2A6ZA

Crystal structure of emp47p carbohydrate recognition domain (crd), monoclinic crystal form 1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
222
structure length
222
Chain Sequence
GSDASKLSSDYSLPDLINTRKVPNNWQTGEQASLEEGRIVLTSNQNSKGSLWLKQGFDLKDSFTMEWTFRSVGYSGQTDGGISFWFVQDSNIPRDKQLYNGPVNYDGLQLLVDNNGPLGPTLRGQLNDGQKPVDKTKIYDQSFASCLMGYQDSSVPSTIRVTYDLEDDNLLKVQVDNKVCFQTRKVRFPSGSYRIGVTAQNGAVNNNAESFEIFKMQFFNGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the carbohydrate recognition domain of Ca2+-independent cargo receptors Emp46p and Emp47p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
molecule keywords Emp47p (form2)
total genus 57
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2a6zA00
3POYA 5KXBA 2ZZJA 3N36A 4YFZA 5JOZA 3WUDA 5DUWA 1MACA 1N1SA 1Q56A 2I2SA 4U2AA 4Y1VA 5GM0A 4FPKA 4WV8A 1DQ0A 1LODA 3WG1A 3ENRA 2DUPA 1HDKA 2EXJA 1RINA 3R4SA 1WW4A 4LBLA 3VKNA 4BPZA 1YO8A 3V0AA 2D44A 1AX2A 3FBYA 4YG3A 4F83A 4GWMA 1UN1A 2GMMA 3I4IA 1GNHA 3GNEA 3LSDA 1GANA 2ZMLA 1G9AA 5T5JA 2DUOA 1G86A 3OBTA 4XJAA 3APBA 2ZHNA 3UJOA 3MPPG 3USUA 1LHNA 4YM2A 1MS0A 1SLIA 2ZAAA 2D6PA 5IK7A 4HL0A 3NV2A 1LU1A 4RL7A 2A5ZA 3RS6A 3AP7A 3TB0A 3VKFC 4YZ3A 2LALA 3IMNA 2YROA 4Y20A 4ZXKA 3ZYPA 1V00A 4LBNA 1FYUA 1MZ6A 3WDXA 1S0EA 3WDUA 4BM8A 3V0BB 2A3YA 4Q8LA 4UW5A 4ISQA 3BODA 2EF6A 4Y1ZA 1S0GA 2TEPA 1FV3A 1SBDA 5HCBA 1N1TA 1AX0A 3SH5A 1JBCA 2G4IA 5GJ6A 1SLLA 3B3QE 4Y1XA 1I1EA 5EWSA 1Q8PA 2VUAA 2WJSA 3O5SA 1B09A 4WZFA 5KXCA 5T55A 5GZFA 3ZSJA 4YZ1A 4FQZA 2DYCA 4Q27A 1BQPA 2P3KA 1RIRA 3B00A 1UMZA 3RG0A 3BOPA 1Q8QA 3C2UA 4GWNA 1HLCA 1QOSA 2EIGA 1FNYA 3AP6A 3IPVB 2C5DA 3AX4A 3DUIA 2NZ9A 1KQRA 4TYSA 2R49A 4ZKTB 4AVVA 4FPJA 1KRIA 2ZKNA 1AJKA 1VAMA 2YXSA 3ZXLA 1R1ZA 2ERFA 2ZHLA 1IKQA 1YIFA 2GMEA 3I8TA 4FQ4A 1N1VA 1LOAA 4P14A 1MS9A 1OQ1A 1HQLA 3AXDA 4XXAA 4ATEA 4XMAA 3WHUA 1G9CA 3M3QA 3N3HA 1SLAA 1S0BA 1MVEA 2V73A 2D6NA 2OVUA 1AXKA 3PMEA 2D3SA 4XBQA 3IPVA 3N7KA 1WCSA 2C9AA 2H0BA 2VW1A 2ZABA 3ILNA 3UJQA 4BMBA 1SLCA 1DZQA 1CESA 2EXHA 4K21A 1S0IA 2DU0A 1G8WA 1KDMA 1WW6A 1DGLA 2JE7A 1G9DA 2AYHA 5IUQA 2NYYA 1MR5A 1CPMA 3QLQA 1C1LA 1KITA 1CONA 3ZPYA 4LBQA 2E53A 2GDFA 1QF3A 2DVFA 2P3IA 3N35A 1LGCA 3PJQA 1ENRA 5GLUA 3AFKA 3PVOA 1WW7A 1DHKB 1MS5A 4Y1UA 5DG1A 4AGVA 2V5YA 5EYXA 1VALA 3A0KA 3OGGA 3VKOA 3RSJA 2GALA 4XHXA 1X50A 1JUIA 3Q9OA 4XYXA 3UK9A 1W6NA 4C1XA 1F9KA 1QKQA 1PZ8A 3TAYA 2PHTA 2A6WA 1DLLA 1NLSA 2AH2A 3IN9A 4MYEA 4YM0A 2AUYA 1GNZA 2BQPA 3AP4A 3FLTA 4YGBA 3A0NA 4DQAA 3JUUA 2EAKA 5T54A 4XDQA 4PBOA 2A6VA 1BZWA 4XE9A 5DG2A 5H9SA 4AVSA 4Q1RA 2UWAA 1DBNA 3W58A 3OYWA 2A6YA 4UW6A 3IKWA 2D7FA 2JECA 1N3OA 2EXIA 4XIOA 1Z0HA 1A78A 3HR9A 1URXA 3SISA 4PF5A 1OFSA 3WDYA 2JD4A 4M3CB 1HKDA 4XXPA 2JJ6A 2D6KA 4CRQA 5CAZA 2CY6A 1QMJA 1V6IA 4XJ9A 3W59A 3SH4A 4BLJA 1ULEA 4CZSA 3LCPA 4YW5A 2WT0A 1CJPA 1IS5A 2JE9A 5T5OA 4YZ4A 1C1FA 5DUVA 3V0BA 3ZSMA 1SACA 1VLNA 1UZZA 1YI7A 4Y26A 3ZXFA 2YV8A 3ASIA 4NOTA 1GZWA 4XIKA 4D69A 3RQ0A 3MEPA 2DTWA 1G9BA 1QU0A 2WSUA 3AP9A 2RHPA 3T1LA 1SFYA 2SLIA 4R9DA 3ZSLA 1QDCA 4YGCA 1NXD1 1YYNA 4Y22A 4C1WA 1UL9A 5E89A 3T2TA 1BXHA 4YM1A 2PELA 3AZVA 1LHVA 1UPSA 4YGDA 2A70A 1V6JA 2W68A 1N47A 4UW3A 3AYEA 1GBGA 2GMPA 3AZXA 3LSEA 1AVBA 1H9PA 4FOQA 3R4UA 1LGBA 4XTPA 5CBLA 5JLVA 3U4XA 2XB6C 5EXOA 1W0PA 2A71A 1IKPA 3PVEA 3M3EA 1GSLA 2E7TA 1PZ9A 4FPEA 1JYIA 1V6OA 1TEIA 4FOVA 5H9PA 1QOTA 4Q8KA 1JN2P 1W6PB 5KXEA 1AX1A 1U0AA 1V6KA 1IS4A 5GZEA 3WDTA 3R05A 4ATFA 1W6PA 4Y22B 5T5LA 3WG4A 4YLZA 2YY1A 1GYKA 5DUXA 1BKZA 5JDBA 4XTMA 2A75A 3AJZA 4FPHA 1N3QA 1RITA 1J1TA 1DIWA 3SNMA 2NN8A 1WBFA 2P37A 2Q5TA 1UX6A 3AXEA 5DZFA 2R1BA 2R16A 4AGRA 4LBMA 1LTEA 4AYUA 1DQ5A 2NMOA 2ZGSA 4R9CA 4XOGA 3ZXJA 3POWA 2ZGMA 3WZ1A 4FPFA 2DTYA 1LENA 5H9QA 1G7YA 2EXKA 2ZGTA 5DZEA 4DPNA 2JDZA 5GLZA 1KDKA 4GKYA 2VH9A 5CB7A 4FOWA 2CNAA 2R0HA 1GLHA 2AR6A 2CTVA 4P9XA 2OUJA 3DGTA 2WT1A 4XBNA 3ZXKA 2ZBJA 2WNEA 3V64A 3PVNA 1AXYA 1FX5A 3NV4A 1W6MB 2D6LX 1LEDA 3T1MA 4BMEA 2PHUA 2NP0A 3ILFA 2W52A 1ULGA 4GXLA 1LHOA 5JVVA 2DWRA 1ENSA 1LOBA 1LJ7A 1QNWA 3FFZA 4YM3A 1KJRA 4XJZA 1BYHA 1GICA 3MW4A 5L73A 2UU8A 2VXRA 3O0XA 1Q8SA 2JKBA 4PQ9A 3RMXA 1W0OA 2ENRA 1LESA 3AYCA 1WLDA 4XJWA 4Q1PA 3WG3A 2ARXA 1CQ9A 1SBFA 3MW3A 3CNAA 5IK5A 4XJUA 4YW2A 1VAVA 3AK0A 1WD3A 1YXWA 1MS8A 3D5OA 3KQRA 2CYFA 5DXDA 5CA6A 2HYKA 2EALA 2D3PA 4XBLA 3VUOA 1BJQA 1C4RA 3NV3A 4PCRA 1CIWA 5T52A 1UZYA 1ZM1A 5GLWA 4KBBA 5DZGA 5GLTA 1SCSA 2WT2A 1DQ1A 1LCLA 1DQ2A 5DUUA 1ONAA 1S0JA 3O12A 3M3OA 5HCFA 2DVBA 5HCAA 4OZXA 1O4ZA 1WUVA 3SITA 3B69A 3ZXEA 3POSA 3M3CA 1XQNA 4FPYA 3VKMA 3OY8A 5FRAA 5F5QA 1GKBA 5E88A 1H9WA 1MS3A 2PHWA 1A8DA 1H30A 2WKKA 2CL2A 2OW4A 4XILA 4PBPA 4YG0A 1D0HA 4YW3A 2NM1A 3V65A 1V6NA 1FV2A 1W6QB 4DFSA 1JW6A 1S0CA 4K1ZA 2W08A 5GZCA 2VY0A 4LBOA 2ZGKA 5T5PA 3B9CA 5JOWA 2PHXA 4M3CF 1AZDA 1APNA 2A3XA 1QOOA 4SLIA 3ILRA 4YZ2A 1LECA 3ATGA 3ZVXA 1DQ4A 1DYKA 4M01A 4DRVA 4FPLA 2P3JA 1LGNA 3RRDA 2B7YA 2E51A 5IK8A 3USUB 2DV9A 4XZPA 4Q26A 5IT6A 1S1AA 5JOYA 4CTEA 4YG6A 2D43A 2LTNA 5EYYA 4HANA 3WDWA 5GALA 2DU1A 4FP2A 4U36A 3FUQA 4AGGA 1QDOA 2DVDA 2ZA9A 2NMNA 4GALA 3V0AB 4XJ8A 1LOCA 4W65A 2ES3A 1PZ7A 3O0WA 1QGLA 1N3PA 3OY8B 1DFQA 3WOGA 4YW4A 3O0VA 1AF9A 1SBEA 1S0FA 3FLRA 4DRRA 2E6VA 1MS1A 1IS3A 1V6MA 3UL2A 4P9WA 1W6NB 2CWSA 2P2KA 3D4KA 3AJYA 4BOWA 4YZ5A 5JMCA 4LBQD 2ZACA 3M2MA 3HMYA 1LOFC 1W6QA 1FNZA 2ZGLA 1LEMA 1SCRA 2PHFA 2ZGPA 5GZDA 1MVQA 1IOAA 2UURA 3WV6A 5BYNA 4FOYA 3AYAA 3FUOA 3B01A 4LBJA 3HN1A 5T50A 3AYDA 2AGSA 3OJBA 4AWDA 1GZ9A 4WVVA 3SLIA 1ZA4A 5CNAA 3INAA 5E8AA 3ZYRA 3H0OA 4ITCA 1ULFA 2SBAA 2ARBA 2DVGA 3MW2A 4GA9A 3L2YA 4LBKA 4DS0A 3NWKA 2WQZC 1Y7BA 2Z42A 4YFWA 3NV1A 5FREA 2DVAA 1VIWB 3SH3A 1G9FA 1WBLA 4ISRA 3FLPA 1O4YA 1LOEA 3AZZA 2GN3A 2ZHKA 3OPZA 2ZMNA 3WVJA 2R0FA 3OBRA 3RMYA 3WCRA 1QNYA 1GZWB 1WD4A 4I30A 4JRAA 3ZSKA 4YGEA 3OYWB 1GV9A 4R9AA 1OKQA 4Y20B 1I3HA 2GN7A 4K20A 1ULCA 5GZGA 1YRZA 2FMDA 3AP5A 3AZWA 1ENQA 2UWBA 2UWCA 3BIWE 4Y1YA 1LOGA 1MS4A 2AREA 4JC1A 4M3CA 4FPCA 2R1DA 1LHUA 2D6OX 4FVVA 4UW4A 4RA0A 1JXNA 3M1HA 5IK4A 1W6OA 2FHRA 4YW1A 1EPWA 4NO4A 5LK5A 1SLBA 3WNXA 2XG3A 1W6OB 2GNMA 5GLVA 5AVAA 4FPOB 1CN1A 1KJLA 4WVWA 1MZ5A 1CPNA 1CR7A 1IS6A 1F31A 3WLUA 5KXDA 4TZDA 2YZ4A 3A4UA 2E7QA 4FPGA 2W39A 2A6XA 2VU9A 2WSVA 4AVTA 2KM2A 4IQPA 1Q8VA 2ZMKA 5F9TA 1UKGA 2A3WA 1F5FA 4FP3A 2D3RA 2ZGUA 1W6MA 4LBQB 4P9YA 3QCWA 1LHWA 2DUQA 3WG2A 2D6MA 4Q2FA 1CVNA 3N7LA 2A6ZA 2P34A 1SLTA 2ZGQA 3WHTA 1JYCA 3KM5A 1DYPA 4Z8BA 2GNTA 3AZYA 1LU2A 1AJOA 4Y24A 4XMIA 4R9BA 2GNDA 4XHBA 2A7AA 3N7MA 1WLWA 5H9RA 2YMZA 4H55A 2OUHA 1JHNA 2ZGNA 2ZHMA 1Q8OA 1V6LA 4BLIA 4BQ1A 5JOXA 4GKXA 1FAYA 1GZCA 3IM0A 4K1YA 1A3KA 3N7JA 1D2SA 1HQWA 1LULA 3WDVA 4M00A 2ZGOA 2AENA 5SV8A 1UAIA 3WUCA 1C57A 1JOJA 4JCKA 2WLQA 1AXZA 3VV1A 1ULDA 1LOFA 2PHRA 3GALA 4L8QA 2VW0A 3D6EA 1DQ6A 3WCSA 2GNBA 2DURA 1S0DA 1Z78A 2CWMA 3VKLA 1N1YA 2VW2A 1WLCA 4M3CE 1FATA 3BTAA 3JU9A 1WW5A 2ZGRA 4ASMB
chains in the Genus database with same CATH superfamily
2VPVA 1W05A 4QM9A 5C4WA 3N36A 4YFZA 3I2OA 5IYYA 4JKLA 4O7XA 5JOZA 3C7OA 5FZ6A 3TNQA 5EJ1B 4HONA 5A1LA 4CDUA 2UY9A 1US3A 2I2SA 5FZOA 1AR92 3WG1A 1DQ0A 2HWC3 1HRV2 5LA0A 2DUPA 4R4ZA 3H7YA 3R4SA 4JQRA 3THDA 4AI0A 5AFBA 1OURA 4W6WA 1AR91 3MFAA 4BQYA 5APAA 1YO8A 1FT9A 4YG3A 1YLLA 4F83A 5I93A 1QJY2 4GWMA 3I4IA 1J58A 1YCIA 4Q29A 4B7EA 5A7NA 2KD7A 4CDXA 3N9PA 4IUGA 1U5ZA 3HBKA 4META 1POV3 3OBTA 3KCXA 3E97A 4FXGB 4OUMA 1YFWA 4CXXA 5IFTA 4HVOA 4QHZA 3USUA 5L9BA 1MS0A 4V1PA 1YFUA 2Q8DA 4HL0A 4UFIA 3NV2A 4QAWA 4XFIA 3RS6A 3VHRA 1O4TA 2RS53 1H1MA 4HG6B 3MIBA 3N9NA 1UYYA 3K48A 1OQEA 1V00A 4LBNA 1MZ6A 5BNOC 1S0EA 3VBOC 5BY5A 2QDNA 3QACA 1YFYA 4OLLA 4C91A 2TNFA 5E16A 5FBZA 3LAGA 1VBA3 2BBVA 1S0GA 1R083 2TEPA 1U5XA 1XE7A 2XJTA 2DCTA 4UOJA 1D7PM 5DAWA 1N1TA 2ZTNA 1FMD3 4E4HA 2G9ZA 1W8ZA 1MQTC 1RB8G 4NVPA 5GJ6A 2JG8C 3W20A 5FPXA 1RUNA 2BERA 1U5IA 2HBTA 2YDEA 3WNMA 4CCLA 2WJSA 3O5SA 1B09A 1RL3A 5FP4A 5C7GA 5LY2A 4E9KA 3HNMA 1O3SA 1CAXB 4Q27A 3DXUA 4MXWB 5BNNC 3AB0A 1CGPA 4LKFA 3BGAA 1NYWA 2WFF2 3N9QA 3RDIA 4NIDA 2GC1A 1HN0A 4QPGA 1EUUA 4WM7C 3KGLA 2BZDA 2C5DA 3AX4A 4DUXA 3IDAA 2NZ9A 1KQRA 2PAMA 2R49A 2XWJB 2VBPA 4XFAA 2YFUA 2YXSA 2HWF3 1W8NA 4CEYA 3ZXLA 1VJ2A 4XUPA 4IV1B 4MGTA 1UY1A 2OZJA 4XDPA 3B7MA 3I8TA 2CSGA 4CCJA 1Z7S1 1D4M3 1OQ1A 1XYOA 2DCJA 4MO3M 4ATEA 3FFQA 4CUAA 4FTSA 1CX4A 3K77A 3LPGA 3M3QA 3N3HA 4CCKA 3FWEA 1UWWA 2JIJA 3K3OA 2D6NA 1AXKA 3EQEA 1WCSA 1H8TC 2H0BA 2VW1A 3NL1A 3UJQA 2HWF2 4BXFA 1SLCA 1DZQA 2Y60A 4N90A 1CESA 2VZVA 4K21A 4KWUA 1YNAA 3NJYA 4BH9A 2XJRA 1G9DA 4PHZA 1YQ8A 2R043 2J1AA 3T0DA 3VHOA 1CPMA 2AACA 1C1LA 5F5CA 1RMU2 2ZEYA 2JDPA 4LBQA 2E53A 1T2XA 2JDYA 4N53C 5HBAA 4HVQA 1ENRA 1LRHA 3AFKA 1DHKB 1MS5A 4AGVA 4RQPA 4EN0A 1UO9A 4LNVA 5EYXA 2OZ6A 3A0KA 3OGGA 3VKOA 5AC93 4XHXA 1X50A 1C5HA 4G4FA 3UK9A 3IB3A 1QKQA 1P8JA 2OS2A 4LA2A 2DBNA 2CU5A 1QIQA 4WM8C 3AP4A 5FZAA 1IPKA 3A0NA 3ZKYA 3JUUA 5A3WA 4AVBA 4DB5A 4DQAA 5A3LA 5IFPA 2EAKA 4LK7A 5FY8A 3TEWA 4QQOA 4BIFA 4LQRA 3VZMA 4NIAA 1BZWA 4XE9A 3BYWA 1PO12 1Y9MA 1R081 4WBBA 1W03A 3ZMNA 3O1VA 3OYWA 1AL23 4TXWA 2WFF1 3I7DA 2JECA 1ND2A 4S2HA 3ZDSA 4BQ3A 2FZ1A 1GZTA 2JXAA 4N8MA 4XETA 2H6BA 2XXZA 3WF1A 1PIV1 3H3ZA 1UY4A 4PF5A 1M06G 1H4HA 3PJYA 2VMIA 1JZ7A 3VBFB 1UYZA 3DKQA 3RFRA 5I8SA 3I59A 4CZSA 3LCPA 4IEPA 1PO21 5T5OA 3V0BA 4BZ4A 5A6QA 4CU9A 3BTXA 4A6OA 3ASIA 4NOTA 3FX3A 4D69A 3RQ0A 3IAQA 4JDOA 4K8RB 4ZU5A 4E2GA 4Y4RA 1VMHA 4I09A 4KWJA 5D8AA 5A7WA 1SFYA 4LOTA 4R9DA 4AL9A 5CG9A 4XF9A 4LIVA 5C4WC 5E89A 4CP1A 3T2TA 4YM1A 1JU4A 1SPPB 4K9SA 1Q5OA 1JU3A 1D4M1 1NG0A 1V6JA 1Z7S3 1ZVFA 2RE9A 1AYM1 2W68A 3IDCB 4GB33 4ARXA 4ARYA 3AZXA 3OTFA 5CBLA 4Q4Y1 2XB6C 1F8VA 3PVEA 1CZVA 1GSLA 4DXZA 4LKEA 4RQPB 4OZOA 1PZ9A 2XBO2 1V6OA 1PM7A 5A6ZA 5A32B 3VZOA 4YSFA 1W6PB 4XQWA 2WNUC 3THTA 1U0AA 3THPA 4AQTA 4I02A 4COZA 3WDTA 3R05A 4OQ8A 3UKTA 1PO13 1GYKA 4IV1C 3A21A 3MIHA 2W92A 3PU3A 5C33A 4FPHA 5LBCA 1J1TA 4ZY9A 4D0QA 2YU2A 1WBFA 2FD8A 1C28A 5LRSA 4GMP0 2C0ZA 1OPMA 5JZGA 3AXEA 2R1BA 1MZEA 1SFNA 2HWE3 4MHRA 4AYUA 2ZGSA 2RS12 4Y5TA 3TN91 1OUSA 1BBT3 2Y33A 4Z1VA 2HBUA 2W94A 4IV3C 2DCYA 2K9ZA 2VZ1A 4FI9A 5FPBA 4COVA 4NHMA 1CAVA 5J1XA 2EXKA 2RS11 5DZEA 1W04A 4AFBA 2JDZA 5GLZA 3ITQA 4BQ5A 3RJRA 2Y26A 4CU8A 2CNAA 3ELNA 2ZBJA 2JB4A 3SCHA 4EQVA 4QXCA 2X09A 2Y64A 3NVCA 5IVYA 1OH4A 2PHUA 1GQHA 1UY2A 4N43A 2YC0A 2W52A 1HV1A 1RVF1 3IDBB 3Q8CA 4GXLA 3CU7A 5DDJ3 4XFBA 4MX3A 5ANNA 1ND3B 1O91A 3MW4A 3MDPA 3O0XA 4KG8A 2JKBA 3PUSA 3ZN6A 1REEA 1AR73 5CKQA 2RM23 1LESA 4LXLA 3I2JA 4MGZE 4CP2A 3FC0A 4WM8B 2QQPA 3S5AA 1F15A 4IL7A 5FTTC 1SBFA 5IK5A 4XJUA 4ASLA 5J36A 4BQ2A 4JX0A 4Q4W3 1JZ5A 1GOHA 5DXDA 3OCPA 4BXSV 2XUEA 3H8UA 1O5UA 5IVFA 1S55A 1CAVB 5FY7A 3VUOA 1AYN2 3N4MA 3ZYBA 4B29A 1UZYA 3UKVA 2J1TA 4EWEA 2RDNA 5A33B 1SCSA 5JSPA 2D5FA 5LBBA 5EIYB 5FMDA 2DVBA 4LHLA 2QBXA 4NIGA 2W1QA 1O4ZA 2P5BA 3DV8A 2Q8CA 4XCAA 4AVCA 4XUOA 2QQOA 5EHDA 1QXRA 2XVGA 4FPYA 3OY8A 4MHUA 5A3NA 2VNOA 1GKBA 3KZ4C 5A7WB 2LROA 1A8DA 1C8M2 1J3PA 4K3UA 2CL2A 2OW4A 4XILA 4A3ZA 1NUKA 2HWD1 4UF0A 3O1UA 4D94A 3DYOA 1CAUA 4DY3A 3V65A 3C7EA 1W6QB 2Q8OA 3DF0A 2QNKA 2VMDA 2B5HA 2EIEA 5JR2A 1R1A2 2OXBA 2ZGKA 4LBOA 4W50A 5T5PA 1PO11 4N9HA 2WLPA 3I59B 1AZDA 4IE6A 5FZMA 2XJSA 3VD5A 3ZMOA 3VZLA 5BNPA 5IVEA 3ZVXA 5FO7B 4M01A 4GMP3 3MLJA 2VUDA 4CDQC 1YQ6A 4Q26A 5IT6A 4LKDA 1DZTA 2IXLA 3UV9A 1F5JA 2FBEA 4JZRA 3O1OA 4RYDA 4Y3OA 1BBT1 1XOYA 3PU8A 3I3MA 4FP2A 4QPYA 1MEC3 2VECA 3M7AA 3DXTA 3RWNA 3DN7A 3VD7A 1XNCA 1AR82 1E5HA 2NMNA 3E6DA 3NO8A 4OUEA 3VBUA 4DUVA 2P1BA 4XJ8A 4XBNA 1PZ7A 3OY8B 1QGLA 2JDUA 1UF2C 1UW8A 2CDOA 2YU1A 3I3EA 3WOGA 3O0VA 1AF9A 1SBEA 3D3AA 2WZ8A 1BEV1 1W99A 4CDUB 5C6CA 1IS3A 1V6MA 2QJVA 3NKGA 1W3VA 1GP6A 3HAGA 1JODA 1HW5A 2CWSA 2P2KA 5FBJA 5BNOA 3AJYA 4BOWA 1ZRCA 4YZ5A 5JMCA 4CU6A 2ZACA 3M2MA 1W6QA 4B4QA 2ZGLA 2VQ0A 2NQYA 2PHFA 2VJXA 2V5DA 2VULA 2ZGPA 1TME2 3ZXAC 1O3QA 3AYAA 1ALYA 1HB3A 1NCRB 1R1A3 3B01A 2VD7A 3FHAA 3HN1A 5FWEA 5T50A 1JZ8A 2QZ3A 3OJBA 1UIJA 2EICA 3PDQA 1IG3A 1ZA4A 2X10A 5CNAA 5FY9A 5BXXA 2YBKA 4XFFA 2SBAA 4GIQA 3MW2A 1QJX2 4R8HA 3ZDVA 4AI9A 4QDSA 1DG6A 2ZPXA 4XFGA 2Z42A 4YFWA 4PLOA 4LJHA 1ND3C 5FREA 3SCFA 3H9AA 4PDWA 1C8M1 1LR5A 3KT7A 5IHRA 3AMQA 3E5UA 4B8EA 1G9FA 4OMDA 5C9AC 3BB6A 3MIFA 3ACFA 3DKWA 1LOEA 3TN92 4JV4A 3VBOA 1VP6A 5F6LB 5ACA3 1K42A 2ZXQA 2ZMNA 1FOD3 5KHHA 1RUF2 3AKSA 4JRAA 4CCDA 4LR4A 2WA4A 3CJIC 5IJRA 4DNYA 1MQTA 3HJRA 4Y20B 1VBA2 2GN7A 2HWD3 2XLAA 5JR7B 4IV3B 1DU3D 3AP5A 3SEPA 2VMCA 1OMIA 1W9TA 2PMWB 2HWC1 2XQXA 3AZWA 1ENQA 2YC2A 2XONA 2WA3A 5DQ0A 4JC1A 4FPCA 3WW4A 1ZBA3 1LHUA 2QE3A 4O61A 2Z79A 3HPNA 5M0TA 1AR72 3LQCA 3MPBA 4YVSC 4AEDA 3WNPA 5B2GB 3NNGA 3LD8A 4B1LA 1OOPC 2VR4A 1SLBA 1QY4A 1W6OB 5GLVA 1POV1 1Y9QA 4H7LA 4D8MA 2F6BA 4WVWA 3JD72 1CR7A 1F31A 2XL9A 5KXDA 3K46A 4WVMA 3BU0A 3IT8A 3ON7A 4NIIA 3WF2A 2X5IC 1PNGA 4D6RA 4BIOA 2WSVA 2C9KA 2KM2A 2W1SA 4IQPA 5A1FA 5C8CA 5HXMA 3FE5A 1Z7S2 5FZ0A 4BQ4A 2A1XA 4UI9L 1RUE2 5KR7A 4KI5M 1POV0 3WG2A 2VMHA 5FAXA 3WHTA 1SLTA 2ZGQA 5JZGB 5LWBA 4MGQA 3B94A 1Y3TA 1DYPA 4PIZA 5CFDA 3ZYFA 4Z8BA 5FZ3A 2YPJA 3VDAA 4J1WA 2XOMA 1JYXA 4XHBA 1H2MA 4QGLA 3KV6A 2JDNA 4H55A 1ODNA 4LUKA 4QDRA 3T2PA 4CSWA 1YWKA 1V6LA 4BLIA 1RC6A 4A3XA 3IM0A 4HSLA 3U75A 1IZ3A 1RJ7A 1ST8A 4MSVA 3N7JA 1D2SA 1LULA 3H1MA 2WZR2 2H0VA 3HT2A 2AENA 1G6NA 4W8JA 1JOJA 4XURA 4QHBA 4HN1A 5CFDB 3DYMA 1AXZA 3VBOB 3VV1A 3WX5A 1W9SA 1YIPA 4QX5A 5FXWA 4GH4A 1W06A 1DQ6A 5L9RA 3WCSA 2GNBA 2DURA 4A41A 1Z78A 5LCWL 5FK8A 1NLQA 1UYXA 3J4UH 4GQ7A 3DL3A 5I8YA 1HRI2 2ZX2A 1RJ8A 3BI3A 3E6BA 1MACA 1WW5A 1C5IA 4QX8A 4LO5B 3IZOA 3BN6A 1AUYA 3H8RA 2QQVA 4MXVA 2O0OA 4XVHA 4TLFA 3J26N 3WP5A 2ILMA 2WN3A 5IVJA 5HCHA 1OLQA 2R073 1N1SA 1Q56A 2E63A 2W87A 4U2AA 4Y1VA 2ETEA 5GM0A 4FPKA 4CE8A 1LODA 3ENRA 4YVWB 1HDKA 2EXJA 4Z07A 3ZN6B 2RR11 2CAVA 1OPOA 1OLRA 4LBLA 1RUE3 2XUMA 3ZFGA 4K40A 3V0AA 5L9VA 1JOPA 3FBYA 1YJLA 3GBGA 4Q4X2 3R6SA 1VMJA 4M4RA 1QEXA 2B9UA 1GNHA 2C26A 3GNEA 4AF9A 2W46A 3LSDA 4K6BA 3KV5A 2FCVA 1TQ5A 4XC9A 3NNMA 1G9AA 2DUOA 2YFZA 5HV0A 5L7OC 1SPPA 4H3WA 2W91A 2ZOEB 1PO22 4H14A 3MPPG 1RUD2 1LHNA 1TMF3 1EAH2 2R042 4BJ0A 2AC1A 5FP7A 4AI2A 3VHPA 5I91A 5JXJA 5IK7A 4CDWC 2F4LA 2N7GA 5FO9B 2GU9A 2A5ZA 3AP7A 3TB0A 3VKFC 2PLV2 5LA1A 5D8AC 1GWKA 3IMNA 3R4DB 4ZXKA 3FHIB 2B9VA 3WDXA 1B35B 3EMRA 4EN6B 2A3YA 4ISQA 1KGYA 1UYPA 2VM9A 1UPIA 3FL7A 1NCRC 3GDBA 3KGZA 4OMCA 4ZZ5A 2BBAA 5F3IA 1D2QA 1FV3A 2XLFA 1SBDA 2P4EA 2VNGA 1AX0A 2JICA 5BNNB 2X5IA 1VBE2 4QX3A 2WZR1 3HQUA 5AC92 1NE4A 1I1EA 5EWSA 1JS9A 2VUAA 3PTYA 5FUPA 4O9GA 3ZSJA 4YZ1A 3O1SA 3ZFEB 2DYCA 4LUMA 4E27A 1AR63 4AHWA 1JUHA 4IE7A 3B00A 1UMZA 3U78A 4CDQA 3ACIA 2VUCA 3BOPA 4MGYE 4GWNA 5A3PA 3KMHA 1S2KA 4ZZ8A 3IPVB 4QHOA 5IVVA 4OVEA 3HWJA 2BRTA 5JZGC 4AVVA 3OPTA 1COV2 2ZKNA 1AJKA 1WKYA 5L19A 4PDWC 4ZXEA 1VAMA 4N43B 1PMJX 1RUH3 2MPFA 3VZNA 1ND2B 4L2NA 1ASJ3 3SKVA 3ZFFC 1R1ZA 1UNBA 2GMEA 4CCCA 5FZCA 1A34A 3ZFEA 4HOOA 1N1VA 4XXAA 5JXIA 3DPRB 4JTNA 1J3QA 1Y4WA 5LA2A 4MH0E 2P3YA 3LEGA 5FZ9A 1S0BA 5LEJA 2V73A 4XBQA 5BNQA 1XB9A 1ZBE3 4NHXA 4NN0A 4COWA 4AFMA 5LEKA 4EWAA 2OT7A 3ZXDA 3OOXA 1S0IA 2DU0A 3KLSA 4E8CA 2QQIA 2AYHA 1QXPA 1GUIA 1ZZ8A 1RYYA 1RUJ2 2YGMA 3GJAA 1O7FA 2FZ2A 3AKQA 4MOAA 2P3IA 1L7LA 4KMQA 1YJKA 3PLQA 5FK7A 2ZCWA 3PVOA 4Y1UA 1W8HA 1Y43B 1WCQA 4HVRA 3N9MA 1QJX3 1VALA 2VOTA 1W2TA 2X53S 2GALA 2W47A 2RG4A 3O14A 1ZRFA 4CVUA 3HD8B 2MEV3 2OQ7A 4XQ4A 3GCWA 1DLLA 4AQSA 4YW7A 4IEQA 5C9AA 4D7TA 5BV6A 2AUYA 2ZS6B 4HETA 1BMV2 4N9IA 4JDNA 1X9TA 2VC9A 3POBA 4XDQA 5J7MA 4L9BA 5C3OA 2A6VA 3E5QA 5DG2A 1AL0G 1SEFA 2ZX3A 3OSDA 4QXBA 2FQPA 2RJKA 2W2IA 1F4HA 2C4XA 4LA3A 1OI6A 3CQOA 1URXA 4B4PA 4CEWA 2HEWF 3THCA 3WDYA 1NQDA 4RFRB 4XXPA 1RMU3 1NCRA 3A23A 3VBRC 5CAZA 1UCXA 4EE2A 4BLJA 2Q1FA 4UBHA 3SH4A 3W59A 1H2NA 4YW5A 5E6HA 1CJPA 1OD5A 2JE9A 4YZ4A 1V9U2 2RM21 2WIIB 3ZSMA 3VHNA 4LORA 3I2IA 3LA2A 1YI7A 4Y26A 1H4GA 5FZ1A 2YV8A 3ES1A 5CISA 1RUOA 1GZWA 4YYOA 5JWPA 2CGPA 3MEPA 3K75B 1G9BA 3LB9A 4CPBA 1PGL2 3H3LA 2HWF1 3L2HA 1K3IA 1QDCA 4Z82A 4YGCA 1NXD1 4BDVB 1YYNA 4Y22A 4Y5SA 4FCAA 4IW3A 4ZONA 4C1WA 2DDUA 1YUDA 2AZ5A 4BQXA 4HN0A 1LHVA 4LE4A 3VBSC 1UPSA 4CDQB 4X8NA 2G1MA 3AVSA 1N47A 3AYEA 1GBGA 2O8OA 2TBVA 4HKLA 1QJU2 2XKOA 2PTMA 4FOQA 4UFLA 3ZO0B 4HBNA 1WZXA 4XTPA 2Z5WA 5EXOA 2D93A 2XHKA 1RUI2 1OOPB 2E7TA 2RJ2A 5G05L 1QJU1 3NMBA 4A45A 1E5IA 3MLKA 1SZBA 1TEIA 4FOVA 3ORJA 4URTA 2VVEA 3I3DA 1JN2P 4CDWB 5A1AA 2E7AA 3U0ZA 3K3NA 4XFHA 1XSQA 1IS4A 5GZEA 3P6BA 4ATFA 4LO6B 2BNMA 4B1MA 3LDBA 3ES4A 4YLZA 5FYCA 1F35A 4XTMA 2A75A 2X29A 2ADDA 3DPRC 4XF4A 1DIWA 2NN8A 1OA3A 1R092 1D0GA 2TUNA 4NHYA 1UU4A 2MNGA 1OKOA 4P9IA 2R16A 2YYOA 4AGRA 3H7JA 1DQ5A 3RZGA 3VD9A 4AI8A 2V72A 3WQ1A 2XL7A 2FCUA 4AI3A 4NWVA 1H6XA 3A7QA 1QQP2 5DDJ1 5FYBA 3WZ1A 4FPFA 2DTYA 2W0XA 4GD4A 4ET7A 5H9QA 2YB7A 2VMFA 1VBC2 1YEWA 1WMDA 2WQ8A 4GKYA 1IPSA 3ME2A 3ROUA 5CB7A 5BNPB 4AEKA 1UZVA 3PUQA 2BTVC 2CTVA 5FLHA 1JYIA 3RJ2X 4M0HA 1VRH1 3HEIA 4NHLA 4QX2A 4NE9A 3T1MA 2D6LX 1LEDA 2CAUA 4BMEA 4CU7A 3AC0A 1XNAA 2JKXA 5FMOL 1ULGA 1LJ7A 1UOFA 3OF1A 5A3OA 3BIEA 4TWTA 4XJZA 1BYHA 1GICA 5A7QA 5L73A 3RMXA 1Q8SA 2ENRA 4XFCA 3GHMA 1PIV3 1VBA1 5FPVA 3U11A 4X6QB 2ZEXA 1UKRA 3NKTA 1WLDA 1WLTA 2WZEA 4P02B 4Y4YA 5JSOA 3AVRA 1XU1A 3CNAA 3ZR6A 3MGUA 1HXS1 1JHJA 2HEVF 2J1UA 1WD3A 3Q8FA 4YW2A 3J8F1 2VNRA 2W9XA 3UESA 3D5OA 2QQLA 2HWE2 2EALA 3AKTA 3H1WA 1UU6A 2D3PA 3POJA 3MI8A 1OF3A 2BGPA 2OX0A 2WC2A 2XJQA 2Q30A 1C4RA 3IDEA 5FWJA 3NV3A 1CIWA 2YHJA 5FYMA 5T52A 3CL1A 5FZFA 1M4WA 4Q4V3 3S57A 4KBBA 3PIJA 4E4ZA 2Q1MA 2WT2A 1DQ1A 1EUTA 1LCLA 4L11A 5DUUA 1ONAA 2V4AA 3O12A 3H42B 1K5MB 2Q0AA 5HCAA 2BDRA 1HB4A 3WP4A 3J7LA 3KV9A 1AR62 4C8DA 2IVIB 3NJXA 5FXVA 5K0UA 3POSA 2X5IB 2OIIA 1C3HA 4CP9B 3VKMA 2VZPA 3HT1A 3RZMA 5FUIA 3LE0A 5E88A 3ZFGB 2VZQA 1H30A 4BISA 2EA7A 1RUG2 4YG0A 4QPIC 2JG9C 3N9LA 5BUVA 5D8AB 1X8EA 1S0CA 3JCIA 2R6QA 2KXLA 3JZVA 3CZUA 4IEVA 2PHXA 3ZR5A 1CWPA 1XNTA 1APNA 2A3XA 2PYTA 2ZJCA 5DAVA 3VBSB 3ILRA 2RS31 4YZ2A 1DYKA 5ISLA 1LGNA 2B7YA 2E51A 2YGLA 3ECQA 5JOYA 1RUF3 5CYYA 3M8LA 1OXCA 1V9U3 5EYYA 3MYXA 4HANA 3WQ7A 1W9YA 4NR1A 4MGKE 1IG0A 3VBHC 3FUQA 1L3JA 2VTXA 2F17A 1EV11 1RUD3 2J1RA 2RMU3 3JBG3 5C71A 4DINB 4AHYA 3V0AB 1PMHX 5K8SA 1KFXL 5FO8B 4W65A 2ES3A 1N3PA 4JDMA 2WS93 4YW4A 2LW8A 1MEC2 2ET7A 3MF6A 3MFCA 4F3JA 3WNNA 3ZFFB 4DUWA 1MS1A 3MO4A 3WT3A 4UAPA 5A7OA 4CEYC 1F2NA 4IGQA 3RNSA 1HXS2 1GU3A 2BWCA 4Q0SA 1VRBA 5LATA 5A6XA 3WP3A 5F37A 4Z2AA 2IFRA 1X9PA 2O14A 3UGFA 1ENXA 4LHKA 5FPAA 2UURA 1IOAA 4LE3A 3NAPC 4GAZA 4O9EA 3FUOA 4UXAA 5AVPA 4AVAA 4LBJA 3T30A 3AYDA 4H2AA 2KR2A 1GZ9A 5A3MA 4MLOA 3T0BA 2YUEA 5F2WA 2JX9A 1OA2A 1PNFA 1VPHA 1IQDC 1BCXA 1COV3 1NXMA 1XU2A 2VZUA 3AL6A 3H0OA 3ZYRA 4CCMA 2ARBA 2R063 3POFA 4GA9A 2BGCA 3L2YA 4QPGC 4NRQA 5L7OB 4DS0A 3NWKA 5F3GA 2BOJA 1ODMA 2WQZC 4CEYB 2XVKA 3NV1A 4V2VA 1PO23 1VIWB 3S0MA 2W1UA 1AR83 1DF0A 3SH3A 2RMU2 3JBG2 4AEJA 2Y38A 3FLPA 1O3RA 1PGW1 3ACHA 4JVAA 1VBC3 3HQRA 2L9LA 5ERLA 3LPFA 2J42A 1GZWB 1WD4A 2ZKLA 5B4XA 2HWC2 4YGEA 1SG3A 3ZSKA 1JYNA 3RI8A 3TEYA 1IPJA 4IV1A 4R9AA 3ACLA 4Z2WA 4CXWA 4EWDA 5AC91 4NUBA 3EO6A 2JG8A 3C7GA 1POQA 3RWKX 2W5FA 2UWCA 3BIWE 4NMIA 1LOGA 2BVVA 4XQDA 2AEYA 2V4VA 2FDKA 1UU5A 1LKNA 2IXHA 2R1DA 4FVVA 3CHXA 2XWBB 3I3BA 1DGWX 5FMCA 5IK4A 1W6OA 2QQJA 2XR4A 4YW1A 4E2SA 2YBPA 2J1EA 1E57A 3OPWA 4NO4A 4GMP1 4D7YA 4J1XA 3O1PA 4F7ZA 1Q43A 2D5HA 3PNAA 2WZPP 4AFDA 2P6CA 1UMIA 4LHNA 2WNVB 3T08A 4GH4B 2W39A 1EV13 2WL1A 2RVAA 2HWE1 5F9TA 2A3WA 3AKRA 1F5FA 3LA7A 3OUHA 3H8XA 4LBQB 1NCQB 2Y34A 3Q8AA 3CBNA 4Q2FA 4E2QA 1DZRA 2VZOA 3N7LA 2P34A 4HPKA 3H1YA 4ZHNA 5CVRA 3KM5A 1US2A 2GNTA 3AZYA 4WM7B 1AJOA 4AQ6A 1DP0A 2A7AA 1XE0A 3N7MA 3VD3A 5F32A 5H9RA 2YMZA 4QXHA 1AYN1 1VBB3 1VB4A 2OUHA 4DXSA 1JHNA 3VBHB 1Q8OA 2GH8A 2R7EB 3OGVA 4BQ1A 2QQKA 4DZGA 2KA3A 2WNVC 1GZCA 4K1YA 1A3KA 1XSRA 3GM8A 1HQWA 3CIHA 4M00A 2PHDA 1UAIA 1C57A 2ZX1A 4JCKA 1AR61 4JGYC 2WLQA 5JIAA 1ULDA 3ALQA 3GALA 1YI9A 2IXCA 4MG2A 1RUI3 3GF6A 5HXVA 1S0DA 4LULA 2J1SA 2YPDA 3A22A 4NPLA 2CWMA 5FUNA 1WLCA 5IAVA 2FDGA 5A70A 3BTAA 3JU9A 3PUIA 4LLOA 2O8QA 5KC5A 3POYA 2Q8EA 2ZZJA 4CCNA 3K4DA 3O1TA 5DN2A 3PIGA 1QQP3 1H2KA 1SHWB 4IXLA 1BBT2 1W9WA 2VCBA 4IEWA 2VXJA 2XKPA 3MUY1 1EP0A 1RINA 3B93A 4HK9A 3AMMA 1ZBE1 1JZ2A 4BB3A 1WW4A 2VOWA 1C8NA 3VKNA 1ULPA 1UZWA 4BPZA 3T3YA 1AX2A 3DECA 5I0TA 4NRPA 1PIV2 1XYNA 3TN93 5ACA2 5BNPC 2GMMA 4KBZA 4KU7A 1EV12 1KXGA 1VMFA 1GANA 2G9GA 2ZMLA 2R041 5F3EA 5T5JA 1REFA 1G86A 1QHDA 1HJGA 3APBA 2ZHNA 4AEDB 4HT1T 1WCUA 3RZJA 2XDVA 5LASA 1W8TA 3SHRA 4RFT0 3AM2A 1SLIA 2ZAAA 2CDPA 1EY2A 1LU1A 4RL7A 4FT8A 1RXGA 3F2ZA 1XPWA 4YZ3A 2DCKA 4D7SA 2YROA 4Y20A 3ZYPA 5FZ4A 2VE1A 3I2HA 3WDUA 4DY5A 4MUVA 1JZ6A 2G9FA 4K7JA 4UW5A 5IVBA 4YPJA 4KL1A 3BODA 1D4M2 2EF6A 3KCCA 5LBEA 3M3IA 3LEKA 4J6GA 2PHLA 4JHZA 5FZHA 4E4DX 2XHNA 3HN3A 4QPIA 5FZLA 4FAHA 2JG9A 1U12A 2Z4FA 1OSGA 1O8PA 2DCZA 1JBCA 4D6QA 3BCWA 5CFCA 3B3QE 1HRI1 1Q8PA 4FFIA 5A7SA 5DPNA 5ABJC 5KXCA 5T55A 4H7MA 5GZFA 1DDLA 2WFF3 3QOPA 4IE4A 4GJYA 5CG8A 5C4WB 4TN7A 4XUNA 2CV6A 1RIRA 2GP3A 4I01A 3CMGA 1PM4A 4XAEA 2LRPA 5C5UA 2VZSA 3JQWA 5A3UA 1FMD1 2JG9B 3DUIA 5LZ6A 4LO4B 4LO8A 4TYSA 5FLJA 3RZHA 1PGL1 4FPJA 1JYWA 5F2SA 4CEWB 2XVLA 1FXZA 2VG9A 4JGZA 1KRIA 4L99A 4GB32 1VBD2 5EPAA 3WF3A 2Z69A 4LKSA 2ERFA 5C5TA 2ZHLA 4UFJA 1WA4A 1YIFA 3KHBA 1TVGA 4A44A 3WW1A 4FFHA 3KF5A 4AOCA 4EZ4A 1TME3 1VBD1 5I0DA 3I2DA 3AXDA 5JPNB 4XMAA 3WR0A 2VMGA 1O5LA 1SLAA 3CEWA 1PX3A 2OVUA 1DCSA 3PMEA 2UYAA 3KHCA 2DFCA 3IPVA 2BFUL 3C7FA 2WDBA 2R071 2J22A 4R52A 2BVBA 2Y6FA 1G8WA 4XACA 1BK0A 3ZYIB 1JTZX 3BTYA 2MEV1 3TNPB 5IUQA 1WCKA 3BTZA 4GJZA 3OGJA 5D2AA 1RUE1 1SQ4A 4PIYA 1CONA 3JD71 2K2SA 3W21A 3ZPYA 5CEHA 4Z92B 2E26A 4JTOA 3PJQA 1LGCA 4QWNA 2C1FA 4N7UA 5GLUA 3ZX7A 3VD4A 1WW7A 3GGLA 5DG1A 4A7YA 4XZUG 1AL22 4S2GA 2V5YA 2ORXA 4QB1A 4QKBA 3RSJA 2QFEA 1JUIA 4QX0A 3Q9OA 5K0UB 3Q8EA 1W6NA 1AL21 3TAYA 4KH9A 4MYEA 3IN9A 1ZBA1 4EROA 4I0BA 4YM0A 1PMIA 2VZTA 4MV2A 2BQPA 1NX9A 3KT4A 2FDJA 1JMUB 5JMOA 1EPZA 1TE1B 4GWJA 4QD2A 3SKJE 4C0HA 3VBUB 5C8WA 4S2FA 5FV3A 4IGOA 4COYA 5IAXA 1CJDA 1HV0A 1NY71 4QPGB 4I2OA 4MADA 5A6YA 1W2NA 2VUJA 2ORZA 4FFGA 4KWKA 4W6XA 4AVSA 3KF3A 2UWAA 5JIUA 1DBNA 3W58A 5DAXA 2A6YA 1E5RA 3I2FA 3IKWA 3F95A 2D7FA 1OD3A 5FY0A 1N3OA 1JH5A 2EXIA 3CO2A 4XIOA 4EN9B 3P3PA 2AEZA 1QJY1 3VBFA 3SISA 3OD4A 1OFSA 4AR2A 1HKDA 5FOBB 2JJ6A 2C24A 4RN5A 3WNLA 3LEMA 2CY6A 4A2UA 4CRQA 2Y6LA 3K51A 3D0JA 1V6IA 4XJ9A 5FYUA 3T2QA 1ULEA 2WT0A 1IS5A 4QPIB 4QQLA 3NJZA 5DUVA 1VBB2 2YG0A 4PF1A 5FYIA 4RR3C 2E33A 4XIKA 1FMD2 2GP5A 4UF0B 1HB2A 2DTWA 1XNKA 4Q4X1 1QU0A 1S2BA 4K8FA 3T09A 4QU1A 2K46A 3MIEA 3L9JT 1UXZA 4HMZA 3WF4A 2OA2A 2RR12 1O6UA 1XNDA 1R093 3EBRA 2YC4A 3VBHA 4YARA 2PELA 3B5LB 1O3TA 1W2OA 1RTVA 4XUTA 1EAH1 2Y0OA 3I49A 4UW3A 2E32A 4MVTA 3LSEA 2OQ6A 1H9PA 2CGNA 3R4UA 1OOPA 1LGBA 3U4XA 4B3NA 1F4AA 2HH9A 3POGA 1IKPA 4LIUA 2UY8A 3TWIA 2ZAHA 4FPEA 4Q8KA 1RUC1 5KXEA 4OHZA 5AFEA 1AX1A 3LF7A 1V6KA 4OI2A 4QB2A 4QQPA 1W6PA 1WCDJ 3BU7A 4Y22B 5T5LA 3WG4A 1DYOA 1X8MA 2YY1A 1BKZA 2XMLA 1QJZA 5FQ0B 1AYM3 3LEIA 3MHZA 3AJZA 1ZZCA 1RITA 3GJBA 1YFXA 1VBE1 2Q5TA 1NA1C 4FFFA 2B39A 5FXXA 4FTEA 4HKWA 1BMV1 3RI9A 3ABZA 1IHMA 2JDAA 5K7PA 4BA6A 3HVDA 1WMEA 4LBMA 4ES9A 2NMOA 4R9CA 4XOGA 4XF3A 5FZBA 4DXRA 3MLLA 2ZGMA 3MBWA 2WNUB 3VBRA 2FDHA 5FXZA 4JGYA 2ZGTA 4YVSB 4WVMB 1MQTB 3WXPA 3M4FA 1KDKA 2BGOA 2VH9A 1I6XA 2WWJA 1NQJA 1H2LA 2JG8B 3QBQA 2AR6A 4FOWA 4HLTA 2OUJA 1OH3A 3LA3A 1MEC1 4HPKB 4QX1A 2WNEA 3V64A 3PVNA 4MXWA 1AXYA 3PHMA 3K4AA 3NV4A 1HRV1 1HJFA 1W6MB 4MGIE 1YC61 4RSUA 2NP0A 3ILFA 1GOGA 4GULA 4LHSA 1LHOA 5JVVA 1ZA7A 3WQ0A 3FFZA 4YM3A 1KJRA 1KS4A 3OEBA 3P3NA 2WFPA 2IC1A 1B35C 4OI1A 2D98A 4WZCA 4A7KA 4XF0A 3I2KA 1UX7A 1W0OA 1PGSA 3E5XA 4XJWA 3WY6A 4DMIA 4AHZA 3WG3A 1SMVA 1CQ9A 3MV11 3MW3A 3OEAA 4Q4Y2 5LW9A 3LOBA 1GQPA 3BPZA 3VN4A 4NWWA 1YXWA 3VBUC 3AFGA 1PVC3 5FZIA 2XBO1 2BOIA 1TNFA 1ZRRA 3GCXA 3KQRA 2CYFA 5CA6A 1D4VB 2HYKA 1KD7A 3VBFC 3ZFFA 5A3TA 2K0GA 3ZXGA 1DGWA 1WMFA 4QDQA 2ATFA 3V56A 4EJRA 5F5IA 3KV4A 3C8XA 1ZM1A 3VZKA 3ZFEC 1OFNA 3KVAA 3UKNA 1NE6A 3ZYJB 5DZGA 5GLTA 3AKPA 3HOBA 1DQ2A 1R091 1PGW2 1S0JA 3M3OA 4DXTA 3KCYA 4OUSA 4EN8B 1W3XA 3B69A 5FQ0A 1XNBA 4YWAA 2RS33 2YBSA 2OYZA 3M3CA 4GH4C 1XQNA 4OHXA 3ZXEA 5FRAA 1ND2C 5F5QA 2XJPA 3WINE 5ABJA 1VAKA 1H9WA 1MS3A 2PHWA 5FP9A 2Y6KA 2BU9A 5A32A 3IBMA 1NCQC 1FOD1 4YW3A 5EJZB 3FHQA 5FZ8A 2NM1A 3CLPA 3OB8A 4DO0A 1FV2A 1L7QA 4B4RA 1JW6A 4K1ZA 2W08A 2BPA2 2VY0A 4NAMA 4RQPC 3O7OA 1GP5A 5JOWA 1HN1A 1QH6A 2WO7A 3I97A 5LY1A 4M3CF 4P9LA 2B46X 2VCCA 1QOOA 1LECA 3ATGA 2B42B 5LBFA 2JWPA 3LKJA 4IETA 3RYKA 3LDRA 4FPLA 4Q0QA 1XBFA 2P3JA 1ZRIA 4FO9A 3M70A 3USUB 5IK8A 1RUG3 1H8TA 3C3VA 3LOIA 4P5YA 3WD5A 1UZ0A 4NJ4A 4P9GA 4YG6A 4CTEA 5CKNA 1RHI3 2IXJA 2R32A 5GALA 2VCAA 2DU1A 1BLZA 4U36A 5EZWA 3CJIA 5FY4A 5L7OA 4LEJA 2PAKA 2WO1A 3LIHA 5FJKA 2DVDA 2JDMA 2ZA9A 3DYPA 4RHV1 3ZYGA 2PAEA 3EYPA 2O1QA 3RZKA 2CGOA 3GXUA 4PLMA 1DFQA 3OBZA 3W5NA 3FLRA 2C6SA 1XXNA 3BPSA 2WO2A 4DRRA 5F3CA 1J84A 1RHI2 3NQHA 3O1MA 3WW2A 1AR71 3GHNA 4I3GA 3KD4A 2VOKA 4X8PA 4CEWC 4GZ9A 4XEZA 1W6NB 2EVXA 3SC7X 1I5ZA 1OUXA 1W8FA 1SDDB 3D4KA 3VGIA 4BWOA 1GMMA 1JI6A 4DOUA 3H50A 1JZ3A 2GSYA 1HIXA 3HMYA 3MIGA 4A42A 2XGXA 4BK4A 3WF0A 1LEMA 5JPMB 5KC6A 1MVQA 3WV6A 5BYNA 4FOYA 3WP6A 3GZAA 1PX4A 2I07B 3EB7A 2AGSA 1O8SA 5T3NA 3UT0A 4AWDA 4L92A 2DBIA 3INAA 4JRLA 2PXJA 1I9RA 4XCBA 5C3PA 1BHGA 2PLV3 4JAAA 4ZS2A 1J1LA 3MIDA 4ITCA 3D0SA 2IXKA 1I5PA 4RS5C 4KGQA 3SQOA 3MV01 2WQ4A 4QGMA 5KHIA 2WS92 2D97A 3KWVA 1Y7BA 2ZZQA 1GWLA 2DVAA 3U10A 1KS5A 5A33A 4QXKA 3ZM8A 2JDHA 4ASKA 5C3RA 2Q1ZB 4ONUA 2WINB 1UOBA 1WBLA 2B4KA 4ORFA 5JAXA 1J59A 1OVPA 4ISRA 4B7KA 4BQWA 4BE3A 3AZZA 1UY0A 2GN3A 4N43C 5I8TA 3OBRA 5C70A 1RGSA 1OVSA 1QNYA 5FZGA 2RV9A 2WNOA 3ZIXA 4G3YC 3W5MA 1ZBE2 2PQSA 1NKGA 2JB8A 1AR93 1OT5A 1GV9A 2BV4A 1R082 1I3HA 3VZJA 4K20A 2Y6JA 5GZGA 2VGDA 2UWBA 4Q4Y3 2RDSA 4Y1YA 4ES8A 1MS4A 2AREA 4AEMA 4CP0A 3QH6A 5K9YA 3JXSA 3RYPA 1BEV2 4C90A 1ZZ6A 3M1HA 1IGOA 5CIRA 1YQ2A 3NW4A 4JKKA 2EIDA 4OHYA 4QT6A 4M4PA 3WNXA 5AVAA 1GWMA 1FPN2 1CN1A 2XJUA 1MZ5A 4A7ZA 1CPNA 3WLUA 1IS6A 1RHI1 3A4UA 3UNPA 1FPN1 4V2WA 4Y5Z0 2XJVA 3U1XA 2WR9A 1EYBA 4DEQA 1DLCA 1H8VA 2F4PA 1SFPA 4P9YA 3QCWA 5FYHA 3B02A 4KG0A 1RMU1 2DFBA 1CVNA 3T4HB 2A6ZA 4N53B 4FAGA 2JEMA 2GC2A 2HWD2 3J8F2 4XW3A 4Y24A 4XMIA 4R9BA 1ND3A 3WW3A 2XH6A 1QWRA 2R072 1ZX5A 1RUI1 1WLWA 1BK1A 3LGRA 1R1A1 3VL8A 1OHFA 1K5MC 3ACGA 4QQ2A 4KNCA 2WUHA 4UT5A 4KU8A 1FAYA 1RUJ1 4PJYA 3LDKA 3KVBA 3U4SA 3ZN5A 1QH7A 3TEXA 2ZGOA 5SV8A 3WUCA 1CAWA 1UOJA 3HIFA 3BALA 4LMFA 4GB31 2WNUA 3VBRB 3NJVA 4L8QA 2LM3A 1NA1A 3J7NA 2R062 4SBVA 1ZRDA 3VKLA 2VW2A 1QJU3 4M3CE 1BVVA 2QQNA 2QUOA 1LAJA 3UETA 3GBFA 2ZGRA 3VL9A 5KXBA 2HYXA 2QTWB 1ZZ9A 4RS5A 1QXJA 3GZEA 4AK3A 1PK6B 3WUDA 5DUWA 1UIKA 3ZN4A 3RVHA 2FCTA 3U37A 4EN7B 4KQ7A 4Q0PA 3TYJA 4WV8A 3ETPA 5CADA 2MEV2 5FYSA 4CUBA 4MGSA 4RGKA 4WVZA 1A8MA 2D44A 2JENA 1AYM2 3KB5A 2GC3A 3PL0A 1UN1A 4XUQA 5F7UA 2IXIA 2A73B 4HFSA 5FYTA 4XJAA 4UBGA 5IATA 4QM8A 2NLRA 4CDXB 4YRDA 3JD73 3UJOA 1CZTA 2BNOA 2VTXJ 4CP9A 4YM2A 1ZREA 3UGHA 1UMHA 2ET1A 2D6PA 4PIXA 4UYBA 4D3WA 2VQTA 3PUHA 3CJXA 4G9SB 2WZR3 4XF1A 5FP3A 4TLGA 5FIXA 4Q5OA 5HV4A 5J37A 5FP8A 4JQTA 2LALA 3ZIWA 2B8MA 1FYUA 1CAXA 2Q4SA 4OHVA 4BM8A 5JUVA 2WAOA 4Q8LA 3V0BB 2RDRA 4IEUA 4PT6A 3ZSEA 1UY3A 1RUF1 3MUZ1 4Y1ZA 5FMOS 2E31A 5DAPA 5HCBA 5IVCA 2LS6A 1X82A 5EQUA 2XQRA 5JSRA 3TRSB 3SH5A 5HI0A 1HXS3 3WEZA 2G4IA 4QPWA 1CAWB 4GWIA 4Q4W1 1SLLA 3RZLA 4Y1XA 2IZWA 3NAPA 4IE5A 4NAOA 5FLIA 4WZFA 3KSCA 2WS91 5DAQA 2RS32 3GYDA 4FQZA 1HB1A 1HQNA 3ETQA 4Q0UA 4QB6A 5JI7A 3HNYM 1BQPA 1NCQA 2P3KA 4LPLA 4WM8A 4Q4V1 4YVSA 1IQAA 5E1RA 3RG0A 1RUJ3 3VDBA 2IUWA 1Q8QA 3C2UA 3USSA 1HLCA 1QOSA 1GR3A 2EIGA 1FNYA 2OPWA 3AP6A 4LOSA 4QGNA 3T0AA 3RZZA 4AE2A 5I0SA 1LNSA 4ZKTB 3K4ZA 3T2OA 2RJLA 3MZHA 2QKDA 5LK7B 5D1IA 5J98B 1TNRA 1IKQA 5C8CC 5KBFA 4P14A 4FQ4A 1NT0A 1LOAA 1OQDA 1MS9A 3CKHA 1HQLA 3CJIB 1X7NA 3WHUA 1G9CA 4DEVA 2FDFA 1W8WA 3J7HA 4Y33A 1MVEA 4QKFA 5CFDC 2VBBA 2D3SA 1PVXA 1V70A 3N7KA 4CPBD 2C9AA 2ZABA 3ILNA 3GBWA 5KHJA 4BMBA 1GFF2 4CXYA 1YHFA 2EXHA 1C8M3 4EV0A 4AEDC 1KDMA 1WW6A 1DGLA 2JE7A 1NZIA 2BWAA 1ZNPA 2NYYA 1MR5A 3QLQA 4HSJA 1B35A 1KITA 1W90A 2H6CA 4F8AA 2ID4A 4CUGA 2GDFA 1QF3A 4JKMA 2DVFA 1T6GC 3N35A 1AHSA 2P17A 4OHWA 5C8CB 4BHPA 1HX6A 2VVDA 3IAPA 1W8UA 2G19A 2FMYA 1KFUL 1WWYA 4LT5A 2VMEA 5FY5A 1OLMA 3WNKA 5F5AA 3OG2A 4XYXA 1VBE3 3E1F1 1S4CA 4BU2A 1R64A 1F9KA 2BNNA 1PZ8A 4C1XA 2PHTA 2A6WA 4EZHA 4INDA 1MZFA 1NLSA 2AH2A 2RS13 3POEA 4YNIA 4NPMA 1PVC2 1GNZA 4YGBA 3FLTA 1W2UA 4L97A 1NY72 3P1IA 4NHKA 5T54A 2WO3A 3NNJA 3VDCA 4PBOA 4RGAA 2VVFA 3D8CA 4A6SA 2ZEWA 3S6PA 3DEMA 1W9FA 3NRUA 1GP4A 5H9SA 2GAUA 1RVF3 4Q1RA 2Y0IA 2VZRA 3E6CC 3ZKUA 1OF4A 1RXFA 3PTRB 5TSWA 2VZ3A 4UW6A 4PI2A 1VE0A 2BEOA 5KHGA 5CFCB 2ADEA 1WGPA 1Z0HA 2HWB1 1A78A 5CU1A 3HR9A 5JXGA 1UOGA 2JD4A 4M3CB 3SMHA 2R061 4NPRA 2D6KA 3P5BA 4ZU4A 1QMJA 1T6BX 2QQMA 4MZUA 2WN2A 5LRRA 5F1RA 5EV7A 2WYFA 2WBKA 4QQHA 4E4SA 3PMSA 1C1FA 5FZOB 4Q4V2 4QKNA 1SACA 1VLNA 1Y9GA 3HBZA 1AR81 1UZZA 3ZXFA 5GKAC 1ASJ1 3BVCA 1AYN3 5EP9A 1W2AX 3FN9A 4D6SA 5ACA1 4IE0A 2WSUA 3AP9A 2RHPA 3T1LA 3J8F3 3TEZA 4KWLA 4CDUC 2SLIA 2Y8KA 2XPJA 3ZSLA 2LUWA 4AG4A 4W6YA 2HLEA 5L36A 4I0AA 1UL9A 3R0RA 1BXHA 3AZVA 4YGDA 5FZ7A 3ZFGC 2A70A 4FXKB 3K2OA 3VDDB 1RUH2 3LWCA 2GMPA 4LK6A 4NRMA 1AVBA 4YW6A 5JOXA 5JLVA 4IEYA 3KQ4B 1STMA 4P00B 4BYYA 1W0PA 2Y6GA 1L7RA 2A71A 3AL5A 3M3EA 3S7IA 3CZJA 4CDXC 3MICA 3S7EA 1NZCA 2IFWA 1OA4A 4KGGA 1OC1A 5C3SA 5H9PA 1QOTA 3GZUC 5FOJB 2VOVA 3U14A 2WAAA 4CDWA 3X29B 2OPKA 4AFCA 5FMBA 5DUXA 1QJX1 3RYRA 3VLBB 3D82A 1H1IA 4COUA 5JDBA 2QVSB 2WABA 1ZBA2 1N3QA 2I74A 5FY1A 3SNMA 1K5MA 2P37A 1UX6A 2RR13 1PK6A 4AAXA 5FFOC 5DZFA 1HRV3 4AHXA 3OGSA 1LTEA 3EHKA 3TBDA 3NNLA 1UD1A 4UFHA 3NNFA 5ABJB 2E9QA 4OFGA 5BPXA 3ZXJA 1SDWA 3POWA 3BKZA 2QQUA 3N9OA 3QD6A 1YQ5A 2WRAA 1LENA 1G7YA 2VQAA 2RDQA 4DPNA 1RUG1 2WNVA 2Z2SB 4PI0A 2UYBA 4E8DA 2PFWA 1V9U1 2RM22 4HZFA 2R0HA 2VL4A 2HWB2 1GLHA 3C7HA 3AMPA 3FBMA 4IGPA 3DGTA 2WT1A 4P9XA 3ZXKA 1VBB1 1FX5A 2RMU1 3JBG1 1XYPA 3PVBB 4UFMA 4ZS3A 1J83A 5I0UA 2XBO3 1REDA 3T4VA 2DWRA 1ENSA 4UFKA 1LOBA 1QNWA 2PA7A 5G04L 2UU8A 1RVF2 2VXRA 4PQ9A 4QMAA 2HWB3 3SEEA 1PHMA 1QJY3 2QCSB 2WWSA 3AYCA 3MF9A 4PDWB 4Q1PA 2ARXA 4PQQA 4AXOA 2ARAA 2NPIA 4CUCA 5HPOA 4HXCA 1VAVA 3AK0A 4IEXA 2JE8A 5FYZA 1MS8A 4AFAA 1Q3EA 3W9AA 3OGRA 5FPZA 4P08A 1W8OA 1ASJ2 4XBLA 3PURA 3CDZB 1BJQA 1K12A 4PCRA 2OKXA 3WQBA 3OUIA 5KHKA 3DCQA 3UGGA 1TZOA 2I45A 5GLWA 5CFCC 2QQWA 4L0PA 4YVWC 2BW8A 1OBNA 1JOBA 4IEOA 1DGRN 1FI2A 5HCFA 2WWUA 2JD9A 4OZXA 1JZ4A 2FDIA 4RD7A 1WUVA 3SITA 1RUH1 5FYYA 5DMYA 1GNYA 1LB2A 5J96B 5FZDA 4OI0A 4P5HA 2W3JA 1NA1B 2BP6A 2WKKA 3LFIA 4IEZA 4P9JA 1TG7A 1VBC1 3JQXA 3FJSA 4PBPA 1D0HA 3WSOA 1X36A 1RUC3 1J3RA 1V6NA 2JDKA 4I3PA 2DF7A 3IIAA 1XJAA 4DFSA 2D40A 5C9AB 5IWFA 5GZCA 4W4ZA 5CKMA 2Y6HA 3B9CA 4A4AA 4CCEA 2IVJA 1W0NA 4JHTA 2BJSA 4RHV3 4ZPIA 2X05A 4SLIA 4CYDA 4LLFA 5JCTA 1W28A 3H8OA 1DQ4A 4XAAA 2VNVA 4DRVA 2HJIA 1H8TB 1W39A 4UWDA 1E5SA 2VBDA 3RRDA 4ZU7A 5BNNA 2DV9A 2RS52 4XZPA 4X6RB 1S1AA 1QJFA 2GZWA 1ULOA 2D43A 1NAEA 2LTNA 3WDWA 2VO5A 1MPXA 3UYJA 1VRH3 3AMHA 3G7DA 3LZZA 4AGGA 3OUJA 4CA9A 4AW7A 1QDOA 3EJKA 5CZKA 3VB9A 4GALA 5EFUA 1UQXA 1LOCA 4CCOA 3I3QA 3HNBM 2BUKA 3O0WA 1KEXA 4LTAA 3S30A 4IERA 1FPN3 3G6JB 3IIIA 5LA9A 1YQCA 1S0FA 3I2GA 3LFMA 1ZYBA 3WNOA 1VR3A 2E6VA 2X8KA 4JGZC 3JB4C 5KWRA 3UL2A 2PLV1 4P9WA 3SXWA 3H3UA 3RGBA 4FBFA 2R30A 5DABA 1RUD1 3EXUA 4LBQD 1GOFA 4XPVA 5FZEA 4C0BA 4TTGA 3BUCA 5BNOB 1LOFC 2W1WA 1ZZ7A 4JGYB 1FNZA 5GZDA 1K5JA 1SCRA 3POIA 5A80A 1CIYA 5ANQA 1U5YA 2ARCA 5FKCA 4M0NA 1H1AA 4QX7A 4NIHA 3JB8A 2XLGA 4RR3A 2VAUA 4WVVA 1RUC2 3SLIA 1TME1 1VBD3 3J9SA 3OBAA 5FPLA 4N53A 5E8AA 5I0RA 1JYVA 1FOD2 2BYVE 1ULFA 5JI9A 1WMXA 2DVGA 4OCTA 4WM7A 4XABA 4LBKA 4HK8A 1XRUA 3TOJA 4OYUA 5J09A 5K4LA 5FCCA 3ST7A 1K45A 1DGRA 4XDOA 3U07A 4HKOA 2V09A 2ZX0A 1VRH2 3ZLIA 1O4YA 4DIQA 1ZZBA 4RR3B 4Q4X3 5IW0A 5EJ3A 2ZHKA 3OPZA 2BFUS 3BOWA 2EAAA 2R0FA 1S2EA 1COV1 3WVJA 3RMYA 3WCRA 5FYVA 1GQGA 3ZPOA 5F6KA 4I30A 2B45X 1VB2A 2W95A 4LO7A 4OULA 3CF6E 5J3UA 1JYTA 1H6YA 4BK5A 3OYWB 3GZTB 1OKQA 4S2DA 5FKBA 3RPQA 4EYUA 1ULCA 4Q4W2 1YRZA 2FMDA 4RHV2 3I54A 4OI4A 4IESA 4IV3A 2IWGB 3IWZA 4M3CA 4AQ2A 2GH2A 1BVP1 3FMGA 5LB6A 2D6OX 4LITA 4UW4A 4Q0VA 3VBSA 4RA0A 4AZZA 2WYSA 1JXNA 4R4XA 3KS7A 2VCMA 1TMF1 2HEYF 2QDRA 5A7PA 2FHRA 1XE8A 4O65A 5FR3A 1EPWA 5LK5A 1UXXX 3ZOIA 5FJHA 2XG3A 5FZKA 2GNMA 1V0AA 3FZ3A 4QU2A 3ZYHA 2JIGA 4FPOB 1TMF2 1KJLA 2MHFA 3LIGA 4J25A 2RS51 5F39A 3J7MA 4TZDA 1O59A 2YZ4A 2E7QA 3QH7A 3VDDA 4FPGA 3PUAA 3URFA 4AI1A 4N7IA 1X33A 1H0BA 2A6XA 2PN5A 2VU9A 5F8PA 4OQ9A 1CZSA 4AVTA 1BEV3 1Q8VA 2VOXA 2ZMKA 1UKGA 4FP3A 4PLNA 5K0UC 2D3RA 2ZGUA 1W6MA 3B9IA 1LHWA 2DUQA 2D6MA 2QZ2A 5FDBA 1XC6A 1A6CA 1ACCA 1JYCA 5D21A 4RS5B 1NLRA 3IMMA 1LU2A 3Q8BA 5SV5A 2GNDA 2GC0A 2J1VA 2VQUA 1QJEA 5C3QA 2ZX4A 2ZGNA 2ZHMA 4IDZA 3KT1A 1OLME 2EIBA 3S5QA 5J48A 4BCUA 5FPUA 4GKXA 1CD3G 3NSTA 1HRI3 3AMNA 3VDDC 1NOVA 4AAPA 3HQXA 4QKDA 2HKXA 5B4NA 3WDVA 2P6HA 4I0WB 4RGGA 1QQP1 5DDJ2 1EAH3 4FTBA 2J7MA 1CAUB 2PQQA 1LOFA 2CHHA 2VTFA 2PHRA 3O1RA 4JGZB 3NAPB 4URAA 4YVWA 4NROA 2VW0A 1PK6C 3D6EA 3SCGA 5JXHA 4TSVA 1CX1A 1N1YA 2ZEZA 1WA6X 1FATA 3DPRA 1PVC1 4FSJA 4ASMB 3OD0A
chains in the Genus database with same CATH topology
2VPVA 4QM9A 5C4WA 3N36A 4YFZA 5JOZA 3TNQA 4CDUA 2UY9A 2I2SA 1AR92 3WG1A 1DQ0A 2HWC3 1HRV2 2DUPA 4R4ZA 3H7YA 3R4SA 4JQRA 4AI0A 5AFBA 4W6WA 1AR91 3MFAA 1YO8A 1FT9A 4YG3A 1YLLA 4F83A 5I93A 1QJY2 4GWMA 3I4IA 1J58A 1YCIA 4Q29A 4B7EA 4CDXA 1U5ZA 4META 1POV3 3OBTA 3KCXA 3E97A 4FXGB 4OUMA 1YFWA 4HVOA 3USUA 1MS0A 4V1PA 1YFUA 4HL0A 3NV2A 4XFIA 3RS6A 3VHRA 1O4TA 2RS53 1H1MA 3MIBA 3K48A 1OQEA 1V00A 4LBNA 1MZ6A 5BNOC 1S0EA 3VBOC 5BY5A 2QDNA 3QACA 1YFYA 4OLLA 2TNFA 5E16A 5FBZA 3LAGA 1VBA3 2BBVA 1S0GA 1R083 2TEPA 1U5XA 1XE7A 2XJTA 2DCTA 1N1TA 2ZTNA 1FMD3 1MQTC 1RB8G 4NVPA 5GJ6A 2JG8C 5FPXA 1RUNA 1U5IA 2YDEA 2WJSA 3O5SA 1B09A 1RL3A 4E9KA 1O3SA 1CAXB 4Q27A 4MXWB 5BNNC 3AB0A 1CGPA 1NYWA 2WFF2 3RDIA 2GC1A 4QPGA 4WM7C 3KGLA 2C5DA 3AX4A 2NZ9A 1KQRA 2PAMA 2R49A 2XWJB 4XFAA 2YXSA 2HWF3 4CEYA 3ZXLA 1VJ2A 4IV1B 2OZJA 3B7MA 3I8TA 1Z7S1 1D4M3 1OQ1A 1XYOA 2DCJA 4ATEA 4FTSA 3FFQA 1CX4A 3M3QA 3N3HA 3FWEA 2D6NA 1AXKA 3EQEA 1WCSA 1H8TC 2H0BA 2VW1A 3NL1A 3UJQA 2HWF2 1SLCA 1DZQA 4N90A 1CESA 4K21A 1YNAA 4BH9A 2XJRA 1G9DA 2R043 3VHOA 1CPMA 1C1LA 1RMU2 4LBQA 2E53A 4N53C 5HBAA 4HVQA 1ENRA 1LRHA 3AFKA 1DHKB 1MS5A 4AGVA 4RQPA 4EN0A 4LNVA 5EYXA 2OZ6A 3A0KA 3OGGA 3VKOA 5AC93 4XHXA 1X50A 1C5HA 4G4FA 3UK9A 1QKQA 4LA2A 4WM8C 3AP4A 1IPKA 3A0NA 4AVBA 3JUUA 4DQAA 4DB5A 5A3LA 2EAKA 4QQOA 4BIFA 3VZMA 1BZWA 4XE9A 1PO12 1R081 4WBBA 3ZMNA 3OYWA 1AL23 2WFF1 3I7DA 2JECA 1ND2A 4S2HA 3ZDSA 2FZ1A 2JXAA 4XETA 2H6BA 1PIV1 3H3ZA 4PF5A 1M06G 1H4HA 3PJYA 2VMIA 3VBFB 5I8SA 3I59A 4CZSA 3LCPA 4IEPA 1PO21 5T5OA 3V0BA 4BZ4A 3ASIA 4NOTA 3FX3A 4D69A 3RQ0A 4JDOA 4ZU5A 4E2GA 4I09A 4KWJA 5D8AA 1SFYA 4R9DA 5CG9A 4XF9A 5C4WC 5E89A 4CP1A 3T2TA 4YM1A 4K9SA 1Q5OA 1NG0A 1D4M1 2W68A 1V6JA 1Z7S3 1ZVFA 2RE9A 1AYM1 3IDCB 3PHMA 4GB33 3AZXA 3OTFA 5CBLA 4Q4Y1 2XB6C 1F8VA 3PVEA 1GSLA 4DXZA 4RQPB 1PZ9A 2XBO2 1V6OA 1PM7A 5A32B 3VZOA 4YSFA 1W6PB 4XQWA 2WNUC 3THTA 1U0AA 3THPA 4AQTA 4I02A 4COZA 3WDTA 3R05A 3UKTA 1PO13 1GYKA 4IV1C 3MIHA 5C33A 4FPHA 1J1TA 1WBFA 1C28A 5LRSA 4GMP0 2C0ZA 1OPMA 5JZGA 3AXEA 2R1BA 1MZEA 1SFNA 2HWE3 4AYUA 2ZGSA 2RS12 3TN91 1BBT3 4Z1VA 4IV3C 2DCYA 2K9ZA 4COVA 4NHMA 1CAVA 2EXKA 2RS11 5DZEA 4AFBA 2JDZA 5GLZA 3RJRA 2Y26A 2CNAA 3ELNA 2ZBJA 3SCHA 3NVCA 2PHUA 1GQHA 4N43A 2YC0A 2W52A 1HV1A 1RVF1 3IDBB 4GXLA 3CU7A 5DDJ3 4XFBA 4MX3A 1ND3B 1O91A 3MW4A 3MDPA 3O0XA 4KG8A 2JKBA 3ZN6A 1REEA 1AR73 2RM23 1LESA 4CP2A 4MGZE 3FC0A 4WM8B 2QQPA 4IL7A 5FTTC 1SBFA 5IK5A 4XJUA 4ASLA 5J36A 4Q4W3 5DXDA 3OCPA 3H8UA 1O5UA 1S55A 1CAVB 3VUOA 1AYN2 3N4MA 4B29A 1UZYA 3UKVA 4EWEA 5A33B 1SCSA 5JSPA 2D5FA 2DVBA 4LHLA 1O4ZA 3DV8A 4AVCA 1QXRA 2XVGA 4FPYA 3OY8A 2VNOA 1GKBA 3KZ4C 1C8M2 1A8DA 1J3PA 4K3UA 2CL2A 2OW4A 4XILA 2HWD1 4D94A 1CAUA 4DY3A 3V65A 1W6QB 2Q8OA 3DF0A 2QNKA 2B5HA 1R1A2 4LBOA 2ZGKA 5T5PA 1PO11 4N9HA 2WLPA 3I59B 1AZDA 3ZMOA 2XJSA 3VZLA 5BNPA 3ZVXA 5FO7B 4M01A 4GMP3 3MLJA 4CDQC 4Q26A 5IT6A 1DZTA 2IXLA 3UV9A 1F5JA 2FBEA 1BBT1 4FP2A 4QPYA 1MEC3 2VECA 3M7AA 3RWNA 3DN7A 1XNCA 1AR82 3E6DA 2NMNA 3NO8A 3VBUA 4XJ8A 1PZ7A 3OY8B 1QGLA 1UF2C 1UW8A 3WOGA 3O0VA 1AF9A 1SBEA 1BEV1 4CDUB 5C6CA 1IS3A 1V6MA 2QJVA 3NKGA 3HAGA 1HW5A 2CWSA 2P2KA 5BNOA 3AJYA 4BOWA 1ZRCA 4YZ5A 5JMCA 2ZACA 3M2MA 1W6QA 4B4QA 2ZGLA 2VQ0A 2NQYA 2PHFA 2ZGPA 2VULA 3ZXAC 1O3QA 1TME2 3AYAA 1ALYA 1NCRB 1R1A3 3B01A 3HN1A 5T50A 2QZ3A 3OJBA 1UIJA 1ZA4A 5CNAA 5BXXA 4XFFA 2SBAA 4GIQA 3MW2A 1QJX2 4R8HA 1DG6A 2ZPXA 4XFGA 2Z42A 4YFWA 4PLOA 5FREA 1ND3C 3SCFA 3H9AA 4PDWA 1C8M1 1LR5A 3KT7A 3AMQA 3E5UA 4B8EA 1G9FA 5C9AC 3BB6A 3MIFA 3DKWA 1LOEA 3TN92 4JV4A 3VBOA 1VP6A 5F6LB 5ACA3 2ZMNA 1FOD3 5KHHA 1RUF2 3AKSA 4JRAA 4LR4A 2WA4A 3CJIC 4DNYA 1MQTA 4Y20B 1VBA2 2GN7A 2HWD3 2XLAA 5JR7B 4IV3B 1DU3D 3AP5A 1OMIA 3AZWA 2HWC1 1ENQA 2WA3A 4JC1A 4FPCA 3WW4A 1ZBA3 1LHUA 2QE3A 2Z79A 1AR72 3MPBA 4YVSC 4AEDA 5B2GB 1OOPC 1SLBA 1QY4A 1W6OB 5GLVA 1POV1 1Y9QA 4H7LA 2F6BA 4WVWA 3JD72 1CR7A 1F31A 2XL9A 5KXDA 4WVMA 3IT8A 2X5IC 1PNGA 4BIOA 2WSVA 2KM2A 4IQPA 5C8CA 3FE5A 1Z7S2 1RUE2 3WG2A 1POV0 2VMHA 5FAXA 3WHTA 1SLTA 2ZGQA 5JZGB 3B94A 1Y3TA 1DYPA 4PIZA 5CFDA 4Z8BA 2YPJA 4J1WA 4XHBA 1H2MA 4QGLA 4H55A 4LUKA 1YWKA 1V6LA 4BLIA 1RC6A 4A3XA 3IM0A 4HSLA 1IZ3A 1RJ7A 4MSVA 3N7JA 1D2SA 1LULA 3H1MA 2WZR2 2H0VA 3HT2A 2AENA 1G6NA 1JOJA 4QHBA 4HN1A 5CFDB 3VBOB 1AXZA 3VV1A 3WX5A 1YIPA 4QX5A 4GH4A 1DQ6A 3WCSA 2GNBA 2DURA 1Z78A 3J4UH 4GQ7A 3DL3A 5I8YA 1HRI2 2ZX2A 1RJ8A 3E6BA 1C5IA 1WW5A 1MACA 4LO5B 1AUYA 4MXVA 2O0OA 4TLFA 3J26N 3WP5A 2ILMA 1OLQA 2R073 1N1SA 1Q56A 2E63A 4U2AA 4Y1VA 2ETEA 5GM0A 4FPKA 1LODA 3ENRA 4YVWB 1HDKA 2EXJA 4Z07A 3ZN6B 2RR11 2CAVA 1OPOA 1OLRA 4LBLA 1RUE3 2XUMA 3ZFGA 4K40A 3V0AA 3FBYA 1YJLA 3GBGA 4Q4X2 3R6SA 2B9UA 1GNHA 3GNEA 4AF9A 3LSDA 4K6BA 1TQ5A 1G9AA 2DUOA 5L7OC 4H3WA 2ZOEB 1PO22 4H14A 3MPPG 1RUD2 1LHNA 1TMF3 1EAH2 2R042 4AI2A 3VHPA 5I91A 5IK7A 4CDWC 2N7GA 5FO9B 2GU9A 2A5ZA 3AP7A 3TB0A 3VKFC 2PLV2 5D8AC 3IMNA 3R4DB 4ZXKA 3FHIB 3WDXA 1B35B 4EN6B 2A3YA 4ISQA 1UPIA 1NCRC 3KGZA 1D2QA 1FV3A 2XLFA 1SBDA 2VNGA 1AX0A 2JICA 5BNNB 2X5IA 1VBE2 2WZR1 5AC92 1NE4A 1I1EA 5EWSA 2VUAA 3PTYA 4O9GA 3ZSJA 4YZ1A 3ZFEB 2DYCA 4LUMA 4E27A 1AR63 4AHWA 1JUHA 3B00A 1UMZA 4CDQA 3BOPA 4MGYE 4GWNA 3KMHA 1S2KA 3IPVB 4OVEA 3HWJA 5JZGC 4AVVA 1COV2 2ZKNA 1AJKA 5L19A 4PDWC 1VAMA 4N43B 1RUH3 3VZNA 2MPFA 1ND2B 4L2NA 1ASJ3 3ZFFC 1R1ZA 2GMEA 3ZFEA 1N1VA 4XXAA 3DPRB 4JTNA 1J3QA 4MH0E 1S0BA 5LEJA 2V73A 4XBQA 5BNQA 5LEKA 1ZBE3 4NN0A 4COWA 4AFMA 4EWAA 3ZXDA 1S0IA 2DU0A 3KLSA 2AYHA 1QXPA 1ZZ8A 1RUJ2 2YGMA 1O7FA 2FZ2A 3AKQA 2P3IA 1YJKA 3PLQA 2ZCWA 3PVOA 4Y1UA 1Y43B 4HVRA 1QJX3 1VALA 3O14A 2X53S 2GALA 1ZRFA 3HD8B 2MEV3 4XQ4A 1DLLA 4AQSA 4IEQA 5C9AA 4D7TA 5BV6A 2AUYA 2ZS6B 4HETA 1BMV2 4N9IA 4JDNA 4XDQA 5J7MA 4L9BA 2A6VA 3E5QA 5DG2A 1AL0G 1SEFA 2ZX3A 2FQPA 2RJKA 4LA3A 1OI6A 1URXA 4B4PA 4CEWA 2HEWF 3WDYA 1NQDA 4XXPA 1RMU3 1NCRA 3VBRC 5CAZA 1UCXA 4BLJA 3W59A 4UBHA 3SH4A 1H2NA 4YW5A 1CJPA 1OD5A 2JE9A 4YZ4A 1V9U2 2RM21 2WIIB 3ZSMA 3VHNA 3LA2A 1YI7A 4Y26A 1H4GA 2YV8A 3ES1A 1RUOA 1GZWA 4YYOA 5JWPA 2CGPA 3MEPA 1G9BA 3LB9A 1PGL2 2HWF1 3L2HA 1QDCA 4Z82A 4YGCA 1NXD1 1YYNA 4Y22A 4C1WA 4FCAA 1YUDA 2AZ5A 4CDQB 4HN0A 1LHVA 4LE4A 3VBSC 1UPSA 4X8NA 1N47A 3AYEA 1GBGA 2O8OA 2TBVA 4HKLA 1QJU2 2XKOA 2PTMA 4FOQA 3ZO0B 4HBNA 4XTPA 2Z5WA 5EXOA 2D93A 2XHKA 1RUI2 1OOPB 2E7TA 1QJU1 3MLKA 1TEIA 4FOVA 4URTA 2VVEA 3U0ZA 1JN2P 4CDWB 2E7AA 4XFHA 1IS4A 5GZEA 4ATFA 4LO6B 2BNMA 3ES4A 4YLZA 4XTMA 2A75A 2X29A 3DPRC 4XF4A 1DIWA 2NN8A 1OA3A 1R092 1D0GA 2TUNA 1UU4A 2MNGA 4P9IA 2R16A 2YYOA 4AGRA 3H7JA 1DQ5A 4AI8A 3WQ1A 2XL7A 4AI3A 4NWVA 1QQP2 5DDJ1 3WZ1A 4FPFA 2DTYA 2W0XA 5H9QA 1VBC2 1WMDA 4GKYA 5BNPB 3ME2A 3ROUA 5CB7A 4AEKA 2BTVC 2CTVA 5FLHA 1JYIA 3RJ2X 4M0HA 1VRH1 4NHLA 3T1MA 2D6LX 1LEDA 2CAUA 4BMEA 5FMOL 1ULGA 1LJ7A 3OF1A 4TWTA 4XJZA 1BYHA 1GICA 5L73A 3RMXA 1Q8SA 2ENRA 4XFCA 3GHMA 1PIV3 1VBA1 3U11A 4X6QB 3NKTA 1UKRA 1WLDA 1WLTA 4Y4YA 5JSOA 1XU1A 3CNAA 3MGUA 1HXS1 2HEVF 4YW2A 1WD3A 3J8F1 2VNRA 3D5OA 2HWE2 3AKTA 2EALA 3H1WA 1UU6A 2D3PA 3MI8A 2WC2A 2XJQA 2Q30A 1C4RA 3IDEA 3NV3A 1CIWA 2YHJA 5T52A 3CL1A 1M4WA 4Q4V3 4KBBA 4E4ZA 2Q1MA 2WT2A 1DQ1A 1LCLA 4L11A 5DUUA 1ONAA 3O12A 1K5MB 2Q0AA 5HCAA 3WP4A 1AR62 5K0UA 3POSA 2X5IB 2OIIA 1C3HA 3VKMA 3HT1A 5E88A 3ZFGB 1H30A 2EA7A 1RUG2 4YG0A 4QPIC 2JG9C 5BUVA 5D8AB 1X8EA 1S0CA 3JCIA 2R6QA 2KXLA 3JZVA 4IEVA 2PHXA 1APNA 2A3XA 2PYTA 2ZJCA 3VBSB 3ILRA 2RS31 4YZ2A 1DYKA 1LGNA 2B7YA 2E51A 2YGLA 3ECQA 5JOYA 1RUF3 3M8LA 1V9U3 5EYYA 3MYXA 4HANA 3WQ7A 4NR1A 4MGKE 3VBHC 3FUQA 1L3JA 1EV11 1RUD3 2RMU3 3JBG3 4DINB 4AHYA 3V0AB 5K8SA 1KFXL 5FO8B 4W65A 2ES3A 1N3PA 4JDMA 2WS93 4YW4A 2ET7A 1MEC2 3MF6A 3MFCA 4F3JA 3ZFFB 1MS1A 3WT3A 4CEYC 1F2NA 3RNSA 1HXS2 2BWCA 4Q0SA 3WP3A 2IFRA 1ENXA 4LHKA 2UURA 1IOAA 4LE3A 3NAPC 4O9EA