 5M7QA 5ADPL 3ARZA 4AK1A 4KJQD 2R0LH 1HIML 3DX7A 3NFPB 1QNZL 3TC9A 4OLWL 1CT8B 3RUGF 4EDXA 2N1KA 2YD9A 3S35L 4ZOEA 3EYVB 1A7QH 4LKCA 3G5XA 1T20B 5D93B 5KVMC 5H8DA 2DQFA 2X09A 3L5HA 5EWIH 1MJUL 2X41A 4WU7B 4LVOB 4EOWH 4LCYB 4PRHE 1MCIA 1MCQA 3JV5A 4H5SB 5GIRB 1Y6NR 5K9JH 1F6AB 1X3DA 1IZJA 2EE3A 3DURB 5TPWL 3D25A 1OL0A 1ZAGA 2IG2H 4GG6B 5EBMB 4OCWH 4EUPA 4WFED 5CEZE 2IH1A 4MQSB 3HZKB 1MCLA 3MMEA 1K8IA 4G80A 1BECA 2ZJSH 3SDYL 15C8H 1I8LC 1FJ1A 2CLRB 2YSSB 3MTRA 3VGEA 1AH1A 5M94B 1KCVH 2VLRA 3FFDA 5FIEA 4G6JL 4JDTL 4M8QB 1AR1C 2P8MB 3HC4H 3BKJH 2KQNA 5FOJA 1I1YA 3QFJD 4GLRI 5EOTB 2BVYA 3RAJH 2EO1A 2YUVA 2YOCA 4P4RB 4QTHB 2IPTL 4RGND 1RIVL 1GGTA 2HFFB 3O4OC 4MD4A 1CDUA 4PJGE 3T3PF 4I0PC 4YQXH 4OSUH 1BZ7B 5T1LA 4N5UA 1N7MH 4XCEB 4PREA 4FTVE 3UC0H 4KKCC 4TN9A 4HUUA 2DOCA 4NHUB 4NZRL 3MV8A 3U4AA 2PYFA 3V6FB 4C56E 3OPZL 5CGYC 4R8WL 1TPXC 2DTML 4LLQB 5L6YH 2ZOLA 5C70A 3BAEL 3T0BA 3K4AA 5I1CH 5BXFA 4UILL 4TRPL 1DDHA 5HD8D 4WW1A 1HH9A 5D1XD 3EDFA 1S7VA 4K7FA 4LK4A 5EU6B 1F6AA 1NBZA 1G7MA 5DXWA 5HPOA 3C6LD 2Y7QB 4I5BB 2MHAA 4X6EA 3FN3A 4I3RL 4OD1H 4HFWA 5A3IC 3MBEB 3C5JA 3MRRA 2AJUL 2DKMA 5FF6B 1K4DB 3ZE1F 3WNOA 1EDQA 5JXEA 1GOGA 5F9WB 3WL9A 4M8VA 1TTGA 5CLWA 2WANA 5EU3A 1NMAH 4I8DA 1CL7L 4FMFA 2LU3A 2VZTA 1WLHA 1RUAH 1FDLH 1E6JL 5DD0L 4ZS7L 1JIBA 2D4DA 1PEWA 3FRUB 4P2OA 1XGPB 3WO4B 3ARGD 1J86A 3JWOL 5CEXB 3VFGL 2MCPH 2VNCA 3O41A 2DKUA 5J06A 5LVEA 4HEME 2NTFA 3HC4L 3VRJB 5CJXA 1KCVL 3UTPE 4YIQA 4G9FB 5FYJH 1P7KB 4U6YB 5I8CB 4OM1L 3ARDD 4UQ3B 5DWUL 3TYFA 4MXQD 2LVCA 1B90A 4RMVA 1EJ6A 2HVJA 4BFGA 3WD5L 3KS0J 5I30H 3WMSA 1GCFA 1S7QA 3O6FC 2NY0B 2Y36L 2UWEA 1OLZA 5SWZA 3BISA 1EFXB 1G6RB 5I2IB 2CR6A 2XZQL 3TNMB 4IDJH 1U8HA 4GRWH 2NY7H 2XKSA 4LPYA 2HKHH 4FQIL 4OFDA 2EEDA 2FZ3B 3AMLA 4XVTH 1XF3B 4KGJA 3BDXA 5HHPB 2FJGA 3GJEA 5CMAA 3UTTD 1P84J 1NANI 2E8YA 1HKFA 5EN2B 2VERN 5GSRA 2YPVH 2P5WA 4NNPL 3ZDXE 5ETUB 3JZ7A 4HK0B 4NNPH 4QRRE 4U1KB 2Q7YB 2G2RA 4XRCB 5GGVY 2A77H 1HXYA 2X2YA 3QFJA 1QHPA 1KIQB 5GGSY 5IVXB 4DUWA 3JV4A 3U46B 3DX9A 3MV8B 3SKJH 4JQIH 1CFNB 1R3JA 2ADGB 2D03L 3S88H 4Y5YC 1I85A 2DS4A 1S8DA 4NRZA 2OJEA 4W70A 4KJYB 5H35B 2W1NA 1R24B 3L3GA 4Q74A 3GIZL 5FOBA 3U4EA 1NEUA 2HFEB 2Z8WC 3U7YL 3S96A 3AU1A 3ALWA 1U8IA 1KG0A 3QUKA 1VGKA 3MZGB 4K94H 4PRPA 1Y18B 3BUTA 3BE1L 1UH4A 3I6GB 5EU6E 3EO0A 3UPRB 1MJ7H 4Y1AD 1WBZA 3FB6B 5D2NE 2R2EB 5HYSG 1T7VA 5C0BA 5FYJL 3X3FL 1IT9H 3L3IA 1MCNA 3V7AG 4V1DB 1UCBL 2CGRH 5DRWB 1ZT1B 4AY0A 5E5MB 3BO8A 4YFDB 1OM3L 1RI8A 3C2AH 1JPFB 3T0VA 2Y36H 3JV0A 4JVUA 3C8KA 1J8HA 1N8ZA 4MCZA 1WFUA 2L7JA 5C6WH 2ICCA 4A2MA 1MH5A 5BV7B 2AJZB 1D3CA 1OAUL 5IVXE 5BVJA 3DX7B 3RTQA 4DZ8B 4HMCA 1CFSB 4I0CC 1U93A 3QI9B 4Y4FC 1G7LA 5JHDE 3U4BH 4NZUL 3I75A 3RVTC 2Z31C 3U9UB 3VI4E 5A2LH 2R4SH 1YEGL 4NUJA 3R8BB 5BW7A 4KK5C 1RULL 4D8PB 3QIUA 1EJOH 4HK3N 1WIPA 5KANG 2Q87A 1LMKA 4TRPH 3X12B 3GMQB 2GK2A 2GUOA 1CK0H 1I3UA 3TNMA 5SX4H 1NL0H 2O93L 2BJMH 3TBYA 4N9GB 1UZ8B 2ADFL 4NQED 2ADFH 3MA9H 1DUYA 5IB5A 1RMFL 3ZE2F 2GEEA 1QSED 1Z2KA 1YN6B 2YHGA 5GJSL 2DTMH 3SE3C 5IF0A 2APXA 1AXTH 1L9NA 4ETYA 4D3CH 4G6AC 1AO7E 2D7OA 3RWGA 4PG2C 1FP5A 5T3XE 4GG8A 1CL7I 4OLYL 3NFPA 1D5XA 1WQVT 5HHME 4E5XA 4KMQA 1J10A 4Y19E 2VLRE 3S37H 1UQSB 2XQBL 2BDNH 3FT2A 1DSFH 2D9CA 3BAEH 3BGFB 1MI5E 4LCWB 1TVHB 1X7QA 5FM5M 1F58L 1G7LB 1JP5A 1K6QL 4S0TD 4IHOA 1MHHA 5KN5A 3SDYH 1A1NA 5EFIB 4WW1B 2XFXA 3SQBA 3V7AE 1QLFB 5FYLH 1VFMA 1YNKL 2YPLD 4QHKI 5F7HA 3TIEA 4OGXL 4GAFB 4N9GA 3EFFA 2P5EA 3DVIA 4JKMA 1S7UB 2ORBL 4PP1C 4H1LA 3MZTA 4HH9A 4R6UA 3L5JA 5L8JB 3ARGB 5C0BB 5I76B 5GRUL 4ZUWA 1MCWW 3V6ZA 5DFVC 3D9AH 4OF6A 3K1KC 5C0CD 1RV6X 1IM9D 4LMQE 3REVA 1WVZA 3MLPA 2B0SL 4P2OC 3TIDB 1D5IH 4WHDA 5TE4L 3S5LB 4M7JH 4C59B 4OLVH 4RIRB 2EH8L 4FQJH 3D2UB 1GXEA 3MFFA 4BSWB 2R29L 5LXGL 2APVA 1FYHB 1ZMYA 1SYVB 4KTEH 5ANME 5MP6L 1BMGA 1OAQL 4PJCA 2AK4B 3HE7A 1R3IH 4PJGF 1KEGH 5CINL 4L8CA 4BQ8A 4Z9KB 5IQ9A 4LQFL 4NO2A 4M00A 5D1QA 4PYHA 1VADB 5I0ZA 2GYSA 1P7KA 1T0NA 1KBGH 4RBPH 1HE7A 3X11B 1T0MA 4JRXB 4ELMF 2XTJC 2X4TB 1K8DB 4F8QA 1JZ8A 1BFOA 3QPXL 2YPVL 5D1ZD 3LSOA 3TT1H 4JO1H 5E8OB 5GS0L 2NY0C 3CUPA 5IB1B 3FRPG 4JHAL 4JO2H 3AS2A 4FQ2L 3PE9A 4K7PX 4OIBA 4IOIB 4JHBA 3D3VA 1UM5L 4QO1A 4ONFH 3BOVA 4MHHG 2HWZH 1F90L 1GGUA 3OKLB 1SHMA 5BOZG 1RSFA 2DF3A 1YEFH 3I85A 4OCYL 3TF7C 4H0IA 3KNBB 4PJGA 5HGBB 4MB4A 2C7UB 2ZNWA 5ID1A 3H9SD 2V7NB 1KJ2A 3NOIA 4Y4KC 2XPGA 5FKAB 1F4XL 1MCPH 1N64H 3DYMA 3GBLA 5IP4A 3GMPA 3CMOH 2WINA 2Q7YA 4U1KA 1H3UA 5F9WC 3UTPD 4NM4H 4JFPB 4S1QH 4RGMC 1XF2A 5LG1A 4YGVA 3BHBA 2SEBB 1KIRA 1A7NL 5ANMB 3FOLA 5IW6A 1D5ZA 4YHKH 4CUCA 2XTJD 3GMMB 3BZEB 2D7NA 3VFGH 4BFBD 4TSAH 5GRVK 3G5YB 1HI6A 2FRGP 5CJBA 1U8JB 1UWGL 3ROOA 4YBHA 2Y06L 1GJIA 4ZAKD 2FHCA 1X5YA 1BGXH 3F58H 1K2DA 5GZNC 5FA3A 2BHYA 3CAFA 3SGJC 2B1AH 1M6OB 3EYOA 4Y19D 1NC2A 4UNTA 1KT2A 2W9EL 3UTTE 3E2HC 1VGKB 2ZSVA 3K3QA 3IFLH 4U31A 5JDJA 4Y4KD 1HHIA 1AQDB 1I3RA 4I3RH 5I76A 2E7BA 5IBUB 5B38G 3MLXH 5FYLD 2EYTA 2GK0A 2ZCLH 3QNZA 1P7QB 1QSEE 5IWLC 4EVNA 2K7PA 5I1JL 2QQLL 3TEUA 5CBEA 4ENED 3KXFE 1I9IH 4ZXBD 1D6VH 1MCCA 3QRGH 1BJMA 3HMXA 4LFHD 1XGTA 2I60L 4L8DB 1TJIL 3FQRB 3U7WL 2J6EH 4LSSH 5L2KE 4MD5B 4R8WH 4QXTA 1MAKA 5FCUL 4HG4K 3L95A 4ZAKC 1MIML 1D5ZB 3FKUS 2BY1A 4DCQB 4KJQC 4RFEB 4KKAD 3BT2H 3WNMA 4EI5B 5H35A 4HPYH 4L8SB 4MCYB 3GSXB 4OFYA 4OSUL 3O3DA 3M07A 3O3AB 1U8JA 1CLOL 4ODHH 3F5WB 3IETB 3KXFD 1IEAA 5HI4C 5BJTB 4NN7C 5HGDA 3C8HA 4U33A 4YJZL 1RU9H 3QEQD 1I85C 5HJ3A 2B4CH 4K07A 1DANU 1NC2B 1IQDA 4F9LA 1ZGLM 4ODSL 2APFA 2C3VB 2EKSA 3KPNA 3L3HB 4ZFFB 3WXVL 1G7IA 1A4KB 3SE3A 4WV1A 4MXWL 4G42B 2O61B 4OCWL 5EU7E 2D31B 2GFBA 4ZUSA 5CZVH 1ZTXL 4WCYL 3UO1H 4GBXD 3UX9B 1EERB 5F72S 1JPGB 2OI9C 1QSEB 4XVUD 5DVNA 5C07E 5D96C 1FYTD 4JFQB 4PGDB 1W8NA 5HY9A 2AAVA 2A73B 5SX5H 4Z95L 2H1PL 2BVUA 4NGHL 1UVQB 1DLFL 1UACH 2P8PA 2X44D 4JFFA 4JY4A 4OLEA 4WDIA 4XBPA 3VWJB 3G04B 4PJ7B 5DURB 4CL7A 4OZ4B 1CFTA 4QF1A 1E6OL 3ARQA 3BP4A 1S7SA 4LEXH 4LCIH 2R56L 3OJMB 1AKJB 4OZGA 1KLGB 3HG1D 2H8PB 2V2WA 4TSCL 3L5WB 2G60L 3MRMB 4PPTA 4Z8FL 2P7TB 1FYTE 3D39E 1DQMH 1YY8A 1KJ3L 1S9WA 5FCUH 3CD4A 1NMBH 3N1GC 4FABH 2CQVA 1UB6A 3L3OB 3QULA 1Q9LA 4G3YL 3UTQA 1RK0A 2HJFA 1T6WA 1OF2B 3CVHL 1GGBH 5BV7H 1CR9H 3RJQB 1J18A 4NKIL 1W72B 4L4VB 1MOEA 2Y25A 5IJKA 4S1RH 4OGZA 2JIXA 4BFEA 4NO5A 1HQ4B 2A9NH 5A3ID 4H1LB 4OM0H 4Z7WB 2L7UA 5I0DA 4PB9H 1CFVH 1R3KA 4FTVD 3T08A 1HHHA 3V6ZB 5TGBA 1OP3H 4MDIA 3U7AA 5BQ7A 1PZ5A 3LPGA 5E2JA 4KROB 1JN6B 1Z6JT 2A6JA 4PBXA 3ORJA 1OAZH 3SJVD 3TO2B 3IU4H 2YBRB 2DM2A 3V9FA 2CO7B 4BK4A 1OTSC 2VDOL 4UB0L 4YE4H 3LB6C 2VLRD 4YHML 5K9OB 1A47A 4X4ZA 5F7FA 1JWUB 3IJHB 3NIFE 3TYFB 1RJZA 3CFJB 3GSXA 4ZNEA 4I0KA 5E4EB 5ICXA 4PJ8D 1BEYL 2WUBL 1RUQL 5T1DH 5EO9B 3ZKXB 3QXDB 1WV7T 5BJTA 4OI9A 4ELKB 5IHLB 2P5WE 3B9KD 5IBLC 3RBGA 5C71A 2NMSA 3SQOL 4Z7QF 3LKRA 4L29A 3BZ4B 3IKCA 1ZKAA 5E6IB 5CHNA 2Z4QA 4GMSH 4ZFZB 1T4KA 4HH9B 3O6FD 4DKAA 1A4JA 3SQOH 1R5VA 3B6SA 3IDNA 3RRQA 3VFRA 2OL3L 4PB0H 3EYUH 2BVQA 1V8HA 1ADQL 1FNSL 5I16B 4Y8AA 3WHXA 1J5OL 2YC1A 2Y07L 4DAGL 3GSQA 1A1MA 1BM3H 2BXZA 1GPOH 5ICYA 4HXBH 4PJXE 1CVRA 1CBVL 3QQNA 1VESA 2NY2B 5IWLA 2UV3A 3P40A 1CF8L 2ED8A 1OGAB 3TV3H 5FF6A 5IJKC 5JMRA 1PLGL 4LHUD 1FZJB 1NGPL 3LKQB 4LARL 3B2VH 4ISVA 4M9PA 1DZBA 4M03A 1YYLH 5KBNC 2UZYB 4CMMA 2XKUA 3ALXA 5F71A 2FBJL 4P23B 5HD8C 2FX9H 1EO8H 5DJZB 4O4YL 4UBDC 2ZOKA 1X5LA 4XWGL 2BCKA 3W9DB 4CN6A 5C9KA 1E4WL 1I3VA 2ICWA 1FNLA 5BRZD 3C6LC 5DZNA 1FC2D 1IC7H 4HGWB 3VFMB 5DFWH 2HH0L 3MXWL 5IG7B 3CK0H 4PUBL 4ZODA 1ZGLA 3VA6A 3VFNA 3EFDH 4KVCH 5KSVA 2CR3A 2FX7L 4YC2C 4HXAL 3BJLA 2JCCA 1WZKA 4NKIH 4C83A 2A6DA 5KG9B 3ZSTA 3MRKB 1SYSB 1LK2B 2R29H 5JXEC 4IRJD 3CLEL 5H37H 2BNQA 3CX5J 4L4VA 1WTGT 2JIXB 4NQCD 3IAPA 2JELL 3HTLX 3WE6B 5E03A 5IHUH 3QUMB 3WS3A 3HN3A 5JDSB 1OCWL 1EFQA 1S3KH 3CVHB 4IIQA 2V6HA 3EJZC 2XPGB 2X1QA 5GGRY 4Y8DC 3DWTA 5BQ7B 3BIBX 5F9AC 6FABH 1UXSB 1D9KD 3PXHA 2UZIL 2WUCH 4UU9B 3U9PL 1G6RH 1EGJA 2WUCL 4KDTA 4UMGA 4ZYKA 1X6LA 3FTGB 2YWYA 1S7VB 3OR6A 4R97C 4WHTB 3DROB 3SDDD 1PAMA 1TITA 2F58L 2NTFB 2L4OA 2ZOLB 1XR8A 3CH1B 5DYOB 1T7ZA 3F7YA 3MRJB 1FNHA 4NQCA 5HGGS 1I8MB 3VRIB 4PJFA 2CXGA 2EICA 5L7XL 2PW2A 3ARTA 4HWNA 3MGTA 2BSED 4HV8B 5GGUB 1UJ3B 1VGEH 2HTLC 3GBNH 2FATL 3GKWL 1DSFL 3BPCB 4K3DH 3IFNH 5B4MC 3T2NL 8FABB 5K9QG 4GUPB 3QJHA 3ME0A 4PIRF 3HNTL 3MRRB 4F7TB 1CIUA 5D71L 1IKFL 3QDJE 4NCC1 5CCKL 1MRDH 1UXWA 3HCVB 3U4EB 1MY7A 4PJHB 2N7AA 3IB4A 4EI6A 1A9BB 1E4WH 1UZ6E 2ARJA 5MERA 2HT3C 2VDLH 5IT2L 3TN0B 3WN5C 3GSWA 2Q6WB 4MJ5A 4YDLB 3KPSA 4AYFA 1MFNA 1CN4A 3LKPA 1HDMA 3DUSA 5DHXB 5FGCE 4W6YB 3MA9L 2G2RB 4XRCA 5I75B 5L2JB 1BAFH 4NQSB 1AY1L 4FQLH 5DEGA 4LHUA 4JREC 5F88A 5MEQA 4MZ3A 5KANI 3ULSB 2DIJA 1TPXB 4P23A 1RZKC 1PQZA 3KPRA 4GO6B 1I9JH 4CW1B 4KHXH 4WTZA 3G5ZB 4IBLT 1KPVA 1V7NH 3CCHA 3DI3B 3NIGF 5A40E 1IL1B 1KYOJ 3CPLB 2L0DA 2NX5E 5GGQL 3NH7L 3MLXL 3MODL 2AGJH 3Q1SH 4JEGB 1JNJA 1D6EA 3NA9L 4MXVE 4WUKH 1UJ3A 4NKOB 3VFNB 1GC1H 1FN4A 5BZDA 3JXAA 1MCHA 3QG6A 5HGHA 4WTWA 4XBGA 3LKOA 2KL6A 2DTSA 1KPUA 4RCAA 1T2JA 2X4OA 1KJMA 4BQ6A 3DNKA 2B1AL 2WUBH 1DQJA 4KDVA 3W0WB 5DJ8B 3RX8A 1CGSL 3JWDL 4OV6F 1VFBB 4PJIA 2NX5A 2YD6A 4XPFL 5MERB 1M05A 4JO3H 2JELH 1JHLH 3NGBB 3PJSB 4WO4C 3WDIA 3C08L 3HNSL 4ELMA 3MR9A 5L88L 3M1BA 1A7NH 2H9GB 3EOBB 4JRYB 1FNFA 1BD2D 3LD8B 4LF3A 2NXYB 2XWBA 2R0ZH 1DP0A 5B3JE 4WHTA 5JHLL 4P4KC 3RBSA 4HS3A 4M62L 4DZBA 1LNUA 1A5FH 4X98A 2F54B 1F4XH 5FUOH 3V2AR 3RVWC 4DKEH 4ZFOB 4DN3L 1IE5A 1OB1A 2VDKH 5I1IL 1FO0A 1WIOA 5ICXB 1F3DJ 4G7YL 4URTB 4WTXA 4HF5L 4O51B 3L3OA 3QULB 4XMKL 2AI0H 2V9RA 1NCAL 1KF9B 4LU5H 4EBQL 4OAWB 4B0MM 2O5XL 1AHWB 1DVFA 3DVGA 1CF8H 5KVGH 1JZ3A 2A77L 4WWKC 5TQ0L 2R56H 3UTSE 1YEJH 4WO4D 2CKBH 5ADOH 2NXZB 3J7HA 1A9BA 5EU4B 2Y07H 4DAGH 5IEHA 4V2BA 2XN9A 5DZOA 1J12A 5ACZA 2JJVA 3ESVF 1IFHL 1UACL 3RWGB 4MJID 2X42A 2VITA 4GRLA 4K9EL 5JUEH 3BUYA 4R0LA 3ULSA 4OD3L 2P45B 1MQKH 2GSGA 5CIPH 4FNLL 4XTRC 1JWUA 5KSUB 3IFOB 1P6AB 3F7PC 2ATPA 2E27L 1P1ZB 3GBML 4XZUB 1MRFL 2V2XA 2IBBA 4FFWD 4PJ8A 4PGEB 2NY5H 2XG4A 3GMQA 4DK3A 1NBQA 3M8OH 2X4NA 3WXVH 3BSZL 3CDFA 2DRUA 4CRPA 4F7PB 5GS2H 2JK5A 1XCTA 1VCAA 4WENB 3CFEA 2EIZA 3LRSB 5DD3H 1WJ3A 3QO1A 4PGCB 2X1XR 2ZCHH 1AI1H 4CMHB 4OAWA 5CEZH 4K3GA 4CVXB 3QXAA 3HR5B 1OD7A 2FJHA 1N59B 3E3QC 1IKFH 5F6HJ 5HPMB 3SGKC 3VWKD 2DQTL 4AJ0A 1K6QH 4MLIA 5T5NF 4ODTH 2NY2D 4JR9L 1YMHB 2XWJA 3FHAA 3FQRA 4OLUH 5C0GA 1JHTB 1MFAH 4NM8L 2G5BA 2FATH 4JR9H 4RRPA 4KZEL 4KKBD 4P2RA 4KY1L 1AIFB 1L0XA 3OKLA 3VG9C 2W59A 5I8EB 1NMBL 1CXFA 4FABL 2XWBB 1WICA 2F53B 1T80A 4PD4K 5BRZE 2VDQL 2CKBB 5HGBA 4PJCB 5EU5B 2CO6B 4KI5D 3WJJC 1DLHA 2Z31B 3HG1A 4XP5H 4XPTL 3AROA 3LRHA 4KQ4H 2NY0D 5E9DD 4XCYA 4LEOA 2DD8H 1EBAA 5LGJA 4LSUL 1U8KA 1CI5A 1CICA 2EDNA 4XVSL 5F1OB 4XP1H 3MOQA 5JIIA 1U3HC 2IADA 2QADD 3PV6B 3H9HA 2HFTA 3HC3H 2BSSB 5DDHB 5LGHL 4ZUWB 3TIEB 2OR9H 2VLKA 3ZYIA 5HYEA 1H3GA 3MGOB 2P5EB 4X6DB 4XGZB 2DJUA 5IHZA 3EYFA 1RIVH 3VXNA 5CAYB 4H26A 1NUGA 2Z92B 2ZUUA 1KTDA 4LQ1A 3GMOB 4PTUA 5JHDB 1T3FA 1NAMB 4PJ5E 5AWNL 3SKMB 2ATKA 2QL1A 4MXWH 2E9JA 1UCTA 4X5XB 3H0TA 3SDXB 1RUKL 4XCFL 3FQUA 4J2XA 5AAMA 3CLFL 2MQ3A 2VTFA 2VN7A 5B8CC 4FP8L 4F7CB 4I9WD 4YDKL 5T33L 2VL4A 3G6DL 5C0AB 3TN0D 1ZEAH 1RK1B 4Z7VA 5IMMA 4KRLB 1W0WA 4OCXL 4P3WA 4LHUB 1IC7L 3K4DA 1NAKH 3OJ2C 4OBSA 5DJCB 3QT2A 4UTAL 3HHRB 2VISB 3VH8A 1A6WL 2BNRA 2G9HB 1A7PL 1ES0B 1O7VA 2VLJB 3HG1B 1ZVSA 2ARWA 3CUPB 2GJZB 5FXCH 1H0DB 4HPYL 5CWSA 3OV6A 5CKAA 3BYYA 3P9WB 3MJ9A 4XPAH 1KSRA 3NPZB 2Z8SA 1JNNL 4MD5A 2IFFL 5HSFA 3RIFK 3EJYD 1TZGL 1VFAA 1DQQA 3WIHH 4FXGA 2PW1B 4JB9L 4U1SB 4X9BA 5KSAD 4PLOB 1F11A 4UAOC 1MQ8A 5TF0A 4U1GB 5D1QD 3EDDA 4JRYD 4KUZH 1LDPH 3O3BA 4MJ5B 3QCUH 4HKXA 4Y7MA 1R3IL 3HE7D 1HDMB 2Q3ZA 1DBAL 4OUUB 2IAND 1ZHKA 1ORQB 2DIBA 3KJ6L 1QRKA 4QNPE 2WLYA 4UI2A 1TTFA 2V2TB 1BQSA 3FQXB 2CLZB 2OTWA 1FVDB 2F53A 2HFGL 4LVNC 4GAJH 4PJ5D 1ZSDA 4XNQB 2R4RL 4RGNC 3KG5A 4P4KB 3N1PC 5ANMA 4HKJA 5ENWA 4AG4H 2DMBA 1ONQB 5CSBA 2BNRB 2Y06H 4G7VL 2LAAA 4KUCD 4Y16B 4UQ2B 1Z5LB 3VXMB 4Z78A 3MJGX 4XXDA 2IH3B 4OLZL 1AD9B 2ICEB 4RFOL 1MHCB 4LPXA 1OTSD 5KVDH 4QRPD 2BOCA 1ORSB 1F6FB 1JUFB 2FNBA 2WBJA 1TIUA 1CT8A 1FSKB 3F65A 1K9TA 1I3RB 1ZLVK 2Z4QB 5D1QC 4FXGB 4NJAH 2AGJL 5LCVH 5KVFH 2DWEA 3GNMH 3Q3GA 4S2SB 1H3PL 3WV0A 5I15H 1LP9A 4AENB 4UNVA 1A3RL 1KCRL 1YQVH 4HFUL 5INDA 1SJHB 4F15B 1YY8B 5GGVH 1YEFL 4LCWE 5FGBC 2ZPKH 3HZKA 5HHVH 5EBLA 4XP4H 3SGDH 3TCLA 3DIFB 1QKZH 1C12B 2DI7A 5HHXH 1TVDA 4NRYB 4PJXA 4UINH 3ULVF 4JZNB 2M8XA 1IEAB 3DBXA 3ZHKA 3QG7H 5B3NA 4W81A 1NDMB 1S5IL 3B83A 3DUUB 3AUVA 3ZHDA 3BKMH 5ERWA 3O6KL 5CCKH 3MRGA 1T5XB 4FQ1H 5AZ2L 4YPJA 4A6YA 3OZ9H 1CL7H 4GRMA 3HKFA 4X0KA 1IC4L 1JGDA 1WUNT 5AYUH 1UM4L 2DL9A 1D5MB 1MWAA 5HGAB 4KTEL 4L5FH 5ICZB 4ZTPH 4HIXH 1U8HB 5FK9B 3REWA 4QRRA 2X4PB 2ZUQB 3WBDA 3PWPB 4QY8A 1DTUA 1AFVL 3L3GB 5FOBB 4NO0D 3VRLE 5EIIA 1MLCB 4BZYA 4KC3B 3FCTB 3B43A 1A6ZB 1AD0A 4YHPA 3U30C 5C0CA 5A16A 1L0YA 2ADJB 2EEAA 1TETL 3C6SA 5I6XB 4JAMA 1P69B 3T2QA 1NMCC 1QRNB 4U1HA 3TT3L 4UILH 2X10A 4QHUB 3V6OE 2D7TH 1X5FA 5FCSH 1U95B 3T3MF 3VFOA 3ZKNC 4AIZA 3DIFA 3LB6D 3OBAA 1KNOA 4KAQH 4RMTA 1UGNA 5GSVB 4ERSL 1XEDA 3A0OA 1JE6A 3A6BL 4OT1L 4Q9BA 2HVKB 4H5SA 1U8QB 3RHWF 4NRZB 3GSNB 3TYGH 5HHMD 3BT2L 5JW4M 4JPVH 4UQ2A 5C9JA 5CJQL 3G6AA 3EZJB 5CP7A 1I9RH 2Z91A 4PGZA 3MNVA 2FX8L 3AU1B 3I6LD 1T03L 2W0LA 2P7TA 3MV01 4XCYB 3DJ9A 3ARFD 1BOGB 1C7TA 4QYOA 2XA8L 2IADB 3PV6A 1K3ZA 4G6KL 1RVFL 1UXWB 1XGYL 2F5BH 5TQ2L 3FQNB 2FSEB 5E8DH 4AENA 2GCYA 1KIQA 3P11L 2IPKB 3ULUD 5HPMA 1SEBB 4KVNL 3VXNB 3IKKA 4DGYL 4XCEA 4JRWA 1R3KB 4L5FL 5T5NG 1FIGL 4CADA 1NANH 3K1DA 5JHDD 1S7WA 1UC6A 2R1WB 3S35H 3DX6A 1XF4A 2I27N 2R1YA 3TO2A 1MAMH 1WFNA 2OL3A 1S9YB 5BXFB 1YN6A 2AABH 4IOSD 3MLUH 5GPRA 5HHPA 1CLYH 5E8PA 3VWJC 5DJ6A 2F15A 2R0LL 3LQMA 4YFLI 1BM3L 3QCVH 3FT3A 3ARSA 3BRFA 3VD5A 1BQHA 1SY6H 1HYRC 4MMZC 5I8OL 4X8XA 2VISA 5DK2B 5C6PB 4P57B 3IF1B 1WBZB 3BP6B 2RB8A 5D2LF 4C56B 3WKML 4ODXB 1Z0MA 3SO3C 1VA9A 5DSCB 5E0QA 5E9DB 1P4BL 3TJHC 3OKEB 4PV8A 1Q9OA 3UCRA 1TCRB 1LK3H 3QNYA 1CDBA 3EDJA 2FL5B 3H42L 2E7LC 5C0BE 1NDGA 3VXUB 4NQVB 2Y4SA 4D0CA 3DV6A 5T1DL 4OV5A 5C08A 2VDMH 4PRAA 3RIAK 3F7RA 3QHFH 1OGAA 2CJUL 1NPUA 3BH8A 3X13B 5DVMA 3CDYA 4PG2A 1JWMA 4QCIA 1UM5H 4UB0H 1S9XB 2MQCA 1DE4A 4JN1H 5DEFA 4PJAF 3V6OA 4GG8B 2V5MA 2X4SB 2F54D 4U6VH 4OD2A 1IGJB 1OAZL 3LEYL 2AK4E 2R1WA 4UT7H 4TQEH 4MAYD 3ARGA 4RFOH 4JY5L 1UENA 2ICWB 2A1WH 2VLRB 1MFEL 2A0LC 2XZZA 4RAHA 4X7TA 3LZFH 3IFPA 2UZXB 3KYOA 1MAML 2G9HA 1E6JH 4M5ZH 4JG0H 1NMAL 1NC4D 3PP4H 3PDOB 1MVFA 3H42H 3DUSB 2VDNH 4HIJA 3V8CA 3QZWA 1M7IB 2G5RA 4ONOA 2IPUG 4M48L 3ZT6A 3QEQB 5HYSA 5B4MD 1CR9L 3G6JF 1BZ7A 1F4WH 3IDMA 1RZKH 2JB6B 5DK0A 1VFOA 1YEKL 2R15A 5F3HB 2H2PC 3P4OB 4JQIL 1DL7L 5KSVB 3BH9A 3RTQB 1VB9A 4J1UA 1NBYB 1B4JL 1DEEA 2HT4D 3NCFB 1KIPB 1UB5A 1A1OA 3UROR 5SWQA 4OUOA 1R5WB 4W4OC 1QLEH 1MVUA 4OZFA 1L4IA 3QCVL 5DR5L 5I19L 5D6CA 2DDQL 3QCTL 4HJJL 3QUZB 5DUBA 4R90H 4UTBH 4MNQA 2VQUA 3MJ7A 3ZDXF 4QHKJ 3VWKA 3E8UL 1KIUA 4FS0A 3INUH 3OGCA 2C4FT 3ZMRA 1RZFL 5F1SA 1UA6H 1XR8B 4GRWE 3FN0H 3BUYB 1CGVA 4G8GE 5MEND 1IAKA 3TCLB 5EG6C 3CSPA 4WU7A 4UZGA 2IPTH 4RBPK 2APTA 5D7LD 3V6OC 2MQ0A 5A2FA 5L9DL 1KTLA 4IOFC 2VXSL 1QSZA 4QTIL 2FX8H 1NDMA 5E2VH 3I6GA 5H2BB 4Y4KB 2ZKHL 5GRWA 2WMPA 2P48B 4QRTB 1WZ1L 3CXDL 3ZE0F 4YEFA 2E5EA 2HKFL 5L9DH 1RZJH 1J11A 5C09B 1HHKB 3ZYZA 2H32A 4YR6B 4Y16C 2GQHA 2IAMD 3C5ZB 1H3WM 4QRUB 3BO8B 2WLZA 2D7TL 1DN0A 2DLFL 3MLRL 4ORGA 1FO0B 4YDIH 4X80L 1RUAL 3W0WA 1DBML 1YEHL 2IBGA 3SE9L 3W5MA 3VXSA 2Q20A 4FFVD 4PJDF 1P9MC 5AEAA 3VXPA 4HUUB 1FQ9C 3MSPA 3QAZB 3UJIH 4LHUG 4QRQB 1MCOL 3G9AB 1XGUB 1NLDH 1VPOH 1CD1B 1NFDA 3SGEI 2O26U 4D0DA 1SEQH 3HUJF 4M61A 3NCYS 1FIEA 1OARH 3MUZ1 1WC7B 4G8GB 3RY5A 1DVFD 3QP3A 3C6LA 3V0WH 1LDSA 3L6FA 1OP5K 3KLHC 4LSRH 1XGRB 2D2OA 2VDQH 1GAFL 1FHGA 4XVJH 3LV3A 4ZTOH 3VXSD 3PWNB 4P5MA 2FWOA 3ARRA 2BVTA 2MHAB 4X6EB 3B9KB 4DK6A 1YDPA 4G8IA 5EDXA 5I1KH 2EDQA 3SY0A 3OAYK 1EEQA 2XN9E 4LLDB 1MWAB 1D5MA 5HGAA 3WFHB 2YR3A 2VDNL 3C5ZC 4OZHE 4EDWL 4J3XA 2AK4A 5KSUA 3W9EA 2R39A 1GHFL 4FZ8L 1S8DB 1FPTL 5HHXL 4J3WA 5JW4R 3STZA 5DVOA 1NFDF 1S5IH 1PYWA 3F12A 2VKXA 4QHMA 4YHIA 3QIWC 1X5HA 4N0UB 4X7FC 4RGOL 4NO3B 1WZMA 1T21A 4GKSA 3HRZB 4MAUL 3HPJA 3OG6B 4U1JA 3R4DA 3K74B 4OLZH 5D7LA 2WIMA 2YD5A 3WXWH 1FLTX 2BXYA 3SBWC 1XGUA 2NY4B 4KK9C 2VC2L 3SE8H 4NJAL 1MCFA 4QXGH 3WXWL 1X44A 2HFGH 4ZFOA 4NQEE 2E27H 3GBMH 4OZIA 5IK3A 5KS9B 4ENEC 2HVJB 3BI9X 5SWSD 5FHBH 1G0XA 2QLVB 3UPCA 4YZFE 1A64A 2GJZA 4L4JA 1KEML 2VB5A 1G9EA 2CRMA 3MV9D 5DFTA 5IMOB 5EZIH 2UWEB 4P46D 1XIWB 3QUYC 2OYPA 1JTPA 4P2RB 4TUKH 5IB3A 4CNIB 4F9PC 3EFFB 3HS0A 4KUZL 4FA8A 1JPSH 4AEEA 3BKCL 4LRNH 3TBSA 2CKBA 4OLWH 4YGAB 3VDAA 3CFEB 1FGVL 1L7TL 2FJGB 2V7HB 2OZ4H 3NCEB 4HBQA 1DN2A 3VGGA 3WKNA 4EUPG 3BN9C 2C3VA 2QHRL 4YK4C 1P2CA 3OKMB 3TA3C 4M9OA 4RAVA 5H37G 2VUOA 2GITB 3DV6B 4OV5B 1S7RA 2VZOA 4XPAL 2EDLA 4H20L 5TQ2H 1JF1A 5DI8A 1MHPL 4M6MH 3V0WL 4MA3A 4IDJL 1YMMA 1CVSC 4FFYH 4N8VA 2Y6SC 3P11H 2P47B 2DQEL 5KAQG 3VXMD 1AC0A 1HSAB 4DKEL 4M7JL 5CILH 5C8JA 4Y5VA 2X1OA 3T04D 3QEUA 1XGYH 2DIAA 3Q5TA 4GBXC 3FO0L 3ISWA 2PYEB 3QUXA 1FL6B 3FAXA 4H1LH 3ZDZE 5F89A 2WIIB 1K8DA 1XMWA 2QR0B 1AD9A 2ICEA 5D7IB 5A2JH 3O8XB 1D5BB 2Q86A 4P59L 4PJAE 4ZUVA 3ULUL 5BZWB 1KG0B 2PUQT 3QUKB 3GSRA 4MDJA 2GKIA 3KLDA 4M6NH 1G7JB 1IGTA 3PNWB 3SY0B 1C5CL 5JNYB 2RHEA 1M7IA 5J13C 3ET9F 4YK4B 1QA9A 4KAQL 2UY7A 5ID0B 3U83A 3ZSSA 1WCQA 3MYZA 3LRSA 1RK0B 1HINH 1RJZB 1BREA 3DXAE 5EA0H 1WCBA 3SDDA 3MRBA 4HWBH 4E0RB 5SV4A 4CU7A 5LGHH 2AJXL 1SJXA 5KW9L 4UV4H 5E95B 3ZDZF 2FLRT 1CWVA 4K55A 1JPFA 4PGBB 5DHVH 3GSNL 3S34L 4GW5B 1J8HB 2NQCA 2W0FB 3TWCL 4Q97A 2CH8A 1DBKL 1TQCB 5D7LB 3CFCL 5BVJB 4XP5L 5KSBB 4TTDC 1CFTB 1Q72L 1LO2L 4YAQB 4N1EA 2PXYC 4P5TC 5C0GB 2CDEB 4N0YL 2ICWJ 3OGCB 2DQCL 2OX5A 3HUJB 3KYNA 4JDVB 3RVUD 4I0PA 4NDMA 3OWEA 1F8TH 4U05A 1A6UH 1BZ9A 3O4LD 5CD3A 3PQYB 1EGJL 1WBXB 3H3BC 3O8XA 2ZNXA 3IRZA 2NY6C 5F7YC 5C09D 3KYMA 4G9DA 4NZRH 1H8NA 5AD0B 1P84K 2C3WA 3PDDA 4XNMA 1MY5A 3DO7B 4NFDA 5TH2A 3NIGE 4PJ8C 4HAGA 5CGTA 1ONQA 1R5WA 3VFPB 4OZ4A 3BMVA 1SM3H 1YEKH 2AW2A 4OLUL 4RAVB 5DHYA 1VEPA 2XXCB 4RZCB 4U1LB 3QWRA 2NW2A 3MV9E 12E8H 2H8PA 3R8QA 2D0FA 3BKJL 7CGTA 4WFHD 4M1GH 3FB8B 3N1MC 1IM3A 4OGAC 2R8SL 4GW4B 5IMMB 3GKWH 1WAAA 1LK2A 3MFGB 4AIZB 2LABA 2DM7A 1YEEH 5KSBA 2VH5L 2B1HL 3L95B 3MV11 4MX7A 4MJ6A 3V4PL 5FYKU 2DAVA 3ULUF 5TE7L 3O4OB 3O11A 4BSVA 1EEYA 3GSNA 5KSAA 2NY6D 4ELKA 3DXAD 4ETQB 4M61B 5C3TA 43C9A 1U91B 5DMIH 5F1KC 1IT9L 4YNYA 1FGNL 1HHHB 2JJTA 3DECA 4UNUA 3VFMA 1JFQH 4D94A 1EUTA 4GFTB 4KZDL 4ZOBA 4EQ2A 4HPOL 4M3JA 5I1AA 4Z7UE 4U0QB 5IM7B 1SYSA 1MCBA 4O2EA 1FBIH 5CFHA 3TNNB 2FSEA 3H3PH 3P0YH 4HGMA 3RQ3A 1J88A 1MFCH 4MMXC 5CSZB 5IROA 2NY4D 4TPRL 2QV2A 5IB2B 2XZCL 5HHOE 2AJYH 3VGHA 1MRCH 2W65B 1EUUA 3N0PB 4WU5B 4JGJA 5D7JA 3EFDL 4MA7H 3HRZA 1S7TB 3VMOA 2VLMD 4HS8H 4TNWF 2ZSVB 2AEPL 1MLCA 1QPPA 4N0CC 4LLYB 3EJZD 3MLVL 1HHIB 3R0MA 2GIYA 5DJ0B 4BZ2H 1ZS8A 3KPSB 1R5IB 1BFTA 2DM4A 2GI7A 4FXKB 1TCMA 4QTHA 1PDKA 1NCCH 4UOW0 1VACA 4O9HL 3NBNA 3BIKB 3QUYA 4JM4L 2W07A 1YYLL 4J3TA 3VRIA 4DFIA 3C8KB 2GAZB 2RFXB 1PY9A 3H7BA 5JPMB 5E4IA 2VAAA 5E08H 5D7SH 2CDFA 3BPOC 2A6KA 4NQXA 2EDRA 3QNYB 4PJAA 5DD5H 2I9LA 2HLAA 2EZ0D 5JHLH 4IRSB 3EAKA 3KWWB 2HT2D 5FYKD 4N8CH 5EBWB 4K2UH 4JFFD 4PV9A 3EYUL 3DSNA 5F21B 4IRZH 3DRQA 1MCEA 4HCRH 3WUWB 5FGBA 3MRPA 4QCIB 1FYTA 4ZXBB 3ZKND 3P30H 1FZOA 3PHQA 4UOW1 2QQNH 4GW4A 4MJ4A 4IMKA 5FKPB 4MA8L 5BV7C 1I8KA 3OHXB 4OT1H 5LBSL 3C08H 3BHBB 1QFUH 5L2JA 2DQFB 4HWZA 4KHXL 2A9ML 5DC0A 1KB9J 4JY6A 2F5AL 1IAOB 3KPOA 5DGQA 5JW4N 3TZVA 3CFJA 2IANA 3S96B 3CIQA 4OQTH 1ED3A 3PWJB 2JCCF 3DBXB 4DUVA 4M1DH 2VDOH 1J05B 3WFZA 3FOMA 4HUVA 1JHKL 2A0LD 3Q5OA 1FVCB 3DMMA 3MACH 5L0QB 4JFED 1YPZB 2B4CC 2EZ0C 3E6FB 3VFUA 3ARFC 3TGXA 5CP7B 2IEPA 2GJJA 4PJEF 4GMTH 1I9JL 2EDXA 5IBTH 3MRLB 3VDCA 4M6AA 4DWHA 4JM2A 2LE9A 3R0NA 1QFHA 4YHNA 3NZHL 5ID0A 2XKNA 2A9NL 3ULUC 4OZFB 4QY8B 4S10A 3L5XL 2R0KH 4KMTH 12E8L 3NZHH 3FO1B 4K3DL 4LCYA 4N5EC 2EC8A 1FFOB 5ESVB 3EOAB 5HVWA 1SEBA 1LO4H 1MHEB 4UIKL 2DQTH 1S9WB 3HZMB 4L3CA 2NY5C 5GS3A 3U2SA 3VWJD 5E7BA 1JHKH 2C3GA 4MYWB 2XN9D 1WAAF 2PXYB 4P5TB 3JUYA 3GO1L 2W60B 1G6VK 4W68A 5KSBF 3T2NH 2ZCHL 6CGTA 2N7BA 5ISZA 3IT8D 3PWLA 3SCMC 2M2DA 6FABL 1ZA6B 4XBEH 3RI5K 15C8L 2ESVD 1RURL 3MRKA 4ZS6C 3BPNC 1XR9A 3LPWA 4X7TB 3QQ9C 5HYJB 1YNTB 3L3HA 2ESVA 3KXFB 5IIEA 4PJFE 1AR2A 3K81A 3W39A 3SDCD 4ZNEE 2NYYC 4APQD 3FRPA 4MQXD 5DRXA 4GT7A 1LD9A 4FTVB 3BWUC 4I77L 1KPVB 3Q5YA 4D0CB 3V4UL 3PL6D 3TVMD 1MJJB 1T0MB 4RMUA 4P2OB 1Q94B 4PJ9D 2A74B 3VFWA 1T2QL 5F3HA 3JBG7 4G7VH 5D6DC 3BH8B 5TQ0H 4LOUC 5DJDA 5KVGL 2Z35B 2Q8AH 3ZKSD 3I3DA 1KCLA 4Z7UA 5KW9H 1RPQA 4KKCD 2KH2B 4K3JL 5HDBE 5EZJA 1MCWM 4G9FA 2HTKD 1UKTA 1ZHNA 2DQUL 5IKCA 3FZUC 4K94C 2VLME 3ULVD 1DQJB 3D1MC 1QBMH 1T7XA 1EPFA 1E28B 1V05A 4ODXA 3D3VD 1F3RB 3BMWA 3GM0A 3GSUB 2PW2B 4EBQH 4GLRH 3GSQB 1P1ZA 4R2GD 4XZUA 4S11A 1JYWA 4NHUA 4R4FL 1TQCC 4V1DE 5TDPA 4JHWH 4WWKB 1TCRA 3U7WH 1J8HE 2IBZY 3JV6A 4XAWL 1GGYA 4HKBA 2OSLA 5DD5L 4E41D 2CSPA 5AUMA 3HI6H 3WIHL 3KGRA 3IGAB 4MA1C 4TPRH 5IJVB 3PL6C 4O02H 5EOCJ 5IW6B 4U2YA 3PWVA 3O3EA 5HYFA 3WDJA 3WUWG 2AV7B 1XAUA 1ND0A 3RWHB 3VXUA 4O9HH 2Q76A 1BJ1J 4V2CB 3NAAH 1K2DB 2XICA 3PQYE 4F2MA 1F4YL 3MFFB 4M6ML 4HXBL 2ZZUT 5DDHA 3H9ZA 2E9BA 1JGEA 1R6VA 3FZUD 1JHLL 3U48A 3D2UD 3ARGC 1P6FA 4RWYL 2KZWA 2PETA 2YD2A 2OK0L 3KPSD 5I2IA 1BGXL 3B9EA 5FFLA 3RWCA 1JHTA 1JVKA 3VD7A 2B2XH 2DQGH 4PJHE 2QQKL 4YBLB 1AP2A 1WBYA 5DMYA 1BVZA 4PGEA 3L7EA 2ENSA 3RNKB 4AIOA 4ETQA 1QZ1A 3HG1E 4OBRA 4RFNB 2KBGA 3B9AA 1BBJA 4F33B 5I6XC 1BIHA 4Q9QH 4LRNL 3WS3B 2YD3A 3HNVH 1F3JB 1T1XA 1IKNA 4KK9D 4PLKC 5I9QC 1IGYA 4C56D 2QQQA 4DKFH 5KVEH 3NACL 3THMH 3BP7B 3PWPE 4K7PL 4XC1L 3VE0B 2AKRA 3QQ4B 3T77B 5T3ZH 4CVXA 3LKRB 4JZOA 4OF7A 5ALBH 4MSWB 3MUJA 4U1IB 4Y5XC 2DB8A 4AEIH 2CRYA 2UUDH 4YE4L 1I1FA 2GY5A 3RJDA 4KZDH 5HTSA 4QXGL 2QTEA 3QUYD 3D18A 4ZMAT 4L4TE 5J56B 1WT5C 4KTYA 2NX5B 3B5TA 5DVKA 2VXUL 4WI7A 4JJHA 1CGUA 5IV2A 5KN5B 5BS0A 1RIUH 2XA3A 4JPIB 2AVGA 4G6FD 2Z93B 2IPUK 3U0WH 2WM0A 1OTTC 4LLMA 1IJ9A 1FL3B 3DRQB 3NCBB 2R69L 3VG9B 1VFAB 2PYED 3GHBL 3V4PH 5I74C 1KCUH 3PHQB 1KXVC 3ARBA 4G9FE 4NOBA 5D7JD 2R2HA 5MEPB 1CYGA 1KBGL 2P5WB 4LLYA 1AP2B 5EOQL 3HB3C 3O4LA 4JREB 4NBXB 1FPTH 2YK1H 2VKWA 2H3NA 4LQFH 2HJKA 3LS5L 3G6JA 2AV1B 4FQHB 1F8TL 1CE6B 3QIUB 3GMLA 2Y6SD 3GSUA 3RWJA 3H9HB 4YWGH 1GYAA 3UJJL 1JPST 2KUTA 3SCMA 2DLIA 5J89A 4KQ3L 1U3HA 1OP5H 3QPQC 4X9FA 1QSFD 5F9DC 5SWZB 1HNGA 2H32H 4I2XB 2CIKA 4NQSA 3ARFB 4OLVL 3RX7A 1ACYL 4PS4H 2E7LA 4MWFB 2XRAH 1S9KC 3QNXA 4P0DA 1C16A 4RQQB 3PGFH 3AS1A 1CIDA 4NJ9L 5IJVA 1DLFH 2F58H 4RAUA 5GGTL 2ZG1A 4Z7OE 5FHAL 5IF0B 1SQ2N 1OD9A 3DGCR 1AGBB 5FHAH 1DLHB 3ZTNL 4U1MA 5EZLA 4JFFE 2HYMA 3U9PH 3MROA 4J4PD 1QP1A 3QISA 2ENYA 1J8HD 5IMLB 4LLAA 32C2B 1ZTXH 4WCYH 3IDXL 1I8KB 3OHXA 4GKSB 4M1CD 3EOAA 1A7OL 3Q3GB 2DYPB 4OUUA 2CPCA 2C4FU 3OKMA 3UJJH 5MEPA 1LEIA 4PJIF 5CUSL 4JG1H 4X5LA 5ACMA 5FYKL 2WP3T 4IHOB 4NDMB 3DLQR 3MRJA 3P4MB 5F7WC 3HZVB 2VXSH 1VFBA 5IFJA 2R23B 1IQWH 3BKYL 2FX7H 3VXMA 1U8OB 3VXUE 2X05A 1I1RA 2WBJC 5ILTL 1LP9E 3GRWA 3B9KA 1WAAE 4ONHB 5KJRH 4L8SC 2GT9B 1OPGL 4MVBD 3O2DA 1I1FB 4W4OA 3OKNA 1Y0LA 4G6ML 4LSSL 4Z77B 1YNTA 3O45B 3GJFA 3KYKL 1EO8L 2R9HC 4S2SA 1BJ1H 5B22A 1ES0A 1CBVH 3EW3B 4V1DA 5GISL 3MC0A 3EOYG 4O5LH 5ECJE 3CFDA 3INUL 3U1SH 1YA5A 3H7LA 5JOPD 3B5HA 1GL4B 1VHPA 4KRMB 1UZ8A 2J6EL 3SKOB 1TJIH 1UVQA 2EYSB 1N5YL 5JO5B 1I4FB 4TUKL 2FIKB 1XGQB 3HE7B 5F97E 4NPYB 4HSQA 5FV1L 2NY1C 1CFSA 1KACB 2OBGA 4JFZL 3MJ6A 3VXTB 4NQTA 3UYPA 4HBCL 4MZ2A 4LASH 1AGEA 3OTTA 5JOPE 4JG0L 4WFEE 4OFKA 3T4AB 4Z0XA 4NP4L 3CMOL 2XWTB 1W0VA 1YUHB 1FSKC 4BUHA 5J13B 2AJ3A 5BZWA 3GGWA 4PRIA 3ZL4L 2BSSA 3VXQB 5C3LD 1OLLA 4M5ZL 3LKOB 1BJ8A 1LP9B 3TBYB 1JNLL 1MF2L 2GSGB 4JN1L 3R1GH 1KN2L 1HSBB 5IEKA 1I7TB 3KDMA 3EHBD 3UDWC 4UT7L 1T1YB 5F1NB 4EXKA 4P2QD 1UM6H 3FCTA 3QHFL 5IG7A 4KI5E 4JO1L 4K23L 3UTSD 3O2DH 1O7SA 32C2A 4P2OD 2V5RA 4KHTL 4AM0B 4ZFGL 3ETBF 4JM2F 1LK3L 2VQ1B 4GQ9H 1IGMH 1QVOB 3RVUC 4G3YH 1F90H 4XNUL 3BEWB 4GXVL 4L9LB 5GSVA 3V5HA 4TOYH 1QEWA 1JV5B 1G7HB 4FQXC 3WO4C 2ED9A 4WV1B 3GSOA 3TIDA 4M7LT 5EO9A 2WWKT 4D0BA 1H0DA 4JANA 3QDGB 2BSRB 4YHLL 3SGDI 5GS0H 3WHE1 5KS9F 1N3NB 2LU4A 4POUB 1YNLL 4IJ3B 3VXUD 5F89B 2Q8BL 3RZCB 4GRWF 5C0AE 2CIIB 3BZFA 3IKCB 3FJTA 4F80A 3E1F1 1MJ8H 1Q0YH 3ARXA 1YMME 1MEXL 3EHBC 2X89D 1BD2E 1JMXA 2BRRL 4ZSOE 1CE1L 4P46A 43C9B 1KJVA 4YX2L 5I74B 2W0PA 1JYXA 2EDOA 5F6HI 5KTEL 5H94A 2X4RB 1AE6L 5SWSA 3RVVD 1OSZB 3C5SB 3MV8D 5KS9E 1EX0A 3MO1A 2DQCH 2FGWH 1KNOB 3WSQH 2PTTB 4FQPA 5BS0B 4UDUA 4YAQA 4L8DA 5DRZB 3MRDA 1U8KB 3WIFB 4BSWA 4H25B 5GRUH 2HAZA 3B8SA 2A38A 4G9FD 2BVPA 4NQVA 1NLDL 2H45A 5GRVL 4TNWK 1HILB 4PJEA 2B20A 3HLAA 4P4KA 5IVXF 3RY6C 2V7NA 2OR8A 1B0GB 4HMDA 2ARJB 3MV8E 4QLRA 4LIQE 4ODSH 4LIQL 5IFAL 5FM4A 4N90D 2E9IA 3R06A 5FYLL 4WU5A 1IGYB 3PL6A 4Z7WE 5TGBB 3LN4B 2R1XB 4OLYH 1BZ9B 1HINL 2XWTA 3UYOD 4QXUH 2X4QA 1PX4A 1URLA 1UA6L 5HBBA 3T77A 4CVWA 1FO0L 1NC2D 4LCCC 4LLQA 3L3DA 4Q9RL 3E8UH 4XNYL 4YUEL 2X9WA 1DDHB 5E9DE 4HC1A 4U2ZA 4EN3C 3ILQD 3MOAH 3IFPB 3IDIB 4R90L 2HN7B 5DJ0A 3TT3H 1B88A 1OTUC 5I1AB 1BHGA 4HXAH 3ECBB 4MAYA 1RUPL 1H3TA 3GMRB 3U0TA 5I1JH 4ZO6A 2AJSH 4CADB 4WJ5B 3FQTA 2PYEE 1S7WB 1DUZA 5EUOA 2XIDA 1LO5B 4D3CL 3WFDL 2A73A 4PR5B 3D48R 4PJAB 3STBA 5C0AD 4P9HL 1AIFA 4HIXL 1G7PB 2X4UB 4PRHA 2AS5M 1EEYB 4M93C 2FBJH 5HJ3B 4WDIB 4MD0B 3O3UN 3C9NA 3VWJA 2CK0L 3RTQC 4XH2A 3VFTA 3P9LA 1S7SB 3B2VL 4D9LL 5GS1B 4MB5A 3RX5A 3UZEA 1OAUH 5M95B 3DETD 4P2QE 1VDGA 4IS6A 4Y4HB 3RGVC 5JOFA 1MPAH 5ICYB 5CD5C 1MSPA 4PLJC 2IAMA 1JWSB 3OAUH 2J8UE 5K9KA 1N7ML 3QWOA 4JM2D 4K8RL 4HAFA 4JFDD 3S36L 1CZ8L 3VXRB 1D7FA 4KXZH 1FORH 3OMZA 1F4WL 2Y7QA 4OF3A 1UJ3C 4XBPB 1I1YB 4ZS6D 1KB5L 1SMOA 5JHDA 4HFUH 1ZK9A 2WNGA 2EDEA 4JAMB 2ICES 3OJDA 3F8UB 4N90E 4K94L 1BVKA 4WW2C 3VFVB 5FUZH 5EUOB 4GS7B 3OQ3B 4PJ7E 5D93C 5DRZA 2X9XA 3MRDB 3T0DA 1KCRH 1YQVL 2H32B 4YR6A 5JZ7C 3QRFM 4A6YH 3RGVB 3SPVB 4OCYH 4CDGC 1IM9A 1RZGA 1UM6L 4RNRA 4D9RE 3MV7D 4TNVF 5LWYL 1NLBL 4PTTB 1UCBH 1PGRB 5TE6H 3WE6A 1HHGB 3RVXD 2CLVB 1CGYA 5ALCH 5JW5A 1D6EB 1TJGH 4DFHA 2IALA 2OJZL 1U42A 2UY6A 3HZYA 5TDPB 4PJCF 4X6DE 3MYJA 2XQYG 2X4QB 4MNGA 4JPKL 5FYJU 1U36A 2APBA 4EDWH 5DEFB 5J1AA 4YIQB 3ZKQD 1T04A 1EA9C 4Y4KA 4ZFZA 2X1WL 1NEZG 1MVUB 4AG4L 1OVZA 1TMCB 2QSCL 5T3XH 1OAXH 4Y2OA 4NUGL 5DJ8A 2HFEA 2BK8A 5HHQB 4F58L 1MUJA 2EH8H 1AGFB 1NC4A 3H3PL 1WEJL 4N5ED 3MXVL 4YH6A 3G5VA 4NUGH 4Q9CA 4HUWB 3IJHA 3E6HA 3UTZA 3FO2B 3IDJB 5JZ7D 3GI9H 2P43B 3VFVA 2VE6A 5TFSH 1T1ZB 4GRMB 4X0KB 5I71C 4RGNB 1CLYL 1FFOA 5ESVA 5JA9A 2CRZA 3QHZH 1KLUB 3D85B 3D85D 1WK0A 5C86A 2X4UA 4OCRL 1AXIB 5ELIA 2DJ4A 4L3CB 4R26L 1LNUB 1KCSL 4C57C 3RNKA 2X7LB 4TVPL 2UYLB 4QRRD 1RZ7H 5IW3A 4FFVC 3P77B 1RJYB 1C08B 1NBVL 4IS6B 2HFFA 5F3BA 1JZ5A 2JJTC 5FDWB 2BOCB 3A6BH 5DSCA 3LD8C 3VD4A 4ERSH 2VXTH 4MA1B 1NAKL 3DMMB 1YDPB 4G8IB 5KG9A 2XACC 5HI5C 1NCTA 5DWUH 3C5ZA 1DVFC 4LNRB 1UB6B 4XT1C 2R8SH 4WI4A 3G6DH 3CXHJ 2F9BT 3SDCC 1CGTA 4NKQB 5IR1B 4BQ9A 4DW2L 1NGZB 4MQXC 1VEMA 5D5MF 1HKLH 4NUJB 3RIFF 1JF5A 4QWWD 3AC0A 5CJ5A 1OGAE 2YD1A 1KENH 3QXVA 4LSPH 3QWQB 4KKNA 2MPAH 4Z7WA 2B39A 4HK0A 1I3GH 3C5ZD 3FO2A 3BZ4A 1XF5A 4ZS7H 2W9DL 1UM4H 3U46A 3P4NA 4CAGA 5MHSD 1RIHL 5C0DA 3KYOB 2A6DB 4X6CF 5FUCC 8CGTA 4LKXB 2I60H 5DYOA 3PABA 3DUHA 3S5LG 2DL2A 2BVEA 2NCMA 3I2CL 1FVEA 2QQLH 4Z5RA 4XNXL 4CU8A 5F3BB 1QBLL 3W0WE 3UC0L 1GZPB 3HZYB 4QHNB 2PF6A 5DD1H 1XCTB 1B4JH 3PDGA 1BFVL 5DD6B 3FT2B 3CFCH 1BVLB 3V4VL 4YDJB 1RULH 3VRJA 2FJFB 1LO3H 1G0DA 1UB5B 5EIQA 2OTUA 1TZHB 1A6PA 2OL3B 2P5ED 5L6YL 3LS4L 4GKNB 1QBLH 3GB7B 3H6JA 4YPGA 5EFIA 3M45A 4Y4FB 4D9QE 5AUMB 1JZ2A 4PJBB 5CJXC 5EA0L 2FEDD 5DUBB 4PY8I 5DJDB 1KUMA 1MFAL 2DYPD 2GITA 3GNML 3PNWA 4HUWA 3PWUA 5GQBA 4B53A 5E94B 4M7LL 1BQLL 4C83B 4UDUB 1GGCL 1QRNA 1A1NB 3VWKB 4YUEH 3X3FH 4C56A 1G9NH 3LMJL 5FB8A 4KFZC 4OFPA 3KLAB 2IQAB 2BP3A 5E1AB 5DVLA 3VJ6A 1B3JA 4Z0BL 4YBLC 3KPSE 2EO9A 1ZHBB 2R69H 4R4NC 2MSPA 3AREC 4QRPA 1CG9B 5HVGB 4RFNC 3T8XB 4WEUD 1XIWD 5DZLA 1PKQA 2YRLA 5GSRB 5CEZL 4JFXB 1P9MA 3ZHLA 1EAJA 4OCRH 2NY5L 2ID5A 3BGMA 1HYSC 3U7YH 4OF5A 2X1PA 4Y4HC 2IF7A 5T5FH 4NC2B 3BE1H 1UQSA 4P9HC 3TBVA 3HPJB 4MNQE 4WNQB 1I7UB 3UYRH 2GUOB 2EYRB 4HW6A 2EDBA 1P4BH 2WWMC 4K7PH 5TPWH 3JTTA 5C0CE 2Z92A 4IMLA 4OD3H 5GIRA 4JFDB 3N85L 3MJ9L 2IFGA 4H88L 1I7RB 2JB5H 4LVNB 2JE8A 4CW1A 1Q1JH 2PO6C 2NR6D 5E94A 5ITBL 1IFHH 4GKZA 3ARED 1C5BH 1JUFA 3BKCH 1TZGH 3T09A 1PEZA 2J7LA 4NIKB 1HCFX 4KRPD 3S9DB 3UPRA 2R9HD 1CXKA 3U0PB 1JI1A 3MCKA 4KXZI 3LPFA 5ALCL 2HKHL 3FFDB 3HB3D 3VI3F 1BLNA 4H88H 2YEZA 5MP6H 3MJ9H 4HF5H 3B5GA 2PKDA 4X8JB 1WWCA 2AQ1A 1LE9A 1YPZE 1A1OB 1KFAL 5DRWA 5E8EB 3O9WC 2J6EA 2YA0A 2IQ9L 3GK8H 1T6VN 5DFVD 3VE0A 4F58H 3RUGB 3LKPB 1QBAA 5KZCD 3CZFA 4FFZL 3UMTA 4U3XA 4PJGB 4PD4J 3WS6C 4HZLB 1X5JA 4U1IA 43CAB 2P42B 5E6ZA 1NGYB 5E9DA 1A6VH 4YDKH 3LEXB 1T89A 3UBXB 4F57H 4GAGL 2WINB 3TJEL 2ICWI 5DUPL 1T03H 3BW9A 3LN9A 4M7ZC 3SDCA 4JKWA 3DGGB 2ZG3A 4M7KH 4YGVB 1FZKB 3D25B 3V0VA 5CLTA 2X4TA 4TULH 3AB0B 3HE6B 2R23A 5DJ2A 4BUGA 1O0VA 3F7VA 4M7LH 4NN7B 4J4PC 3SJVB 1U0QA 2BHZA 5FA4B 5A2IH 2VLKD 1KPRA 3BEVA 3G5VB 1DE4B 1DQDL 4PJXF 3JWOH 1TNMA 3DRTA 4OCXH 2CMRH 2RCSL 5MENB 1OW0C 2WW8A 3D87B 5DEZA 3GHEH 5F8QC 4XWOD 4N8VG 4BYHA 3BRGC 4ZTOL 4S1SL 3NCJH 2ATPB 2VYRE 3MRQA 4X99B 4YHOL 3EYSH 3DVGB 3P9MB 5BCAA 4P4KD 4M5YL 1BBDH 2IGFL 1PG7H 3L3JB 1SEQL 5HDQH 2W0KA 1EMTL 4LMQI 3V4VH 1JRHL 4LPVA 4OGYL 1EXUA 3K2UL 5D5MA 3AXLA 5J9PB 2R0WL 4I18A 1Q8MA 4P99A 4DCQA 2VDRL 4EI5A 2NXZC 4XNXH 5IB4A 5JW3L 1AY1H 4FQLL 1RUPH 2ZUQC 2ILLA 4WFGE 1TDQA 5DJCA 4FG6D 3K4ZA 4JFEE 3O6KH 2ZUTA 3MROB 2WWKO 4IMLB 4GRLD 1RIHH 2VDLL 5IT2H 4Z77A 1RJLA 4KQ4L 4NNYB 4WI3A 4PJ9B 3OPZH 1EJOL 1IQDB 2GJ6A 1YEGH 4MA3B 1HQRA 3A67L 1E4XH 2OP4H 2XNAB 1IMHC 5C0ND 5HGDB 4PJFF 3S7GA 4JFOA 3FN9A 4H25A 4JFPA 4QYOB 1EZVY 4ZPTB 4PJXB 3D0VB 4K8RC 4LHJB 4KZEH 3ARDB 3WN5A 1P7QA 3RKPA 5EU5A 1L6XA 1I9EA 2HP4A 3C60C 3RU8L 2VL5B 4KMTL 5GGSA 2IG2L 3IJYB 3GRWH 5I73C 5CJ8A 1H3PH 3LQAH 5I71B 4XB7A 4LBEB 1ODAA 2XY2A 5TDNA 4FFWC 1OB1B 5IBTL 4HWEH 1EXUB 5DMKB 1T22B 5L7XH 3CC5B 5C6TL 5J11B 5IB4B 5K9JL 4P2QA 1CICD 5DD3L 3EO9H 3QFDA 3QHZL 3TPUA 3VA2C 1UH2A 3OXRA 1JF6A 1RZ7L 1ZWIA 2FJFA 4OCSH 4TVPH 1NCDH 2VR5A 1IAIL 5J3HC 3DX8A 3K0WA 5GGTH 4AT6B 4Y4FA 3PGCB 2D3VA 1G6RL 3QNZB 3OB0H 1KULA 1T1YA 1IVLA 5DURD 4HC1L 2DQJL 3KHOA 5LAXA 1IAMA 4NWTH 4BFIB 3W11C 4PRPB 4LCUB 5E56A 1IILE 3VWKC 5D1XA 3EOTH 1KXTB 4FHBD 1UADC 1A9EA 4WFFE 1X4XA 4HHAB 4RMRA 5MENA 3JTSA 3P30L 1NDGB 1XGQA 1UWXH 4KKBC 2F8OA 1P7HL 4NQDB 3F6IA 5I1EL 1U8MA 3DI2B 2P24A 3CLEH 1FRGH 3HPLB 5FUOL 1HXYB 4OQ1A 3ARPA 2IMNA 3T1FB 4Y4HA 3G6AB 1HQ4A 2OTPA 1J1PH 2EH7L 4HLZG 2AEQL 4KI5C 2ZUWA 2V17L 4OZGF 3E2HB 3OKOA 3GMPB 3K2MC 1BPVA 1CICC 4O4YH 1MLBB 2P8PB 4JFFB 4JY4B 3H0TB 5C0FB 3ULVE 1IGIH 5FDYA 2XV6B 2BVOB 3DETC 1ZLSH 1LQSR 3WDHA 1C12A 1QO3A 5GZND 3EO1B 3GIVB 3EBAA 1YNLH 4FQIH 1HSAA 4L3EB 1PLGH 3SGJA 2V5TA 4L8BB 3U9UA 1LO0L 1IBGH 3R06B 3DX8B 3W11D 2FO4A 5F96H 2DLEA 1ZA6A 1QLRA 3MLVH 4G8EB 4Y2DC 4A6YL 3PDOA 5IGXH 4LPUA 5EBMA 4QOKD 4JCMA 1AGCA 4EKXA 1CGWA 1T5XA 5CIPA 2QHLA 1H3XA 4R7DA 1ORQA 3D39B 5BO1L 1MAJA 4UUJA 4Q2ZA 1IAOA 3VRLF 5HY9B 2J12B 2F53E 1F6LL 1CG9A 4DKFL 2QKIA 2DBLL 2HLAB 3CLFH 4LSVH 3U0PA 4JKPL 4MJIA 4WI9A 4XCFH 4PB0L 4OJFH 1FORL 1T3FB 1I8LA 3V5KA 4D9QD 2P24B 1MFCL 3O6LL 5E5RB 1HHGA 3ZLQC 4PJBE 4WEMB 3ULUE 1AO7D 1II4E 4DVBA 1JZ4A 1CGSH 1AGDA 3VFSB 1MF2H 1K85A 3CZFB 3AB0C 1FFQA 4DN4L 4KU1A 1ZT4A 3RVXC 2XKNB 3QWRD 1UT9A 3W9DA 1TVBB 4AQOA 3BDYL 1ZHKB 1INDL 2VLKB 3KPOB 4NN6C 3B2UC 4HD9A 3KPPB 4HLZH 1AGFA 3O3AA 1BF2A 1B4RA 3UTSA 3DGGA 5KJRL 3NZ8B 3O4LE 3NN8A 4IRJB 2JTDA 3FOMB 4KTDH 4PTUB 3QUZC 3W82A 4GKZB 4OF8A 5GS2D 3O0RH 5JIHA 4S1RL 2OSLB 2B1HH 5D9SA 1YYML 3BKYH 4GBXB 4XAWH 5IBLD 3V79C 3CVIL 4AEFA 4EUPH 4G5ZH 1CFVL 4APQC 3I3BA 3T0EA 1VGEL 2BNRE 3H3KA 3WCYA 4XVUC 5B3JF 4TUJB 3RL1A 4U6XB 4HUKB 4XNYH 2BNQD 3T1WA 5EORH 4TYUA 3T3ME 2AXJA 3BD3A 1GGBL 4F2MB 3L9RB 3VMNA 3RWDB 4YQXL 4CJ0A 4G6MH 4IMKC 2VLJA 4CVZA 4ZD3H 4BQBA 4DQOH 1NUFA 3QO0A 4LVHC 1J0ZA 4UT9H 4OZFH 1QQDA 3QXDA 2YUWA 1U8PA 1FO0H 3FFCB 4U3HA 4CDHA 4ALAH 1K4CB 1A6TB 1GGIL 1NBYA 4XNQA 1ZT4B 3OSKA 4ELME 3PGDB 4FQXA 5I8KH 2H2SD 1B0WA 1YY9D 3PWPA 3CMGA 1E4XI 3UPAA 3Q48A 4W4NA 3QIBA 5EH1A 4ZOAA 2M1KA 4NNXB 1T1WA 4L4TB 4L4TD 4BJLA 2EKJA 3KR3H 2VLKE 4LPCA 1Y6MR 3JWNC 4X6CA 5T1KB 5T1KD 2IALB 4NGHH 4JGMA 1TTUA 3N9GH 4G8EA 4QKXB 2CUIA 3GMRA 1AE6H 3O3BB 3WHE0 3PWLB 5C0IA 1XF1A 3MBXH 5I66A 1SVCP 3ULVH 5IHBA 4YX2H 2EECA 3WSQL 4O00A 4OI7A 3D3VB 5FYKE 3P9LB 1IAIM 2R2EA 2A83A 3SKNB 1W72A 4FQ1L 4NZTH 1YN7A 3E3QE 5HDOA 4J4PA 4WI8A 5BRZA 1A7RH 1EH9A 3O6FA 4X9GA 7FABL 3ZTNH 3PWJA 4ZSOB 3S98A 3DMMC 1DBJL 5EBLB 4UINL 3T0EC 4XI5D 5FKAA 3E6FA 3O2WL 4QHNA 4MCZB 5EO1A 5AD0A 3DX9B 1QFWI 3LKNB 2EE6A 3IS0X 1JWSA 1NGPH 2AI0L 4LARH 2GW5A 3FFCE 1NKOA 3CDGA 5DUMH 3RIAF 4FZEH 5C92A 4M6NL 2Y5TA 3MRIA 4MSWA 2Q76B 5DGRA 4ZFGH 2VDKL 3SDDC 3GZKA 1GVIA 5BMFL 4UIMB 5EU6A 1X5XA 3UAJC 4K23H 4UV7H 4D8PA 4XNUH 5IB1A 4PRBA 3C8DA 3N06B 1R5IA 3MLWH 4E41A 5E2TH 5F9JA 3X12A 4PRNB 1EBPA 1D6VL 1Y18A 3WNNA 1JRHH 2HMID 3MUHL 3EO0B 3C5JB 3NACH 1QSVA 3MLTA 1KN2H 1R3HA 4AMKL 3HCVA 4NQXB 2ZCLL 2XOTA 1CLZH 3X3GL 4MX7B 4BK5A 2VR4A 5EOCH 1CXLA 4Z7VE 5KVDL 3M17B 2CLVA 4M1DL 4IRSA 3U0WL 3V5DB 3S35X 1M05B 5J0BA 3JTSB 5DJAB 2MCG1 1CD8A 1QSFA 2KDGA 5DHVA 3L9RA 2R4RH 3JVGA 4M43H 2NZIA 3FQNA 2OZ4L 4NBYB 3DSFL 3IDYB 5EOCL 5CS7A 5FDWA 3MCG1 1W8OA 4LAQL 3MCLH 5BOPA 3CZJA 3IRPX 4DZBB 2HVKA 2D0HA 2P4AB 5BW7C 5J1AB 4JQVA 3Q6GL 1T04B 3QCUL 3G6JE 2G75A 1FE8H 1KEMH 2PYEA 1F4AA 2MFNA 3QUXB 3G9VA 4AT6A 1BBJB 1V7NL 4J3OC 1YECH 1Q94A 1U9KA 2HLFD 2WV3A 4X7DC 4KMLB 4MNGE 4AH2B 2EXYD 1ZGLB 5BS0D 4GG6F 1V5JA 2HJLB 5DUML 1MCPL 5A2KH 1CDGA 2F53D 1FNGB 5EZJB 3MLZL 1INEH 1BX2A 3GB7A 3PHOB 4LL9A 1CCZA 4AMKH 4PJIB 3FMGH 4X8JA 3IXAA 3QUMA 1NGXA 3OR7B 4I1NB 1JZ7A 1A6WH 3BGAA 4OFIA 5F9OL 1ZLSL 3MRHB 4WFGD 1ZA3B 4FOMA 1MRDL 1B2WL 2YN3A 4JRYA 1C5BL 3SN6N 3KLAA 3VJ6B 1UXSA 2GJ6D 3MJ8B 4IRSC 4POZC 5C07B 2DQDH 4WO4B 1YC8A 5CINH 1XZ0B 4E42B 1T2QH 1ITBB 5FYKH 2CRIA 3O9WD 1WWBX 4FN0A 5CUSH 3V7MA 4OZIF 1W72H 5L2KA 3TM6A 3SO5A 4L8SA 5E00B 1JCKA 3CVHH 4DGIH 4JHWL 3EOTL 1OQXA 5EBGA 4NFCA 3T65B 2EXYC 4HGKC 3PUCA 4JG1L 4UIMA 3G6JB 4NQCB 3ZE0E 3GJFB 1NSNH 3RVWD 1FYTB 4ZXBA 1Q9OB 4P3CH 4FXLA 1T5WB 3ZTJG 3HC3L 3VXQA 5I8KL 1ETZB 4MVBC 4JE4B 3MMEB 3ILPB 2YUXA 2DD8L 2JK5B 3NFSL 4FQCH 4PJDE 5TH2B 1FJ1B 2CLRA 2YSSA 3CSYA 1JI2A 1JK8B 1TLKA 4NN5B 4EI6B 3K46A 3STZB 4H8WH 3OAZH 5E5MA 4NJ9H 1GGIH 3OXSA 4Y4HD 5K93A 2BRQA 1LD9B 2PTUA 4FTVA 3VXTA 1J05A 1A6AA 4PS4L 3BP7A 3LMJH 3FB8A 4NT6A 1E4KA 1PZ5B 4KDWA 1CTNA 2HKFH 4PJ7F 4R0LB 4LRIA 1TZHA 1SYVA 4KJWD 3EKCA 3MUGA 3RVTD 3O45A 1U3JA 3LEVL 2PYFB 5F7LB 4YDJA 4U4BA 1HHKA 4P3DB 3HR6A 3VG0L 5D1QB 5ISZD 1RZ8B 2OTUB 4L9LC 1EO5A 4J7RA 2NR6C 2PO6B 3QEHB 4NNXA 4F7PA 4I48B 3UXFA 3S37L 4K7FB 2Z31A 3FMGL 2FH8A 2R2BB 2V9TA 1ZHBA 4NHCL 4LCWD 4OCNC 1RZFH 2VLLB 3IAQA 4HIIA 5JW3H 4UIKH 4HX1A 5EB9A 1OAYL 1I8IA 2D9QB 4X4MA 1SY6A 1INDH 5DJXA 1A3LH 4QRTA 3FT4A 5DJ2B 3L3IB 3IU3B 4MS8C 3OKDB 4GAYA 4XHJD 1OSZA 1K3IA 3C5SA 2AV7A 2R2CA 5CZKA 3WHXB 5KVEL 1HWGB 2VDPL 1BP3B 1JGVL 3BVNB 4PREB 2R0WH 4PJIE 5ALBL 3U4BL 1NCWL 5D1ZA 2LAGB 2P44B 1XGTB 1EEUA 1XGPA 1LGVA 1T22A 1XZ0A 2F74B 2YPLB 4YZFF 3WO3B 4XPGL 1MREH 1KENL 3O41B 3W9EB 4Z7QE 3GJFK 3STLB 2P8LA 4HS3B 4JKPH 4J1UB 4Y5VB 1KTLB 5J1SC 4P3DA <