2A70A

Crystal structure of emp47p carbohydrate recognition domain (crd), monoclinic crystal form 2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
222
structure length
222
Chain Sequence
GSDASKLSSDYSLPDLINTRKVPNNWQTGEQASLEEGRIVLTSNQNSKGSLWLKQGFDLKDSFTMEWTFRSVGYSGQTDGGISFWFVQDSNIPRDKQLYNGPVNYDGLQLLVDNNGPLGPTLRGQLNDGQKPVDKTKIYDQSFASCLMGYQDSSVPSTIRVTYDLEDDNLLKVQVDNKVCFQTRKVRFPSGSYRIGVTAQNGAVNNNAESFEIFKMQFFNGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the carbohydrate recognition domain of Ca2+-independent cargo receptors Emp46p and Emp47p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Sugar binding protein
molecule keywords Emp47p
total genus 58
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2a70A00
1QDOA 1YXWA 2E7TA 4LBQD 3T2TA 1WCSA 4Q27A 1W6OA 2H0BA 3ZYPA 4GA9A 4DFSA 5DUXA 4CTEA 2WKKA 4YGEA 5F5QA 3ILFA 3WLUA 4AGGA 1PZ9A 2DVDA 2WJSA 3ZXEA 1MVEA 2ZAAA 3FUOA 5H9QA 3PMEA 1HKDA 1BKZA 2LALA 2ZHLA 1G9DA 2R0FA 3AXEA 4LBMA 4YM0A 1FV2A 3T1MA 2DTWA 3OYWA 2ZGQA 3GALA 3SLIA 5H9PA 1JYIA 3M3CA 1ULDA 3R4SA 1KQRA 3AJYA 4XXAA 2A5ZA 1J1TA 3SH4A 2E53A 4FPKA 4AGRA 3USUA 1CESA 3V64A 5CAZA 1ENRA 3MEPA 2WT0A 1Q8OA 3ENRA 2GMMA 3QCWA 3WDWA 5JLVA 3RRDA 3POSA 1DYKA 1YYNA 1KDKA 2CL2A 5IK4A 4P9YA 3T1LA 4M3CF 3AK0A 3ATGA 4GKYA 4HL0A 4Q8LA 5IUQA 1I1EA 4XZPA 3RS6A 1WD4A 2A7AA 4DS0A 1B09A 2UWCA 4XJ9A 2LTNA 2EXIA 2CTVA 1AVBA 2AREA 3A0KA 5F9TA 1IKQA 2ENRA 2YROA 4PQ9A 4Q26A 3V0BA 4YLZA 4LBOA 3MW3A 1GZCA 4XHBA 4TZDA 1A3KA 1AJOA 5IK7A 2RHPA 1OQ1A 4DRVA 5DZGA 3HMYA 1LU1A 2W39A 3I4IA 2OW4A 2A3XA 2C5DA 2D3PA 4GKXA 4FQZA 4BPZA 3PJQA 4YGCA 1ULGA 5JVVA 5CBLA 1Z78A 5E8AA 4RA0A 2D6OX 3NV2A 3OPZA 3AJZA 4Y22A 4ASMB 2Q5TA 1DLLA 1AF9A 3N7JA 4LBJA 3IMNA 4TYSA 1FNYA 1ULCA 4XJAA 2D6NA 2KM2A 2UURA 1FATA 1SBFA 2JDZA 3APBA 5DUVA 3WCRA 3MPPG 1UAIA 2BQPA 3I8TA 3NV4A 1YI7A 4GWNA 1FV3A 4AWDA 1W6QB 4YW1A 3AZVA 1NLSA 4WZFA 1RITA 1AX2A 1MS4A 5FREA 1LHUA 3VV1A 1V6IA 2WSVA 2SLIA 2D3SA 4PBOA 2ZGLA 3QLQA 4FPEA 1G86A 1A8DA 2ZKNA 4YW3A 3D5OA 3V0AB 2ZGSA 1CN1A 4MYEA 2A3WA 1V6LA 1VAMA 3WHTA 2AUYA 2GDFA 1LHWA 2ZMLA 1AX0A 3OBTA 1C1FA 1VALA 5T50A 3ZXJA 4WV8A 1XQNA 3D4KA 5JDBA 1S0IA 1JN2P 1WLDA 3VUOA 2E51A 4BQ1A 4CRQA 1YO8A 5L73A 1SCSA 3KM5A 3M3EA 2P34A 5DZEA 4LBKA 1BYHA 4XJUA 1AXZA 1DQ4A 1GANA 3ZSLA 4U2AA 3AZWA 5T54A 1IOAA 1CVNA 3IM0A 2R49A 1W6MA 2ZGMA 1LU2A 4YM3A 4XILA 1H30A 2EXJA 2JD4A 3V0BB 3WG1A 2GALA 2Z42A 2HYKA 1QF3A 2VW1A 3O0VA 1G7YA 1Y7BA 4FOQA 1G8WA 3AYAA 1WBFA 2ZGRA 4AGVA 4BLJA 5KXBA 4Q8KA 2ARBA 4YM1A 2ZABA 3HN1A 2EALA 3AYCA 2E7QA 4FQ4A 4GALA 3UK9A 1UZYA 2SBAA 3AP4A 4XHXA 3SH3A 2VW2A 5GLZA 5CNAA 2ZBJA 2ZZJA 1W6QA 1S0EA 3AYEA 3FLPA 4M01A 2EXHA 1DQ6A 1LOFC 5GZEA 1ULFA 2FMDA 3WV6A 5DXDA 3WHUA 1WW5A 1BQPA 1DIWA 3SITA 3B69A 3UJOA 4YGBA 1Q8PA 3AZXA 4XTMA 1JBCA 3RSJA 5JMCA 4YG6A 5AVAA 4AYUA 1SCRA 1SBDA 1MS8A 3VKOA 1QU0A 5H9SA 1KJLA 1LEMA 3WNXA 2I2SA 2PELA 2NYYA 1SFYA 4YW5A 1G9CA 1ONAA 2NMNA 3AX4A 4YW4A 1Q56A 2B7YA 4Y22B 3WDUA 2PHUA 4NO4A 5CA6A 1JHNA 1LODA 1W0PA 4UW5A 5GALA 5JOWA 2W68A 5EYXA 5JOZA 2EXKA 1F31A 1VIWB 2JE9A 2JKBA 1HQWA 1KITA 1DYPA 3TB0A 1RIRA 3M2MA 1JOJA 3BTAA 2CNAA 2WLQA 1QNYA 4JC1A 1W6NA 3ZSJA 5E88A 3AP6A 2ZACA 1DZQA 1AX1A 5T5JA 1MVQA 2EAKA 4ISQA 1QKQA 2CYFA 3LCPA 3OBRA 4D69A 5T5LA 1N1VA 2V5YA 4ATEA 2DURA 4CZSA 5EYYA 3M3OA 3B3QE 5T52A 3NV3A 1CR7A 1ULEA 3VKNA 1MS9A 4ITCA 3ILNA 1SLBA 1MS5A 4Y26A 2R1DA 3LSDA 1QNWA 2C9AA 2OUHA 4Y1ZA 4RL7A 5HCAA 3ZXKA 2E6VA 1ENQA 2YXSA 1IS6A 4YZ1A 4L8QA 2GMPA 3USUB 1S0FA 2AENA 2GNDA 2VXRA 3AP9A 4P14A 4Q1PA 4BOWA 3AP5A 5DG1A 1V6NA 4ZXKA 2A6WA 1JYCA 2DVBA 3AP7A 4FP2A 4YZ5A 1UN1A 1TEIA 1HLCA 1S0DA 2DTYA 2DVAA 2JE7A 3R05A 3ZSKA 5IT6A 1N1TA 1IS5A 1UL9A 4Q1RA 3V65A 5E89A 2GNTA 1AZDA 2DU0A 5CB7A 1MS1A 1LULA 1N47A 2YY1A 1CPNA 2W52A 5JOYA 2FHRA 3ASIA 1LHVA 3WCSA 1LOFA 2TEPA 3OGGA 5IK8A 1DHKB 1LOBA 1UKGA 1VAVA 1VLNA 1FYUA 4LBQB 4XTPA 1ZM1A 1OFSA 1UX6A 2P3IA 4Y1UA 3VKFC 5KXEA 3O0WA 2AR6A 1DBNA 2GNBA 1GSLA 2A75A 4Y1XA 2GN7A 2PHFA 3OY8B 4Z8BA 3POYA 1IKPA 4PF5A 2WNEA 4DPNA 2OVUA 1WLCA 2D7FA 5SV8A 3WG4A 1KRIA 1F9KA 2D6LX 2G4IA 3PVEA 3RMYA 3A4UA 4BMEA 4FPHA 2DWRA 5HCBA 3FLTA 4BLIA 1RINA 2CWSA 1ZA4A 1X50A 5T5PA 4GXLA 3SNMA 3ZXLA 4I30A 2CWMA 4XYXA 1QOSA 3BOPA 1C4RA 5GLWA 1SACA 4F83A 1S0JA 2EIGA 4YM2A 1GNZA 1PZ7A 3IKWA 1CIWA 1CONA 2DVGA 3VKMA 3NV1A 4C1WA 2D3RA 3C2UA 1DGLA 1DQ2A 3FLRA 1OKQA 3O0XA 3ILRA 3N7MA 1AXYA 1Q8VA 2D44A 2D43A 1O4YA 2ZA9A 3ZPYA 1V6KA 4XMAA 2ARXA 1CJPA 4LBQA 4R9CA 1GBGA 2ZMNA 4XJZA 1LHOA 4XOGA 4AVVA 1YIFA 3N7LA 3FBYA 1IS4A 2DYCA 1JUIA 1DQ0A 1V00A 1S0GA 4FP3A 3WDXA 2ZGOA 1V6JA 4JRAA 5H9RA 4YG0A 4DRRA 2P3KA 2YMZA 3CNAA 3M3QA 2YV8A 3ZVXA 1NXD1 3N35A 4YW2A 3RQ0A 1WUVA 4LBNA 4XDQA 2W08A 3B00A 3SH5A 1MR5A 1LCLA 2D6KA 2NZ9A 4C1XA 4Q2FA 2NMOA 2ZMKA 3UL2A 4Y24A 3AZZA 1SLAA 3SISA 1CPMA 2OUJA 2NN8A 5KXDA 4UW3A 3JU9A 1W0OA 1F5FA 4YGDA 2D6PA 2V73A 4YZ3A 3L2YA 2AGSA 2A3YA 4K20A 2ES3A 2DVFA 1G9BA 2ZGTA 4Y20B 1DQ5A 3WDVA 1N3OA 3WUCA 2WT1A 1IS3A 3V0AA 1SLLA 1Z0HA 5DG2A 4YZ2A 3HR9A 3OJBA 4P9WA 1WW7A 4AVTA 3ZXFA 2XB6C 1AXKA 1QOTA 4FPLA 2UWAA 3B9CA 4NOTA 5GLUA 2ZGUA 4HANA 2ZHKA 4R9AA 3DGTA 1D0HA 4U36A 2A71A 2DUOA 1JXNA 3D6EA 4FOYA 1W6NB 3MW4A 1KJRA 1LENA 2ZGNA 3FFZA 2PHTA 4YFWA 1C1LA 3OYWB 4PBPA 4UW6A 4M00A 4KBBA 1SBEA 5T55A 3H0OA 2NM1A 4XBNA 1MZ6A 4XXPA 5HCFA 3WDYA 3ZSMA 3RMXA 1ENSA 2A6XA 3POWA 3INAA 2JECA 3W58A 3R4UA 3N3HA 4FPFA 4M3CA 1KDMA 1V6OA 4PCRA 1MS0A 4ISRA 1LESA 1LGNA 5BYNA 4M3CB 2UWBA 1BZWA 5GJ6A 1LEDA 2VU9A 5DUUA 3AFKA 5GZDA 1S1AA 3ZYRA 3W59A 1LOGA 2A6VA 1MS3A 1UPSA 1URXA 3IPVB 5EWSA 2YZ4A 4XJWA 4AVSA 1UZZA 2A6YA 3N36A 3AXDA 4P9XA 1UMZA 4FPJA 4BMBA 4BM8A 1FX5A 3MW2A 2CY6A 1I3HA 4Y1VA 1HDKA 3B01A 5GZGA 4XJ8A 4WVVA 2VH9A 1MZ5A 4FPOB 2R0HA 1DQ1A 5IK5A 3FUQA 1Q8SA 1H9PA 2PHWA 1N3PA 1C57A 1GV9A 3N7KA 4LBLA 5EXOA 1LOCA 1U0AA 3WDTA 2DUPA 2GMEA 4YFZA 1GZ9A 5FRAA 1LGCA 5GM0A 5GZCA 3Q9OA 1APNA 1GKBA 1QGLA 3WG3A 2R16A 1EPWA 4UW4A 4YG3A 5LK5A 3WOGA 1HQLA 4Y20A 1V6MA 1S0CA 2UU8A 4K21A 2D6MA 1W6PA 2WT2A 1W6MB 1S0BA 4JCKA 4H55A 1A78A 4XBLA 4FOVA 1QDCA 1GYKA 3WG2A 2ZGKA 1CQ9A 1BJQA 1N1YA 4ATFA 2DV9A 3NWKA 2WQZC 3LSEA 1LJ7A 3UJQA 1GLHA 4XBQA 5GLTA 1GZWB 1GZWA 1QOOA 1SLTA 3PVNA 1G9FA 2A6ZA 3AYDA 4M3CE 4XE9A 2PHRA 3WUDA 1R1ZA 1G9AA 3JUUA 1AJKA 1H9WA 2ERFA 2AH2A 1GICA 2A70A 4K1ZA 2R1BA 2WSUA 3AZYA 3U4XA 1W6OB 1N3QA 1W6PB 1WW6A 2JJ6A 3O5SA 5T5OA 4FOWA 4IQPA 3TAYA 1Q8QA 3A0NA 1SLCA 3O12A 3GNEA 4ZKTB 1JW6A 2ZGPA 4Y1YA 1GNHA 2VW0A 4R9BA 5DZFA 1FNZA 4DQAA 1SLIA 5JOXA 3WZ1A 2ZHMA 1DFQA 3PVOA 1N1SA 4FPGA 2DUQA 1LOAA 5GLVA 2AYHA 1QMJA 4XMIA 4YZ4A 2P3JA 2GN3A 2GNMA 2XG3A 2DU1A 3WVJA 4XIOA 3BIWE 1LECA 1PZ8A 5GZFA 1WLWA 1FAYA 2VY0A 3IN9A 1MACA 1O4ZA 4FPYA 2P2KA 4W65A 4SLIA 1BXHA 4WVWA 2PHXA 1LOEA 4XIKA 3OY8A 4R9DA 4GWMA 1WBLA 2ZHNA 2VUAA 5DUWA 3VKLA 2P37A 2NP0A 3RG0A 3KQRA 4FVVA 3BODA 4FPCA 1LHNA 1WD3A 3M1HA 3DUIA 1LGBA 5KXCA 1LTEA 1D2SA 1YRZA 4OZXA 3IPVA 4K1YA 1WW4A 2EF6A
chains in the Genus database with same CATH superfamily
2Z79A 2HWF1 1YXWA 2VVFA 5CISA 4LBQD 4Q27A 2R073 4QB1A 2WZPP 2BZDA 4HSLA 4OI4A 1LNSA 2WNVB 3RZLA 4DFSA 2WUHA 1R093 3DN7A 4CCJA 3ZYFA 3ILFA 1X7NA 1UW8A 2PLV1 4QXBA 2WJSA 3LOIA 5FZEA 3OUJA 1CX1A 5FV3A 1LAJA 1HKDA 2LALA 2P17A 4YM0A 4LBMA 1CZTA 2XVLA 2R063 3T1MA 3ZFFC 1IZ3A 4WM7B 2B46X 5FZLA 1AUYA 2Q1ZB 3J9SA 3SLIA 3ZMOA 4CEWB 3FFQA 4N8MA 4XXAA 5HXVA 5A6QA 5C3RA 4DUVA 5KWRA 1KXGA 1D4M3 4FPKA 4JTOA 3KLSA 3LPGA 1MEC1 1ENRA 4LQRA 1YCIA 1Q8OA 1Z7S3 3ENRA 4PJYA 1MZEA 1QIQA 4BK5A 3BTZA 2XWJB 1DYKA 1Q3EA 3POSA 3RI9A 4CEWC 1B35A 1B35B 5I8TA 4LK6A 3T4HB 2CL2A 3T1LA 1IQAA 4AFMA 5FYYA 3LFMA 4D8MA 3IWZA 3NNLA 1HB1A 4ZU5A 5FBJA 4K9SA 1COV1 3RS6A 4JKMA 1F4HA 4C90A 1QY4A 2JD9A 2DCJA 4QU2A 1UPIA 3RI8A 1AVBA 1FMD2 3ZFGC 5EQUA 3CDZB 4CEWA 1O7FA 4K3UA 2W46A 5IYYA 1W90A 4TZDA 3RYKA 3THDA 4SBVA 2XJRA 5JI7A 3ZFFB 3KHBA 4CDQB 5C3SA 4AL9A 1DGWA 4ZZ8A 3HMYA 5FZCA 3T0AA 2OW4A 2A3XA 5C4WB 4GKXA 4BPZA 1QWRA 1ULGA 1UO9A 2KR2A 5B4XA 1OOPC 4HN0A 3LQCA 2VMEA 3VDAA 4A3ZA 4CP0A 1K5MB 4ASMB 3DF0A 1MEC2 1IG3A 2XJQA 1DLLA 5BPXA 1AF9A 1DZTA 4NWWA 4LBJA 2HWD2 2VQTA 1BEV2 4ZS3A 5HXMA 2KM2A 2UURA 1FATA 4KGQA 5F6KA 1R083 3APBA 5DUVA 5KHJA 1PX3A 2VUDA 4A6OA 4OYUA 2VAUA 2QVSB 4LHLA 1VBB1 5A3WA 4DB5A 3I8TA 3LF7A 1NCQB 1UQXA 5BNQA 5FO8B 3CL1A 1YI7A 4GWNA 4UWDA 1VE0A 1FV3A 4AWDA 4MUVA 1VJ2A 3LE0A 1TE1B 2UY9A 4JGYC 2OPWA 2XKOA 4WZFA 1AR63 3SKVA 5FOJB 1ASJ3 2QQOA 1ODNA 4F8AA 4BQ3A 2XQXA 4L97A 2WSVA 2D3SA 3PUQA 1PO21 3BPZA 3SCFA 4HFSA 4DY3A 3UNPA 1CAUB 1A8DA 1S2EA 1UYPA 1RUJ2 3V0AB 1ULPA 1QJFA 3SXWA 1V6LA 1LR5A 2WINB 2Q8CA 4MGTA 1JH5A 5BUVA 3OGJA 3MZHA 4QWNA 5JWPA 1GWMA 4AK3A 3T08A 1D2QA 2BW8A 4OI1A 5F6LB 1JN2P 3S0MA 5CKNA 3VUOA 4BQ1A 5LY2A 5L73A 5J09A 1SCSA 5LEJA 3KM5A 3M3EA 2QQNA 1OMIA 2P34A 3VDDC 5HV0A 1SZBA 1DQ4A 1VBA1 3MIHA 3OSDA 5T54A 1IOAA 3IM0A 4YM3A 4XILA 3OEAA 4X8NA 2XHKA 2JD4A 3JBG3 2WWSA 5A7SA 5A1LA 4OUMA 3V0BB 2V4AA 2Z42A 2HYKA 2RJLA 5CKMA 4CCKA 4D7YA 5CKQA 3VHPA 2WFPA 2XUEA 1G7YA 1NX9A 2UYAA 3QBQA 1CAXB 1ENXA 2JG9A 3AL6A 4MSVA 1WBFA 2WL1A 4Y4RA 5FP7A 2OKXA 3OG2A 4Q8KA 4XCAA 1PVXA 1PK6B 4QKFA 4YM1A 3HN1A 5FMBA 2EALA 4IEUA 1PIV2 1YQ2A 1GP6A 4GALA 5CIRA 4XHXA 3SH3A 4DXTA 4OVEA 4XCBA 3KT7A 5CNAA 2ZBJA 3B02A 4CU6A 1S0EA 3FLPA 4M01A 1PX4A 4WM8A 2JB4A 5IJRA 1SFNA 1XPWA 1BQPA 1DIWA 2D97A 2WA3A 2XVGA 3B69A 1NQDA 3BOWA 3SITA 4CVUA 4XTMA 4YRDA 4OQ9A 4IETA 5AVAA 2HEYF 4D6QA 1MS8A 4RQPC 3PVBB 2J1AA 4RS5C 3WNXA 1LEMA 3ZDSA 5DQ0A 3NNJA 2VMFA 2HEVF 3FJSA 5LWBA 2BGCA 3NW4A 4Q4X3 4Y22B 2VTFA 4IE7A 5CA6A 3BKZA 5GALA 1RUNA 1A34A 4CDQA 5FK7A 5FOBB 3FX3A 3MLJA 1W8HA 3ZFFA 4AAXA 2X05A 4OI2A 5EJ3A 2FZ2A 2FBEA 4YYOA 4QQ2A 3NJVA 3ZYJB 3AKPA 2JDPA 2CNAA 1W6NA 2BYVE 5AFBA 1DZQA 3H9AA 1BHGA 5FY9A 2HWC2 1MVQA 1AYN1 1QKQA 2WR9A 1RUJ3 1N1VA 4ATEA 2VGDA 5A32A 2DURA 4CZSA 2X5IA 5EYYA 3M3OA 4DNYA 3AM2A 1QH7A 2VXJA 2NPIA 4QGLA 1MS9A 2Q1FA 5E1RA 1TZOA 4AR2A 4Y26A 1RUF2 4AEJA 2OUHA 5FO7B 1VAKA 5HCAA 1US2A 3I49A 2ZPXA 4Y5SA 1NYWA 2ZZQA 3HQXA 2C1FA 5M0TA 3H8XA 1S0FA 2AENA 4DXZA 4DEVA 4CCMA 2YHJA 3AP5A 2W1UA 3HT2A 2R6QA 3CJIB 5DG1A 2RR12 4W6YA 3AL5A 4JVAA 1JYCA 2YC0A 2DVBA 4E2SA 1GOGA 4A45A 1AR72 4LA3A 5CEHA 5ANNA 4YZ5A 1HN1A 5A7PA 4AEMA 4BA6A 2QQIA 3SMHA 1OPMA 5FYMA 3E6CC 3ZM8A 1KS4A 4JTNA 1IS5A 1EV12 3Q8CA 1BVP1 4QKDA 3RZGA 4PLOA 3KGLA 2DU0A 5KR7A 1GWLA 5A70A 1MS1A 2Y6HA 5I93A 1LULA 1N47A 3O1SA 2VD7A 3T0DA 2FHRA 4B7EA 1LHVA 3VBHB 3PDQA 2J22A 4MXWA 4IEWA 4MV2A 4QXHA 5IVVA 1SDDB 3VZKA 1LOBA 1VAVA 1VB2A 1FYUA 2PLV2 3B9IA 2JKXA 2BNOA 4OMDA 1OFSA 4XQWA 5I0DA 1ZBE1 2R043 3KS7A 1W03A 4Y1UA 3WNKA 5KXEA 2VOKA 3I2IA 1RUF1 5FJHA 2GNBA 2A75A 4A7KA 1IKPA 4PF5A 2VOVA 3IIIA 2G4IA 1VP6A 1CAUA 4KL1A 4QB6A 3HD8B 1R1A2 2DWRA 5HCBA 1NCRC 2VMIA 1RINA 4E4SA 5HCHA 3K2OA 4A44A 4PF1A 3I3QA 1V9U1 1C28A 1QOSA 3M8LA 4Q5OA 3VBOC 1UOBA 5GLWA 1SACA 1UZVA 1S0JA 2O1QA 3EHKA 4F83A 4YM2A 3IKWA 2WDBA 3OUIA 3LGRA 3NAPB 4JHZA 3NV1A 4CPBD 1ACCA 3U07A 4QX5A 1OVPA 5C6CA 1XU2A 4IE5A 3ZPYA 1O4YA 4RN5A 1U5XA 1XE0A 1SG3A 1RUH1 4LBQA 4R9CA 3PLQA 1GMMA 2HKXA 4QHBA 3LEMA 3N7LA 3MHZA 4P9GA 1QJY3 5IVFA 1DQ0A 1UZ0A 1S0GA 4XETA 5FLIA 2VCBA 2ZGOA 1V6JA 4JRAA 1DZRA 4KG0A 5A1AA 3HVDA 4Q4W2 4HT1T 4RGKA 3JXSA 4LHSA 1NXD1 3N35A 4NHMA 2VBDA 2J1EA 3ACGA 4XDQA 3A22A 4H2AA 2K2SA 4C1XA 2NMOA 4LOSA 4Y24A 4UFIA 1SLAA 4CEYA 4QPGB 3VBRB 2XONA 3BGAA 3LEIA 1H2MA 5J1XA 2R30A 1W2AX 2V73A 1O3QA 2CAUA 2BBVA 1ASJ1 2ZGTA 5FK8A 4N43B 3WDVA 4ES9A 5DN2A 5LA9A 3S5QA 1DYOA 2WT1A 3ZYHA 3TYJA 4AFAA 4XACA 3N9NA 3VGIA 5DG2A 1AR81 4R4ZA 4OUEA 5D8AB 4COWA 2XB6C 4K8FA 5C33A 4XFHA 1QOTA 2NLRA 2WLPA 3VN4A 3N9PA 4BQ4A 3DGTA 4FFFA 3F2ZA 4FSJA 2A71A 1OSGA 5FLHA 2PAKA 4FOYA 3AC0A 3GDBA 2VZPA 3MW4A 1KJRA 4LUMA 3NKTA 2PHTA 3DEMA 3WW3A 1O3TA 4LJHA 1C1LA 1WWYA 1X8EA 1PMJX 3OYWB 4IV1C 4NAOA 4PBPA 2WO2A 4W50A 4CEYB 1R64A 3H0OA 2VNRA 4XBNA 2WQ4A 5HCFA 3AKQA 2XL9A 3MV11 5LRSA 3MIGA 3INAA 2JECA 1HIXA 4QT6A 5GKAC 4P5YA 4M3CA 2Z5WA 1E5HA 3FHAA 4H7LA 4Z2WA 1LESA 3WW4A 5FY8A 4AF9A 1BZWA 5GJ6A 5GZDA 4E2QA 1BMV2 4FCAA 2E33A 2A6VA 4NRQA 3HIFA 1MZFA 3IPVB 4LIVA 1UZZA 4BMBA 1UMZA 2E9QA 4JZRA 2QQUA 4BM8A 4ASKA 2FDKA 4O61A 4ARYA 3OB8A 2EIDA 4Y1VA 3S7EA 3B01A 3PIJA 5B2GB 1OHFA 4WVVA 2VH9A 3G7DA 4ZU4A 3MUZ1 4DUXA 2VBPA 1H2KA 1HRV1 5FFOC 1Q8SA 2PHWA 1OOPA 5LATA 4J25A 5FLJA 1DU3D 4NR1A 4UFKA 4B1LA 2DUPA 4MH0E 4EN9B 2BV4A 2PHLA 4QXKA 5LBEA 1GZ9A 5FRAA 5I8SA 4GIQA 4RHV1 5EV7A 5FWEA 5GZCA 3QOPA 2BU9A 3BU0A 1L7QA 1QGLA 4MVTA 1EPWA 4UW4A 4IV3C 2ZX0A 1PIV3 4RYDA 2ETEA 5F1RA 4BQXA 5JPMB 5F3GA 2UU8A 1XXNA 2PLV3 4XABA 2D6MA 4JCKA 2XJVA 3FL7A 3RYPA 2X10A 3AMMA 5A7OA 5F37A 5JSPA 3IAQA 4RR3B 4UF0B 3KVAA 1VRH3 2K9ZA 2B9VA 3MF6A 1CQ9A 5CG8A 1D4M2 2WNVC 1QJX2 3UV9A 3NWKA 2RM21 3UJQA 3LSEA 1LJ7A 4Q0UA 1GZTA 5HV4A 5IVEA 5JCTA 5C9AA 3PVNA 5FZ7A 4PQQA 1HRV2 1TVGA 2YC2A 3EMRA 5KHIA 3ZMNA 1R1ZA 3JUUA 2VTXJ 1TME3 1W8NA 1U5IA 2WFF2 1W6OB 1WW6A 5EJ1B 3TAYA 4HKOA 4FOWA 1OLME 3GNEA 4ZKTB 2GH2A 1JW6A 2OS2A 2VW0A 3A21A 4IXLA 3J4UH 4CP9A 3O1PA 2ZHMA 4AEKA 1IHMA 3LDKA 1FPN3 2DUQA 4X8PA 5D21A 1VBA3 1COV3 4N7IA 4YZ4A 3W21A 5A7QA 4NIGA 2P3JA 4LKEA 1WKYA 5FUPA 1HRI1 1LECA 1RMU3 2VJXA 2GP3A 2WNUA 4CP1A 3KVBA 5BNNB 1FOD2 1FAYA 1W9YA 4BU2A 1Z7S2 3IN9A 4BJ0A 2OA2A 2JG9C 4WVWA 2YPJA 1HB2A 1OVSA 2H6BA 5DUWA 2NP0A 1Q43A 2P37A 5FZ9A 3RG0A 5A3NA 5JXHA 4FVVA 3EB7A 1XSQA 3ZKUA 1RYYA 4B1MA 1LGBA 4UFHA 1RUG2 1LTEA 1YRZA 1MQTA 2BVBA 3IPVA 4Q4Y3 4EN0A 3BTXA 3WQBA 1XNAA 2EF6A 4I02A 4PI0A 1QJU3 1RC6A 4YNIA 2BRTA 1REFA 1OF4A 1WCSA 4QPGC 3VBRC 1POV0 1L3JA 1W6OA 1XC6A 2R061 2YB7A 2YU1A 4I2OA 2WQ8A 5FXZA 3ZXGA 2QCSB 2WNUC 2Q8OA 4OHYA 2VZ3A 3MDPA 1K45A 1MVEA 5FBZA 1PO13 2EA7A 2ZAAA 4GH4C 1J3RA 1BKZA 2MEV1 1W8FA 3AXEA 5JI9A 3LAGA 3L9JT 2DTWA 1Q5OA 4LHKA 3JZVA 3E5QA 3M3CA 4XDOA 3R4SA 4NAMA 3QH6A 4JDMA 1F4AA 1K5MC 1J1TA 4Q0VA 3SH4A 3B93A 2E53A 5FZOA 4GB33 3PU8A 4AGRA 1H6XA 4IERA 3V64A 1YEWA 1PO23 4RS5A 2QQVA 1ST8A 3CBNA 3MEPA 5CAZA 2GMMA 2RS32 1EV13 3RZHA 4OUSA 2VMCA 3CEWA 4LOTA 1SDWA 4XFFA 3RGBA 3WDWA 3ZYBA 4CCLA 5JLVA 1YYNA 3GXUA 3B5LB 1ZRIA 3VBOB 1OQEA 1GUIA 1DCSA 4Q8LA 5IUQA 1XOYA 4XFAA 4AEDA 2VVEA 3NSTA 1NT0A 1WD4A 1PVC3 2XQRA 4GH4A 1AR93 2LTNA 2EXIA 5FUIA 3A0KA 1IKQA 2ENRA 2YROA 4Q26A 4B4PA 4LBOA 1NE4A 2ADEA 4AHYA 5JR7B 4XHBA 1A3KA 1AJOA 2XVKA 3WQ1A 2VNVA 1OQ1A 1YHFA 4TTGA 4CU7A 4DRVA 3KF5A 1YQCA 5FZHA 5JSRA 4META 1LU1A 2MPFA 2W39A 1J3QA 2D3PA 1YQ5A 4PLNA 3SHRA 2E32A 4FQZA 2IXJA 3LDRA 3PJQA 4JV4A 5B4NA 5D8AC 2BVVA 2YFUA 5JVVA 2GU9A 1XNDA 4OHVA 2D6OX 3NV2A 3OPZA 3AJZA 5EPAA 2Q5TA 2WNVA 1OC1A 2ZX3A 1JTZX 1RB8G 3IMNA 4TYSA 1I6XA 2TUNA 2VG9A 1NQJA 4XJAA 2WZR2 4QU1A 4XQDA 1WCDJ 1R091 4XPVA 2BPA2 2JDZA 3VDCA 4C0HA 1OXCA 3WCRA 3HJRA 4AI1A 5CFDC 3MPPG 2VECA 1K5JA 4HOOA 4O9GA 4EJRA 1EP0A 2D5HA 2X8KA 3URFA 3RZZA 4AEDC 1W6QB 1YJKA 5KBFA 4YW1A 1L7RA 3AZVA 3MGUA 2JE8A 4CXYA 3CMGA 1MS4A 3P3NA 3KV6A 1AYM1 3VV1A 1UXXX 4ZY9A 5JUVA 4PBOA 4LKDA 2BBAA 2HWF2 2RMU3 2VVDA 2ZGLA 4KWUA 4TWTA 3O1VA 3D5OA 2Q8DA 4YW7A 1G6NA 3RWKX 1CN1A 1UNBA 1JHJA 3GF6A 4IV1B 3ZFGA 3CU7A 4LITA 3WHTA 5BNOC 1RUD1 2CDPA 2CU5A 2FD8A 3RZMA 2FDJA 4ZS2A 2GDFA 1LHWA 2XR4A 1VALA 4BXSV 4CP2A 4QKBA 1HX6A 5L7OC 4LK7A 2IFRA 2XJTA 5JDBA 4DZGA 2UY8A 4I01A 5F39A 3BI3A 4NROA 1QH6A 4ES8A 1JZ6A 1B35C 2JDYA 2VR4A 5C5TA 3GJBA 5E16A 3N4MA 4RSUA 4I0BA 3KMHA 3ZSLA 1PO12 1QJY1 2J1UA 1RUJ1 1NE6A 2OQ7A 2WZ8A 1H4HA 3WNNA 5EP9A 4F7ZA 3IDBB 1X82A 2EXJA 2HBUA 3J8F2 4HPKA 2GALA 4M4PA 1BEV1 4AHXA 5G05L 3I7DA 3CZUA 5FMCA 5C9AC 5CFCC 1H1AA 4BQ5A 5FYSA 3O0VA 5LBBA 5FYTA 3AVRA 1STMA 1ND3B 2XXZA 3MIFA 5IHRA 5FQ0B 2WWJA 3WEZA 3S5AA 1ZZ7A 4COZA 4AGVA 3KB5A 3U0ZA 2EAAA 5AFEA 4R4XA 3S57A 2WO7A 3NJYA 3DPRA 4FQ4A 1Y43B 4GMP1 4XUQA 1CAVA 5L9RA 3U78A 2QTWB 1Y9QA 2QQJA 2CGOA 2VW2A 3MICA 2BNMA 3HT1A 1WZXA 1HJFA 3ZN6A 1ZZ6A 1YQ6A 1DQ6A 1AR83 1MQTC 2FMDA 4KGGA 1FMD1 4QQLA 3WHUA 4I3GA 3PU3A 2YDEA 4QDRA 4KG8A 2ZAHA 1WCQA 4CEYC 1QU0A 2Q8EA 3TRSB 3DYPA 3P1IA 3RZJA 4C91A 2PELA 2NYYA 3NAPC 3AX4A 4CXWA 1K5MA 5LZ6A 5F8PA 1RTVA 4JGZB 4NO4A 5JSOA 5FDBA 1LODA 1W0PA 3KZ4C 3LPFA 4UW5A 2Y6FA 5BNPA 1SEFA 2ZX4A 4B3NA 2F4LA 2O8OA 2W68A 1ALYA 4IW3A 1F31A 2JE9A 1OH3A 1UYXA 3WW2A 1DYPA 3C7FA 3BVCA 3TB0A 3DKWA 2AACA 2JXAA 2C4XA 3J7HA 1RIRA 1YFUA 3M2MA 4NWVA 1JOJA 1ZRFA 2WLQA 1RMU1 3FHQA 4TSVA 3OBZA 4NE9A 5HPOA 2ARCA 5T5JA 4E4HA 3IDEA 4EN7B 4ISQA 5CFDB 3ZR6A 3OBRA 2PFWA 3WNLA 1OF3A 4X6QB 3ZN6B 4ZU7A 3GBFA 2D40A 4BCUA 1CR7A 3VKNA 4ITCA 5IAXA 2X29A 3OEBA 1SLBA 1MS5A 3G6JB 3NNFA 2R1DA 5DAQA 1W8UA 4Y1ZA 2JG9B 4FXKB 4RD7A 1K12A 1ENQA 1XNKA 1IS6A 2YUEA 4L8QA 2GMPA 4OHXA 1R1A3 2RM22 1DDLA 5FZOB 4IE6A 2GNDA 4P14A 2VXRA 3VZOA 2CDOA 1GQGA 3LFIA 3DXTA 5EZWA 4UT5A 2VOXA 4YVWA 3HAGA 4XUOA 3ME2A 2ARAA 2CAVA 2QJVA 3AP7A 2B4KA 4JQRA 2XL7A 4RHV3 4UI9L 2P4EA 1TEIA 1HLCA 3IMMA 2JE7A 3R05A 5LCWL 4E2GA 1N1TA 1HV1A 5CU1A 4AHWA 3WNMA 3VL8A 5I8YA 5LW9A 4QXCA 2YBSA 3TNPB 3ZYIB 2YY1A 1RUC3 1FOD3 2W52A 5JOYA 1XSRA 2I07B 2Z4FA 1O8PA 3ASIA 3K48A 1QXJA 3I2GA 3K3NA 1VBA2 4ORFA 1LOFA 4QPWA 3OGGA 4AI9A 5AC91 3PUAA 1VLNA 1JZ2A 4QHZA 3FN9A 5DAWA 1UX6A 2Z69A 4K7JA 2P3IA 5J98B 3M7AA 3VKFC 3HWJA 1YNAA 2QNKA 1AR61 4FAHA 4OQ8A 1WMFA 2VCMA 3CZJA 4ZXEA 4Z8BA 3ZFGB 3POYA 1ND2A 4RQPB 4JQTA 4DPNA 3HNYM 5SV8A 1QHDA 1F9KA 3RMYA 1DGWX 2BFUL 4FPHA 5FY0A 2RJ2A 4BLIA 4NPMA 3TEZA 3ZXLA 2MHFA 4GXLA 4Q4W3 3X29B 3LDBA 1F2NA 2CWMA 1HB4A 3HNBM 3ZOIA 5LA2A 1VMJA 2ZEZA 1C4RA 4CE8A 2HEWF 3GZTB 3HN3A 3VBSC 5F32A 3MLKA 2D3RA 3VD3A 1DGLA 2ZKLA 1OKQA 3O0XA 5DPNA 3ILRA 3ZFEB 1CGPA 1ND2B 1WCUA 4RQPA 2ZA9A 1V9U3 3IT8A 1ZVFA 4XMAA 3UGFA 1CJPA 2I45A 4MLOA 4QAWA 3RDIA 1LHOA 2GC0A 4LIUA 1IS4A 2DYCA 3LA7A 4L11A 1V00A 4XURA 1W8OA 5H9RA 3VZLA 4DRRA 2HWE1 1PGL2 1YI9A 5C4WA 4PIYA 4LO7A 2VO5A 4YW2A 4JGYB 3WNPA 4TN7A 3P3PA 1EAH1 1RUH3 1VBD1 2W08A 4KBZA 3SCGA 4LE3A 2D6KA 4B29A 5ACA1 1WMXA 3J7LA 4LMFA 1XNTA 3JBG2 3VD9A 1W3XA 1A8MA 4K40A 3DV8A 2OUJA 1HB3A 5C70A 4UW3A 3JU9A 1W0OA 3TN92 1PGW1 4TLGA 4YZ3A 1W8TA 3PUHA 2A3YA 4K20A 2ES3A 2DVFA 2FCTA 4IEYA 5DMYA 3WUCA 3D0JA 1O3RA 5IFTA 3GM8A 1JYXA 3OJBA 5FZMA 3BU7A 2VNOA 3LEGA 3ZXFA 1BVVA 1ZZ9A 5C4WC 1E5RA 2WYFA 3IB3A 3EQEA 2VZOA 3DPRC 1VBB3 4QPYA 4RFT0 2DCZA 5FYUA 2ZGUA 4W8JA 3NJXA 4XF4A 1VRBA 2E26A 2BUKA 1VPHA 3WW1A 1JXNA 1Y9GA 4GJYA 3D6EA 1BBT1 1W6NB 4Q4X1 1NCQA 2ZGNA 2Y33A 1J58A 1U12A 2EIEA 1AR92 4J6GA 2H6CA 2OXBA 4Q4V3 4Z92B 3WY6A 4AHZA 2AEYA 5T55A 3BPSA 4IEVA 4OHZA 3LEKA 4WZCA 1CZSA 1QJU2 2P1BA 3WF0A 3MPBA 3H3ZA 3WDYA 3RMXA 3USSA 1GU3A 4PIXA 3R4UA 4KWLA 4FPFA 4Q0PA 1GWKA 5C3QA 2AC1A 3FWEA 4XFBA 1FT9A 3H1WA 4PCRA 3AKTA 2QDRA 4HONA 5FJKA 5L9BA 3HOBA 4WM8C 3VZNA 1LEDA 2ILMA 2VU9A 3AFKA 5DUUA 5FZ6A 1S1AA 3WINE 3ZYRA 4C8DA 3HNMA 1RHI1 4LKFA 1PMIA 3GZEA 2YZ4A 4L99A 1VMFA 4XJWA 1O59A 4E8DA 3AXDA 5EFUA 2RS12 1D4VB 1RUE1 1W05A 4FPJA 1BLZA 5FP4A 2ZX1A 4K8RB 1FX5A 3E97A 4E8CA 1MQTB 4GMP3 2JEMA 3RFRA 1F15A 2GC3A 2WC2A 2ZEXA 4NJ4A 1I3HA 5JMOA 4MGYE 3K4ZA 1H4GA 4JHTA 3J8F3 5GZGA 2ZEYA 1MZ5A 5DDJ3 1DQ1A 2GZWA 3JB8A 1REEA 3BUCA 3FUQA 4V1PA 1ZRDA 5C5UA 4Q4X2 3JQWA 1UOJA 1ZZCA 3O14A 5D8AA 5LRRA 3WDTA 4HG6B 5C8CA 2XJPA 5GM0A 3Q9OA 3Q8AA 1APNA 1UMIA 1DLCA 1GKBA 1WA6X 2VTXA 4HK8A 4MGSA 5FUNA 1W39A 1JU4A 4YG3A 4O65A 4YVWC 4AVBA 5LK5A 3O1UA 3PMSA 4QX8A 4L9BA 5K0UB 4Y20A 1AR71 1S0CA 5FO9B 5EHDA 2VC9A 1W6PA 4HSJA 1S0BA 1A78A 1UXZA 4FOVA 1QDCA 3I2DA 2XGXA 4GQ7A 4IGQA 3WG2A 4P08A 1RL3A 2ZGKA 1O5LA 1BJQA 2RVAA 2WS91 4LE4A 1XYNA 2ZX2A 4AI8A 1UMHA 1NG0A 1PIV1 4D6RA 1VBC3 2P3YA 4YVSB 5A33B 4XBQA 1PO22 3N9LA 3NJZA 1QOOA 4XF9A 1AYM2 1GQHA 2B8MA 3AFGA 1TMF2 2A6ZA 4LKSA 4XE9A 2PHRA 3WUDA 1W9FA 4BQ2A 4BIFA 1FPN1 4PHZA 4GJZA 4AE2A 4BE3A 1GICA 2WAAA 2R1BA 2JDAA 3AZYA 4A41A 1N3QA 1W6PB 4OFGA 5I0RA 5T5OA 1NLQA 3A0NA 5A3MA 3LIGA 1CZVA 1GNHA 4EE2A 4I09A 1FNZA 5JOXA 4FAGA 3HBZA 3WZ1A 5DAPA 2J7MA 4HK9A 1LRHA 4GULA 3PJYA 5A3TA 1LOAA 1XNCA 3F95A 4JKKA 4P9LA 4WM7C 2FCVA 4XMIA 3U37A 1R1A1 4HVQA 4IEPA 1W3VA 1PVC1 2GN3A 3GZAA 3K51A 3POIA 3TNQA 2G9ZA 2B5HA 5BNOA 3BIWE 4E4DX 3KD4A 3OGSA 1PZ8A 4GB32 4Q4Y1 3C7OA 3K3OA 2HLEA 3PURA 2DDUA 1C8M3 3CJXA 4HMZA 1QJU1 4KU7A 4E27A 4LXLA 4W65A 4XAAA 3BTYA 1RUOA 4XIKA 3OY8A 1UU4A 2ZHNA 1NZIA 2VUAA 3HEIA 1L7LA 3PUIA 4FPCA 2JIJA 3M1HA 2XH6A 5KXCA 1D2SA 4FFIA 5FPUA 1OA3A 2AEZA 3ALQA 1QDOA 3GZUC 5BV6A 2BOJA 3NKGA 3T09A 2JIGA 4BWOA 3ETQA 1E57A 3AMPA 3ZYPA 3T30A 1RUE2 3FMGA 4GA9A 5IVCA 3I2OA 2Y6LA 4YGEA 4ARXA 3DECA 4EN6B 5A3LA 1YC61 2H0VA 3WLUA 3RYRA 4JRLA 1PZ9A 4NPLA 1JOPA 4Y3OA 4Q4V2 3KT1A 1NUKA 3PMEA 5ABJB 2HWC1 3D8CA 3ZKYA 4CDWC 1FV2A 2QQLA 2IXKA 2IVJA 2VOTA 1T6GC 1W9WA 2ZGQA 1W04A 2OX0A 5H9PA 1JYIA 2J1RA 1OH4A 1KQRA 5FY1A 2A5ZA 2QBXA 3DL3A 1YQ8A 2LW8A 2IXHA 2TBVA 2W1SA 1CESA 5A80A 1TNFA 2RMU1 2WT0A 4QHOA 3QCWA 1SFPA 1UY1A 4FTBA 5JIUA 2HWE2 5IK4A 4P9YA 4UXAA 1ZBA1 2X5IB 3AK0A 4GKYA 4HL0A 3Q8BA 5FIXA 1UWWA 4IEZA 4NHXA 1I1EA 3VBHC 4MOAA 3HBKA 3DXUA 3VDBA 4DS0A 2A7AA 5FR3A 3KCYA 2RE9A 1HN0A 4XJ9A 5CFDA 3GCXA 2CTVA 5C71A 1HRI3 4I0WB 4UFJA 5K4LA 3EXUA 4PQ9A 5FZFA 5F5AA 2QE3A 4YLZA 4BQYA 1DG6A 1Y3TA 5KHHA 1RUG1 1TG7A 3J7MA 3THCA 5A6YA 1GZCA 2RS13 2EVXA 5ABJA 5IK7A 2JDMA 3SCHA 2RDSA 3PHMA 2B39A 2ZEWA 4LO6B 4QPGA 5LB6A 1QJX1 3VBRA 4LR4A 4AQSA 4CDWB 1V9U2 3CJIC 5DZGA 1FXZA 1W28A 3ZXDA 1ZX5A 3ACHA 3ACLA 3TN91 2C5DA 3BCWA 4YGCA 2OZJA 4TLFA 4CXXA 1Z78A 2A1XA 1WCKA 4RA0A 5E8AA 3WSOA 3UGGA 4ZHNA 1J83A 1OI6A 2IUWA 1ULCA 1ZA7A 1XRUA 2D6NA 2FDIA 1SBFA 2GAUA 4KNCA 1BCXA 4I0AA 5FZ8A 4R8HA 5C7GA 2PXJA 3MFAA 1UAIA 2BQPA 3L2HA 3KCXA 4MX3A 4NIHA 3SEPA 3SQOA 3CO2A 4NVPA 3TWIA 4G9SB 1RVF3 2R7EB 3J7NA 1FMD3 3QACA 3ACFA 2Q4SA 4UOJA 5ISLA 1RITA 5FREA 5IAVA 3AB0A 1LHUA 4M0NA 2IWGB 1ZREA 2SLIA 1ZBE2 3O1MA 5LBCA 1VR3A 4RGAA 1G86A 2ZKNA 4MO3M 4YW3A 5FQ0A 1ND3A 2VZVA 2ZGSA 2RR11 4FFHA 2X09A 3CKHA 2QZ2A 1NCQC 4HPKB 2F4PA 2P5BA 1UY3A 3OBTA 5FZ1A 1GFF2 5IVYA 5K9YA 3LA3A 1S0IA 2VZRA 4S2GA 2E51A 1OURA 3NL1A 4CRQA 1JZ3A 2WAOA 1RUE3 4LUKA 4GAZA 3QD6A 4AVAA 1LKNA 1BYHA 4HXCA 1QXRA 4X6RB 1CD3G 4INDA 4XJUA 1AXZA 4BQWA 4RR3C 1CVNA 4BXFA 4AI2A 1WLTA 5DDJ1 4AQTA 2ZGMA 2RS31 3T3YA 2QFEA 2I74A 2WZR1 1JODA 4JX0A 2VW1A 3OBAA 1EAH3 5FKBA 3D0SA 4MHUA 1KGYA 5HI0A 1Y7BA 4YWAA 1G8WA 1O6UA 2VQ0A 2DCKA 5C8CB 4NHKA 5KXBA 3VZJA 3RPQA 2QZ3A 2VBBA 3U10A 4RGGA 4XVHA 4CUCA 3AYCA 2BGPA 2V72A 3UK9A 2BERA 3VBUB 2ET7A 3VBSB 2SBAA 3W20A 3U4SA 5GLZA 2VM9A 1W6QA 2WYSA 1ULFA 2BFUS 1HV0A 3IDAA 5A3UA 3UJOA 5FP8A 4URTA 4NPRA 4YGBA 1WGPA 3I2FA 3T0BA 4YG6A 4AYUA 1SBDA 1GOFA 1SCRA 1UY2A 1KJLA 3FBMA 3POEA 5AC93 1SFYA 3PIGA 2W91A 1ONAA 1BBT3 2NMNA 5A1FA 1Q56A 2JDUA 2Y38A 2KA3A 3R0RA 4JGZA 5APAA 2PHUA 3KF3A 5JOWA 2HYXA 1ZYBA 4GB31 4M4RA 4CDWA 2EXKA 1HJGA 4CCCA 1W2UA 2XDVA 2VCCA 4QM8A 3THTA 1WMEA 2IVIB 5KHKA 3U1XA 3VD7A 4CDXC 2GSYA 1TMF1 3UKTA 4LTAA 4S2DA 3BTAA 3S30A 2CGNA 2VCAA 1QNYA 1QQP3 1KS5A 4QX7A 1V0AA 1POQA 3AP6A 3Q8EA 5E88A 4ASLA 1AX1A 1RMU2 3T4VA 3POJA 2V09A 4WVZA 3GBWA 2CYFA 3LCPA 2XLGA 4D69A 4NHLA 2V5YA 1KFXL 1NA1C 5JPNB 3H8OA 5DAXA 2RV9A 3DPRB 4FXGB 3VBUA 4XF3A 5FTTC 3ZX7A 1CAWA 2V5DA 3H3LA 4CDUB 1PK6A 4R52A 2YXSA 3RJ2X 1YFYA 4YZ1A 1KEXA 3J8F1 2VMGA 5D2AA 4BIOA 4CDXA 3AMNA 2J1VA 2HWB3 3AP9A 4CP9B 4BOWA 2ZTNA 2HWE3 4Q1PA 4RFRB 4JAAA 4LHNA 2AZ5A 4CDQC 2DBNA 4ZXKA 4Z2AA 4H14A 4NRMA 1C5IA 3ACIA 4XFIA 3U75A 3UESA 3ZXAC 2Y6KA 2IZWA 4AOCA 2BWCA 3KCCA 4QX3A 5JR2A 2JG8C 1S0DA 3ES1A 3WQ0A 4Y4YA 3UKNA 4EYUA 5CADA 2CV6A 1YUDA 5E89A 3MYXA 4QQPA 3ZFEC 2PMWB 1RJ8A 4O7XA 3WF2A 1JYNA 1VBC2 3UETA 3TEXA 5LY1A 2Q1MA 4Z82A 4P02B 3V56A 3MV01 4CUGA 4EZHA 2X5IC 2TEPA 4AI0A 1DHKB 5ERLA 2JG8A 4QKNA 4XTPA 4P9IA 1E5IA 1VBC1 4HKLA 1ZM1A 2Y6GA 5FYVA 4BDVB 1ZBA3 3H8UA 3LZZA 4Y1XA 1OD5A 2GN7A 2PHFA 2YG0A 3OY8B 2B45X 5FPVA 3MIDA 2OVUA 2D7FA 3AMHA 3WG4A 4BMEA 2A73B 3A4UA 2E31A 3EBRA 2RS53 1OA4A 4QMAA 1R082 1OUXA 2CWSA 2BNNA 1X50A 1XE8A 3SNMA 1PGL1 4I30A 1ZZBA 1PM7A 2OZ6A 1GR3A 1RUD3 3BOPA 1RGSA 4WVMA 4WVMB 4XYXA 4CYDA 5F3EA 5CYYA 4LLOA 1GNZA 2Y6JA 1ZRCA 4A6SA 1CONA 1HW5A 2DVGA 4D0QA 1EV11 2XBO2 3POFA 5F2SA 3C2UA 4C1WA 2XOMA 1YIPA 3N7MA 5J7MA 3D82A 3SC7X 4PT6A 3N9MA 3TN93 4A42A 4HLTA 3I59A 4EZ4A 4E4ZA 3PUSA 2RG4A 2O8QA 2Y26A 2VQAA 2ZMNA 1VRH2 4N9HA 3FBYA 5FPBA 4MGKE 4LA2A 1F35A 4FP3A 5F5IA 3E5XA 2WRAA 4IEOA 4B7KA 2OYZA 2YMZA 1GNYA 2JICA 2J42A 2YV8A 3M3QA 1R081 1YFWA 4UFMA 1F8VA 4LBNA 3B00A 1I5PA 1W0NA 1X9PA 1LCLA 1Y9MA 4J1WA 4Q2FA 2ZMKA 4W6WA 4XAEA 4BISA 3UL2A 3AZZA 1XJAA 1VBD2 5CZKA 5ACA2 1AL21 2PHDA 1CPMA 3TBDA 1ULOA 4AFCA 2NN8A 5KXDA 3OCPA 3UYJA 1F5FA 4N53B 3DYOA 1AL0G 3E5UA 5CFCA 1IG0A 1S55A 3EYPA 5A7WB 5L7OB 1UY4A 1W2OA 1DQ5A 2HWC3 1SPPA 1IS3A 1EUUA 1TME2 1YJLA 2BTVC 2EIBA 3NNMA 1WW7A 3FE5A 4COUA 4AVTA 2RMU2 3VBOA 1JZ7A 2GC1A 4PLMA 3VLBB 4V2VA 5FXXA 3VDDA 2HBTA 4CUBA 1H8TC 4H7MA 4NOTA 3ZSEA 4R9AA 1PMHX 4UBGA 1D0HA 1VBE2 3CF6E 4IE0A 2WS93 1ZNPA 3M3IA 4QX0A 1RHI2 4U36A 2DUOA 5A32B 5L7OA 3VBFB 5FPZA 1IGOA 5IFPA 3H7JA 1XYOA 2D93A 3JB4C 1OA2A 4QGNA 4M00A 1VBE1 4KU8A 4KMQA 4COVA 4XXPA 4QQHA 4UFLA 3WT3A 4MZUA 5FMOL 1ENSA 1DGRA 2A6XA 5FZ3A 2YU2A 3W58A 3N3HA 5A6XA 1KDMA 4QDQA 1J3PA 5IVJA 3VZMA 1V6OA 1NCRA 1NCRB 5FMDA 3PL0A 1MS0A 4ISRA 4UAPA 1RUG3 3I3DA 4M3CB 4A3XA 2UWBA 4BZ4A 1UZWA 1POV1 4MHRA 1LOGA 2E7AA 1MS3A 2Y8KA 2WO3A 2ET1A 2RDNA 5EWSA 2QDNA 2YGMA 3MO4A 4QB2A 3N36A 1UYZA 5FZAA 5LASA 1H2LA 4UBHA 1AL22 2VMDA 2PYTA 1HDKA 3NAPA 2QUOA 4LPLA 4LULA 2W5FA 3EO6A 4XJ8A 1RXGA 4GH4B 1OUSA 1UOFA 4FPOB 3JQXA 5BNNA 4NIAA 5IK5A 2WNUB 1GP4A 4V2WA 3KWVA 1GV9A 5EXOA 5C8WA 4OZOA 4DEQA 1HXS1 3FHIB 2GMEA 3ES4A 5FZKA 1R092 3RNSA 2DCTA 3ABZA 4LORA 3TEYA 2RJKA 2R16A 2VZUA 4BH9A 5FKCA 2CHHA 5IW0A 1HQLA 3GYDA 5BY5A 2VQUA 4XW3A 4K21A 4DXRA 2WT2A 1W6MB 3VB9A 4N90A 5JXIA 2R32A 5FZIA 1PK6C 1RUI1 2IXCA 1N1YA 3BYWA 1DF0A 4ATFA 2DV9A 2PN5A 2WQZC 2WZEA 2PTMA 3K75B 3WXPA 2RR13 1GLHA 3WNOA 1GZWB 1GZWA 1SLTA 5F2WA 1AR73 2YPDA 1G9FA 4M3CE 1G9AA 3PNAA 1AJKA 3U11A 1H9WA 2ERFA 4KWJA 3H7YA 2RDQA 4RR3A 4UF0A 3ZPOA 3H1YA 2WSUA 1NLRA 2JWPA 1KFUL 3CHXA 5FPXA 2JJ6A 3O5SA 1X36A 1Q8QA 1COV2 3O12A 5LK7B 4Q4W1 2ZGPA 4HVRA 3ZFEA 4R9BA 4DQAA 3ZN5A 3PVOA 1DFQA 4FPGA 1N1SA 1PGSA 1RJ7A 4P00B 3POBA 3OF1A 2AYHA 5JAXA 1W8WA 4PDWB 4YSFA 4F3JA 1CWPA 2GNMA 3JD71 1CAWB 4XFCA 5FYCA 3MFCA 4IGPA 2WZR3 3MLLA 1JOBA 3I2HA 4FI9A 2JDHA 4GWIA 1WLWA 2VY0A 1O4ZA 2HWF3 2YFZA 4FPYA 2LM3A 4BB3A 4SLIA 1BXHA 2PHXA 1DGRN 4R9DA 2UYBA 1WBLA 2XHNA 3C7GA 1QJX3 4GWMA 2W9XA 4N9IA 3VKLA 5CG9A 3KQRA 1UIKA 4CU9A 5HBAA 1LHNA 5FMOS 4K6BA 4PIZA 4OZXA 1OLQA 1EYBA 2BGOA 4K1YA 4D94A 1VB4A 1C8M1 4BK4A 3R6SA 2XUMA 2B42B 2E7TA 2VUJA 3T2TA 3WP3A 2D5FA 4YVSC 4L0PA 4YARA 4XDPA 2H0BA 3AMQA 5JIAA 3A23A 4HKWA 5DUXA 2WKKA 5F5QA 4CTEA 1XBFA 5C3OA 5L9VA 1HQNA 4AGGA 2DVDA 5EJZB 3ZXEA 4DINB 1QJZA 3ST7A 1QJY2 4I3PA 2FDGA 1JMUB 3FUOA 5H9QA 4P9JA 2XPJA 2ZHLA 1G9DA 2R0FA 2OPKA 4OLLA 5FXWA 4AAPA 3OYWA 1X9TA 3GALA 1DP0A 2WWUA 1SQ4A 3TOJA 3O1OA 2DF7A 1ULDA 2MNGA 1NKGA 3AJYA 1C3HA 1MPXA 4QD2A 4A7YA 5FP9A 1LB2A 1FOD1 2C0ZA 3AVSA 3CJIA 3USUA 1E5SA 1A6CA 4KI5M 2IC1A 3I3BA 4D3WA 1C8M2 5FPLA 3WP5A 4CDXB 4XZUG 3RRDA 3VDDB 4MGZE 2BWAA 1WMDA 2FCUA 1KDKA 4C0BA 1XE7A 2J1SA 4Q4V1 4M3CF 2JDKA 3FC0A 4S2HA 3ATGA 4DY5A 3POGA 4OCTA 1AYN3 1CAXA 1D0GA 3OTFA 2DCYA 3EJKA 1J1LA 4LO4B 1RVF2 4XZPA 3U14A 3WF1A 3BIEA 2KXLA 1B09A 1US3A 2UWCA 4AQ2A 2XLFA 1U5YA 2R042 1UKRA 2AREA 3GHNA 4IE4A 3VHNA 5F9TA 3V0BA 4GZ9A 2ORXA 1ND3C 2XBO1 3MW3A 1OBNA 1UU5A 1SMVA 4CCOA 4E9KA 2F6BA 2Z2SB 2EICA 2RHPA 1AL23 3KGZA 3GGLA 2HWB1 4J1XA 5F3IA 4ONUA 3BN6A 3I4IA 5FZDA 2QQMA 2W0XA 2VPVA 1TNRA 3H42B 3KV5A 4JGYA 5E6HA 2PAMA 4Y5TA 4DO0A 3K4DA 5CBLA 2YBPA 3HPNA 5DABA 4FO9A 1XNBA 4Y22A 2VZTA 1ZRRA 3GCWA 3CIHA 5BNNC 5KC6A 3N7JA 2YGLA 3JD72 5F5CA 3T2OA 4CCEA 4NUBA 1FNYA 1RVF1 4MGIE 3WR0A 1WA4A 4IUGA 2VZQA 4RHV2 2E63A 3MBWA 3S6PA 1OQDA 1UYYA 3K4AA 3MIBA 2W87A 1H0BA 3Q8FA 4JDNA 5A6ZA 3GJAA 1VBD3 3ON7A 5ACA3 5FPAA 3NV4A 2VL4A 3KQ4B 3S7IA 5JZGB 2FDFA 3THPA 4XQ4A 3RVHA 5AVPA 1NXMA 5IWFA 1CAVB 2WFF1 3D3AA 4FTSA 1JU3A 1NLSA 2R041 5G04L 4DMIA 2IFWA 1IQDC 1AX2A 1JZ4A 1W9SA 1OD3A 1V6IA 4PDWA 5FYHA 1MEC3 4QM9A 4FT8A 3I3MA 3QLQA 4FPEA 4ET7A 4FTEA 2HWD3 1IPSA 4PDWC 5DDJ2 5FYZA 3KV9A 4LNVA 4MYEA 4MADA 3KHCA 2KD7A 5FZBA 3WF3A 2ZXQA 2A3WA 2OT7A 1VAMA 3N9QA 4QX2A 5A7WA 4AVCA 2AUYA 4KQ7A 5LA0A 1S2KA 1XYPA 2ZMLA 1AX0A 2Y0IA 4IL7A 1C1FA 4MXWB 5T50A 3VL9A 4NMIA 1XQNA 4WV8A 3D4KA 4XUNA 3VBHA 2BOIA 4QPIC 3ZXJA 1WLDA 2DFBA 3BALA 4D6SA 3T2PA 1IPJA 1YO8A 1K3IA 2V4VA 2G9GA 3MF9A 4AG4A 2FMYA 3AKSA 1T6BX 1OT5A 4TXWA 1X33A 5DZEA 4KWKA 2X53S 4LBKA 3LOBA 2BDRA 2G19A 1GANA 4YVSA 2W95A 5A33A 4U2AA 3AZWA 2P6HA 3JCIA 5K8SA 2FQPA 5FZ4A 2R49A 4XUPA 1W6MA 1LU2A 1H30A 1HRV3 2HJIA 3WG1A 1NY71 3IIAA 1PGW2 2HH9A 4IV1A 5K0UC 1O3SA 2FZ1A 2QQKA 3I59B 1QF3A 4YVWB 4EQVA 3E6DA 4Z1VA 3FZ3A 4EROA 1UIJA 2WN2A 3DKQA 4FOQA 5ABJC 4CA9A 5LEKA 3AYAA 1RHI3 2ZGRA 2RS33 4BLJA 3NNGA 3VHOA 3DYMA 2C9KA 2ARBA 3O7OA 1OOPB 2QKDA 2ZABA 3GHMA 4HBNA 4MGQA 2QQPA 2E7QA 5I0UA 1JZ8A 1UZYA 2B9UA 3AP4A 4CU8A 2R071 4IGOA 2ZZJA 5FYIA 3NO8A 3AYEA 5C8CC 2EXHA 1LOFC 4Y33A 5GZEA 4EN8B 1S4CA 1HRI2 3WV6A 5DXDA 1WW5A 4MG2A 1W2NA 2OQ6A 4WBBA 4BHPA 1EAH2 1Q8PA 3AZXA 3RSJA 1JBCA 4A2UA 4AFDA 1W99A 4D7SA 5JMCA 2R072 1TME1 3VKOA 5JXJA 1NOVA 4IDZA 5H9SA 5BXXA 3ZLIA 2I2SA 1ZBA2 2ZOEB 4YW5A 1ASJ2 3OOXA 1G9CA 2LRPA 4YW4A 3WDUA 4A4AA 2B7YA 3VBFC 4CCNA 1JHNA 3GBGA 1RUH2 1UY0A 1RUF3 5EYXA 1REDA 5JOZA 1F5JA 1VIWB 2JKBA 1HQWA 1KITA 3E6BA 5LBFA 3K46A 5FP3A 2VNGA 5L19A 3JD73 1NZCA 3RWNA 1SHWB 4JC1A 4NRPA 1VBB2 4N7UA 1HXS2 3ZSJA 2ZACA 1M06G 3LD8A 5JZGC 2XLAA 2MEV2 2EAKA 2QQWA 4N43C 1J59A 1POV3 2WNOA 5T5LA 3CQOA 3VBSA 3VHRA 4DIQA 5EIYB 3B3QE 5T52A 3JBG1 3NV3A 1H6YA 1ULEA 4AZZA 1FPN2 2WBKA 3ILNA 4CSWA 3LSDA 1QNWA 2C9AA 2JX9A 3ECQA 2ZS6B 3KV4A 4XEZA 4L92A 3MIEA 4RL7A 2E6VA 3OD0A 3ZXKA 4BYYA 2RS11 2WIIB 4RS5B 3RJRA 1JUHA 1QXPA 2RS52 3USUB 3OPWA 2WS92 5K7PA 5FZGA 1PM4A 2GH8A 3M4FA 3HQRA 4Q0QA 1NA1B 2Q30A 4N53A 2LUWA 4Q0SA 4XF0A 1V6NA 4GMP0 4EWEA 2A6WA 4AW7A 4N53C 4FP2A 2ADDA 1UN1A 4GWJA 2CGPA 1EY2A 2DTYA 1P8JA 2DVAA 4WM7A 3ZSKA 5IT6A 1JYVA 1YLLA 3LIHA 2JDNA 1UL9A 4Q4Y2 4Q1RA 3V65A 3WP4A 1CIYA 2GNTA 3P6BA 1AZDA 5CB7A 2GP5A 1JI6A 2NQYA 4EWAA 3LA2A 1CPNA 1RUD2 4OULA 2Y34A 4Y5Z0 3WCSA 4P5HA 1FI2A 1OPOA 4ZZ5A 5DAVA 1KD7A 1BMV1 3NQHA 2ZJCA 5IK8A 1UKGA 1UOGA 4LBQB 2ZCWA 2RS51 3C7HA 3ZYGA 3H50A 2WO1A 5J96B 1O91A 1Y4WA 3O0WA 2VZ1A 2AR6A 1DBNA 4Z07A 1GSLA 2YC4A 4H3WA 1YWKA 1J84A 5J3UA 2WNEA 5C3PA 1EUTA 1WLCA 1AR82 4WM8B 4B4RA 1KRIA 2D6LX 3PVEA 1TMF3 1H2NA 1AR91 3FLTA 3UT0A 4LEJA 1ZA4A 5T5PA 2PQQA 1UCXA 4IV3B 1OLMA 4XF1A 5J36A 1D4M1 4IV3A 1VBE3 2EIGA 3ZO0B 2O14A 1PZ7A 4CCDA 1C8NA 1CIWA 3LB9A 1Z7S1 3VKMA 1CJDA 3ZR5A 3FLRA 1VMHA 1JYWA 1DQ2A 4PI2A 5FY5A 5JZGA 1S2BA 1AXYA 1UU6A 3O1TA 1AHSA 2D43A 1Q8VA 1PNGA 2OIIA 2C26A 2D44A 2VUCA 1V6KA 2W47A 3H3UA 2ARXA 3OPTA 2JG8B 3OUHA 1GBGA 4XJZA 4XOGA 4AVVA 1YIFA 1I9RA 1JUIA 1OKOA 2W94A 3WQ7A 3OGVA 2O0OA 3WDXA 1H8TA 1RUI2 3VD5A 4YG0A 2P3KA 3CNAA 3I3EA 5KHGA 4QGMA 1UF2C 3ZVXA 2Y64A 1M4WA 4LLFA 3RQ0A 1WUVA 2GC2A 3SH5A 4IESA 1MR5A 3KT4A 2JB8A 1X8MA 2VULA 2NZ9A 4CDUC 3DCQA 4DOUA 1JZ5A 1IPKA 2ATFA 5FYBA 1PVC2 1RXFA 3HQUA 1C5HA 3IBMA 1O8SA 3SISA 3B7MA 3WP6A 3AKRA 1K42A 4W6XA 4YGDA 2D6PA 5SV5A 2DBIA 4COYA 4NN0A 3L2YA 2AGSA 3R4DB 5J37A 1G9BA 1HXS3 1XU1A 1AYM3 2VE1A 4Y20B 5K0UA 4EWDA 1N3OA 1NA1A 1PO11 2C6SA 3ELNA 5LA1A 4DXSA 2MEV3 3IDCB 3V0AA 1SLLA 4CDUA 2HWD1 1Z0HA 4YZ2A 4NIDA 3HR9A 3W9AA 4P9WA 3WF4A 4QX1A 3B94A 5FZ0A 1GQPA 4AEDB 1AXKA 4HETA 4OMCA 3QH7A 2ORZA 3C7EA 5F3CA 2D98A 2R062 5D1IA 4FPLA 2RDRA 2UWAA 1TQ5A 3B9CA 2BP6A 5GLUA 4HANA 2ZHKA 1PNFA 3KSCA 2HWB2 3ZDVA 3MUY1 4M0HA 2PAEA 4ZPIA 2RM23 1ZZ8A 3C3VA 5T3NA 1H8VA 2W1WA 1LENA 2JENA 3FFZA 4GD4A 2PA7A 4YFWA 3W5MA 1UX7A 1XB9A 4UW6A 1QEXA 2XJUA 4KBBA 1SBEA 4D7TA 4AI3A 4LO8A 2F17A 2NM1A 1MZ6A 3ZSMA 1V70A 4JDOA 4JKLA 2C24A 3POWA 3W5NA 2YBKA 3NVCA 1NY72 3NMBA 5TSWA 2WABA 2XMLA 1QQP1 2XBO3 1RUC2 5BNPB 3TEWA 1LGNA 5BYNA 5I0SA 2VOWA 1PHMA 3WD5A 3RZKA 3I54A 1ND2C 3I2KA 3W59A 1UD1A 1UPSA 1URXA 3CLPA 3ORJA 3ZIXA 1QQP2 4AVSA 4XFGA 2L9LA 5J48A 2A6YA 4NHYA 4P9XA 1W9TA 1U5ZA 1I5ZA 2DFCA 2VZSA 1YFXA 3MW2A 3VBFA 2CY6A 5FCCA 2LS6A 1AR62 1GP5A 4EV0A 4HVOA 2Y0OA 5A7NA 5L36A 1JYTA 2BEOA 2R0HA 2J1TA 5AC92 4IEXA 1NAEA 1H1MA 1H9PA 2Y60A 1N3PA 1C57A 3VBUC 1OFNA 3UKVA 3N7KA 4LBLA 3ROUA 3SEEA 1LOCA 1U0AA 4AFBA 5KC5A 5FXVA 2CSGA 1W8ZA 4YFZA 3VD4A 1LGCA 2W1QA 1SPPB 3I2JA 4IEQA 5FAXA 1VRH1 2WN3A 4LT5A 1EPZA 1RUI3 1W06A 2K0GA 3IAPA 4N43A 3WG3A 2WFF3 3LWCA 4YW6A 2G9FA 4DUWA 5CFCB 5A3OA 5IATA 2K46A 3MI8A 3WOGA 1V6MA 4S2FA 5F7UA 4OHWA 2IXLA 5ANQA 1D7PM 4G3YC 4H55A 5FY4A 3ZIWA 4B4QA 1OLRA 4XBLA 5I91A 1GYKA 4ZONA 3M70A 1BK1A 1ODMA 4QPIA 3WX5A 2Q0AA 4O9EA 1BK0A 3C8XA 2VMHA 4URAA 5JXGA 3P5BA 5GLTA 1ZBE3 5BNPC 1O5UA 3LKJA 3AYDA 4QDSA 2IXIA 4Q29A 3IZOA 3T2QA 4QPIB 4FBFA 2AH2A 5C9AB 2P6CA 3NRUA 1H1IA 1JS9A 2A70A 1H8TB 2BJSA 4G4FA 4K1ZA 4KH9A 3U4XA 3K77A 2WA4A 3E1F1 3BB6A 3H1MA 4IQPA 5IVBA 1SLCA 2TNFA 1GOHA 1AYN2 2XWBB 3SKJE 4FFGA 4Y1YA 5CVRA 2PQSA 5DZFA 4L2NA 1SLIA 3OGRA 3ETPA 2FDHA 2LROA 4CPBA 4NIIA 5GLVA 4HN1A 1QMJA 3OD4A 4HZFA 2XG3A 3ITQA 4W4ZA 2N7GA 2W2IA 4B8EA 2DU1A 3WVJA 3J26N 2YYOA 3PTRB 4XIOA 1BEV3 4JGZC 4AQ6A 4A7ZA 4LO5B 5GZFA 3O1RA 4AXOA 4OI0A 4YPJA 4XUTA 4MXVA 1MACA 1T2XA 5BNOB 2P2KA 1O4TA 2W92A 3H8RA 2ID4A 1QJEA 1LOEA 4QQOA 5I0TA 5A3PA 3A7QA 3I97A 3UGHA 5FY7A 2XKPA 2W3JA 3BODA 5FWJA 1WD3A 3PTYA 1BBT2 2XJSA 3DUIA 4UYBA 2G1MA 4XC9A 1RUC1 1W2TA 3ZN4A 3N9OA 4CUAA 1WW4A 1CX4A
chains in the Genus database with same CATH topology
2Z79A 2HWF1 1YXWA 2VVFA 4LBQD 4Q27A 2R073 2WZPP 4HSLA 4OI4A 2WNVB 4DFSA 1R093 3DN7A 3ILFA 1X7NA 1UW8A 2PLV1 2WJSA 3LOIA 1HKDA 2LALA 2P17A 4YM0A 4LBMA 2XVLA 2R063 3T1MA 3ZFFC 1IZ3A 4WM7B 2B46X 3SLIA 1AUYA 2Q1ZB 3J9SA 3ZMOA 4CEWB 3FFQA 5HXVA 4XXAA 5KWRA 1KXGA 1D4M3 4FPKA 4JTOA 3KLSA 1MEC1 1ENRA 1YCIA 1Q8OA 1Z7S3 3ENRA 4PJYA 1MZEA 2XWJB 1DYKA 1Q3EA 3POSA 3RI9A 4CEWC 1B35A 1B35B 5I8TA 2CL2A 3T1LA 1IQAA 4AFMA 3IWZA 4ZU5A 4K9SA 1COV1 3RS6A 4C90A 1QY4A 2DCJA 4QU2A 1UPIA 3RI8A 1AVBA 1FMD2 3ZFGC 4CEWA 1O7FA 4K3UA 4TZDA 3RYKA 4SBVA 2XJRA 5JI7A 3ZFFB 4CDQB 1DGWA 3HMYA 2OW4A 2A3XA 5C4WB 4GKXA 4BPZA 1QWRA 1ULGA 1OOPC 4HN0A 4CP0A 1K5MB 4ASMB 3DF0A 1MEC2 2XJQA 1DLLA 5BPXA 1AF9A 1DZTA 4NWWA 4LBJA 2HWD2 1BEV2 2KM2A 2UURA 1FATA 4KGQA 5F6KA 1R083 3APBA 5DUVA 5KHJA 4LHLA 2QVSB 1VBB1 4DB5A 3I8TA 5FO8B 1NCQB 5BNQA 3CL1A 1YI7A 4GWNA 1FV3A 4AWDA 4MUVA 1VJ2A 1TE1B 2UY9A 4JGYC 2XKOA 4WZFA 1AR63 5FOJB 1ASJ3 4F8AA 4L97A 2WSVA 2D3SA 1PO21 3BPZA 3SCFA 4HFSA 4DY3A 1CAUB 1A8DA 1RUJ2 3V0AB 3SXWA 1V6LA 1LR5A 2WINB 1JH5A 5BUVA 3OGJA 3MZHA 5JWPA 4AK3A 1D2QA 2BW8A 4OI1A 5F6LB 1JN2P 3S0MA 3VUOA 4BQ1A 5L73A 5J09A 1SCSA 5LEJA 3KM5A 3M3EA 3VDDC 1OMIA 2P34A 1DQ4A 1VBA1 3MIHA 5T54A 1IOAA 3IM0A 4YM3A 4XILA 4X8NA 2XHKA 2JD4A 3JBG3 2WWSA 3V0BB 4OUMA 2Z42A 2HYKA 2RJLA 4D7YA 3VHPA 2WFPA 1G7YA 2UYAA 3QBQA 1CAXB 1ENXA 2JG9A 4MSVA 1WBFA 2WL1A 4Q8KA 1PVXA 1PK6B 4YM1A 3HN1A 2EALA 4IEUA 1PIV2 5CIRA 4GALA 4XHXA 3SH3A 4OVEA 3KT7A 5CNAA 2ZBJA 3B02A 1S0EA 3FLPA 4M01A 4WM8A 1SFNA 2XVGA 1BQPA 1DIWA 2D97A 2WA3A 3B69A 3BOWA 1NQDA 3SITA 4XTMA 4YRDA 4IETA 5AVAA 2HEYF 1MS8A 4RQPC 3PVBB 4RS5C 3WNXA 1LEMA 3ZDSA 2HEVF 3FJSA 2BGCA 3NW4A 4Q4X3 4Y22B 5CA6A 5GALA 1RUNA 4CDQA 5FOBB 3FX3A 3MLJA 3ZFFA 4OI2A 5EJ3A 2FZ2A 2FBEA 4YYOA 4QQ2A 3ZYJB 3AKPA 2CNAA 1W6NA 2BYVE 5AFBA 1DZQA 3H9AA 2HWC2 1MVQA 1AYN1 1QKQA 1RUJ3 1N1VA 4ATEA 2VGDA 5A32A 2DURA 4CZSA 2X5IA 5EYYA 3M3OA 4DNYA 3AM2A 1QH7A 2NPIA 4QGLA 1MS9A 5E1RA 4Y26A 1RUF2 4AEJA 2OUHA 5FO7B 1VAKA 5HCAA 2ZPXA 1NYWA 2ZZQA 3HQXA 2C1FA 1S0FA 2AENA 4DXZA 2YHJA 3AP5A 3HT2A 2R6QA 3CJIB 5DG1A 2RR12 4W6YA 4JVAA 1JYCA 2YC0A 2DVBA 4E2SA 1AR72 4LA3A 4YZ5A 4BA6A 4AEMA 3SMHA 1OPMA 3E6CC 1KS4A 4JTNA 1IS5A 1EV12 1BVP1 4PLOA 3KGLA 2DU0A 1MS1A 5I93A 1LULA 1N47A 2FHRA 4B7EA 1LHVA 3VBHB 4MXWA 4IEWA 4MV2A 3VZKA 1LOBA 1VAVA 1VB2A 1FYUA 2PLV2 3B9IA 2BNOA 1OFSA 4XQWA 1ZBE1 2R043 3KS7A 4Y1UA 5KXEA 2VOKA 1RUF1 2GNBA 2A75A 4A7KA 1IKPA 4PF5A 2VOVA 2G4IA 1VP6A 1CAUA 4KL1A 3HD8B 1R1A2 2DWRA 5HCBA 2VMIA 1NCRC 1RINA 4E4SA 1V9U1 1C28A 1QOSA 3M8LA 3VBOC 5GLWA 1SACA 2O1QA 1S0JA 4F83A 3EHKA 4YM2A 3IKWA 3LGRA 3NAPB 3NV1A 3U07A 4QX5A 5C6CA 1XU2A 3ZPYA 1O4YA 1U5XA 1RUH1 4LBQA 4R9CA 3PLQA 2HKXA 4QHBA 3N7LA 4P9GA 1QJY3 1DQ0A 5FLIA 1S0GA 4XETA 2ZGOA 1V6JA 4JRAA 1DZRA 4KG0A 4Q4W2 4HT1T 1NXD1 3N35A 4NHMA 4XDQA 2K2SA 4C1XA 2NMOA 4Y24A 1SLAA 4CEYA 4QPGB 3VBRB 1H2MA 2R30A 2V73A 1O3QA 2CAUA 2BBVA 1ASJ1 2ZGTA 4N43B 3WDVA 4ES9A 2WT1A 3TYJA 4AFAA 3VGIA 5DG2A 1AR81 4R4ZA 4COWA 5D8AB 2XB6C 4K8FA 5C33A 4XFHA 1QOTA 2NLRA 2WLPA 3VN4A 3DGTA 4FSJA 2A71A 1OSGA 5FLHA 2PAKA 4FOYA 3MW4A 1KJRA 4LUMA 3NKTA 2PHTA 3WW3A 1O3TA 1C1LA 3OYWB 1X8EA 4PBPA 4IV1C 4CEYB 3H0OA 2VNRA 4XBNA 2WQ4A 5HCFA 3AKQA 2XL9A 5LRSA 3MIGA 3INAA 2JECA 1HIXA 4QT6A 5GKAC 4M3CA 2Z5WA 4H7LA 4Z2WA 1LESA 3WW4A 4AF9A 1BZWA 5GJ6A 5GZDA 4E2QA 1BMV2 4FCAA 2A6VA 3HIFA 1MZFA 3IPVB 1UZZA 4BMBA 1UMZA 2E9QA 4BM8A 4Y1VA 3S7EA 3B01A 5B2GB 1OHFA 4WVVA 2VH9A 3G7DA 4ZU4A 1H2KA 1HRV1 5FFOC 1Q8SA 2PHWA 1OOPA 5FLJA 1DU3D 4NR1A 4EN9B 2DUPA 4MH0E 2PHLA 4QXKA 1GZ9A 5FRAA 5I8SA 4GIQA 4RHV1 5EV7A 5GZCA 3QOPA 1QGLA 4MVTA 1EPWA 4UW4A 4IV3C 2ZX0A 1PIV3 2ETEA 5F1RA 5JPMB 2UU8A 1XXNA 2PLV3 2D6MA 4JCKA 2XJVA 3RYPA 5JSPA 3AMMA 4RR3B 1VRH3 2K9ZA 3MF6A 1CQ9A 5CG8A 1D4M2 2WNVC 1QJX2 3UV9A 3NWKA 2RM21 3UJQA 3LSEA 1LJ7A 4Q0UA 5JCTA 5C9AA 3PVNA 1HRV2 5KHIA 3ZMNA 1R1ZA 3JUUA 1TME3 1U5IA 2WFF2 1W6OB 1WW6A 3TAYA 4HKOA 4FOWA 3GNEA 4ZKTB 2GH2A 1JW6A 2VW0A 4IXLA 3J4UH 2ZHMA 4AEKA 1IHMA 1FPN3 2DUQA 4X8PA 1VBA3 1COV3 4N7IA 4YZ4A 2P3JA 1HRI1 1LECA 1RMU3 2WNUA 4CP1A 5BNNB 1FOD2 1FAYA 1Z7S2 3IN9A 2OA2A 2JG9C 4WVWA 2YPJA 2H6BA 5DUWA 2NP0A 1Q43A 2P37A 3RG0A 4FVVA 1LGBA 1RUG2 1LTEA 1YRZA 1MQTA 2BVBA 3IPVA 4Q4Y3 4EN0A 2EF6A 4I02A 4YNIA 1QJU3 1RC6A 1REFA 1WCSA 4QPGC 3VBRC 1POV0 1L3JA 1W6OA 2R061 4I2OA 3ZXGA 2QCSB 2WNUC 2Q8OA 4OHYA 3MDPA 5FBZA 1MVEA 1PO13 2EA7A 2ZAAA 4GH4C 1J3RA 1BKZA 2MEV1 3AXEA 5JI9A 3LAGA 3L9JT 2DTWA 1Q5OA 4LHKA 3JZVA 3E5QA 3M3CA 3R4SA 3QH6A 4JDMA 1K5MC 1J1TA 4Q0VA 3SH4A 3B93A 2E53A 4GB33 4AGRA 4IERA 3V64A 1PO23 4RS5A 5CAZA 3MEPA 2GMMA 2RS32 1EV13 4OUSA 3CEWA 3WDWA 1SDWA 4XFFA 5JLVA 1YYNA 3B5LB 3VBOB 1OQEA 4Q8LA 5IUQA 4XFAA 4AEDA 2VVEA 3NSTA 1WD4A 1PVC3 4GH4A 1AR93 2LTNA 2EXIA 3A0KA 1IKQA 2ENRA 2YROA 4Q26A 4B4PA 4LBOA 1NE4A 4AHYA 5JR7B 4XHBA 1A3KA 1AJOA 2XVKA 3WQ1A 1OQ1A 1YHFA 4DRVA 5JSRA 4META 1LU1A 2MPFA 2W39A 1J3QA 2D3PA 4PLNA 3SHRA 4FQZA 2IXJA 3PJQA 4JV4A 5D8AC 2BVVA 5JVVA 2GU9A 1XNDA 4OHVA 2D6OX 3NV2A 3OPZA 3AJZA 2Q5TA 2WNVA 2ZX3A 1JTZX 1RB8G 3IMNA 4TYSA 1I6XA 2TUNA 2VG9A 1NQJA 4XJAA 2WZR2 4XQDA 2BPA2 1WCDJ 1R091 4XPVA 2JDZA 4C0HA 3WCRA 4AI1A 5CFDC 3MPPG 2VECA 4O9GA 4EJRA 1EP0A 2D5HA 2X8KA 3URFA 3RZZA 4AEDC 1W6QB 1YJKA 5KBFA 4YW1A 3AZVA 3MGUA 1MS4A 3P3NA 1AYM1 3VV1A 4PBOA 2HWF2 2RMU3 4TWTA 2VVDA 2ZGLA 3D5OA 1G6NA 1CN1A 3GF6A 4IV1B 3ZFGA 3CU7A 3WHTA 5BNOC 1RUD1 2GDFA 1LHWA 1VALA 4CP2A 1HX6A 5L7OC 5JDBA 2IFRA 2XJTA 4DZGA 2UY8A 4I01A 1QH6A 4ES8A 1B35C 3N4MA 5E16A 4RSUA 4I0BA 3KMHA 3ZSLA 1PO12 1QJY1 1RUJ1 1NE6A 1H4HA 4F7ZA 3IDBB 1X82A 2EXJA 3J8F2 4HPKA 2GALA 1BEV1 4AHXA 3I7DA 5C9AC 5CFCC 1H1AA 3O0VA 1ND3B 3MIFA 5FQ0B 1ZZ7A 4COZA 4AGVA 3KB5A 3U0ZA 2EAAA 5AFEA 4R4XA 3DPRA 4FQ4A 1Y43B 4GMP1 1CAVA 1Y9QA 2CGOA 2VW2A 3MICA 2BNMA 3HT1A 3ZN6A 1ZZ6A 1DQ6A 1AR83 1MQTC 2FMDA 4KGGA 1FMD1 4QQLA 3WHUA 4I3GA 2YDEA 4KG8A 2ZAHA 4CEYC 1QU0A 3TRSB 4C91A 2PELA 2NYYA 3NAPC 3AX4A 1K5MA 1RTVA 4JGZB 4NO4A 5JSOA 5FDBA 1LODA 1W0PA 3KZ4C 4UW5A 5BNPA 1SEFA 2ZX4A 4B3NA 2O8OA 2W68A 1ALYA 1F31A 2JE9A 3WW2A 1DYPA 3TB0A 3DKWA 2JXAA 1RIRA 1YFUA 3M2MA 4NWVA 1JOJA 1ZRFA 2WLQA 1RMU1 4TSVA 5T5JA 3IDEA 4EN7B 4ISQA 5CFDB 3OBRA 2PFWA 4X6QB 3ZN6B 4ZU7A 3GBFA 2D40A 4BCUA 1CR7A 3VKNA 4ITCA 2X29A 1SLBA 1MS5A 3G6JB 2R1DA 4Y1ZA 2JG9B 4FXKB 4RD7A 1ENQA 1XNKA 2YUEA 1IS6A 4L8QA 2GMPA 4OHXA 1R1A3 2RM22 1DDLA 2GNDA 4P14A 2VXRA 3VZOA 1GQGA 5EZWA 2VOXA 4YVWA 3HAGA 3ME2A 2CAVA 2QJVA 3AP7A 4JQRA 2XL7A 4RHV3 1TEIA 1HLCA 2JE7A 3R05A 4E2GA 1N1TA 1HV1A 5CU1A 4AHWA 3VL8A 5I8YA 3TNPB 3ZYIB 2YY1A 1RUC3 1FOD3 2W52A 5JOYA 2I07B 3ASIA 3K48A 1QXJA 4ORFA 1VBA2 1LOFA 3OGGA 5AC91 1VLNA 1UX6A 2Z69A 4K7JA 2P3IA 5J98B 3M7AA 3VKFC 3HWJA 1YNAA 2QNKA 1AR61 4FAHA 1WMFA 4Z8BA 3ZFGB 3POYA 1ND2A 4RQPB 4DPNA 5SV8A 1QHDA 1F9KA 3RMYA 1DGWX 2BFUL 4FPHA 4BLIA 3ZXLA 2MHFA 4GXLA 4Q4W3 3X29B 1F2NA 2CWMA 1C4RA 2HEWF 3GZTB 3VBSC 3MLKA 2D3RA 1DGLA 2ZKLA 1OKQA 3O0XA 3ILRA 3ZFEB 1CGPA 1ND2B 4RQPA 2ZA9A 1V9U3 3IT8A 1ZVFA 4XMAA 1CJPA 2I45A 4MLOA 3RDIA 1LHOA 2GC0A 1IS4A 2DYCA 3LA7A 4L11A 1V00A 5H9RA 3VZLA 4DRRA 2HWE1 1PGL2 1YI9A 5C4WA 4PIYA 4LO7A 4YW2A 4JGYB 3P3PA 1EAH1 1RUH3 1VBD1 2W08A 4B29A 3SCGA 4LE3A 2D6KA 5ACA1 3JBG2 1A8MA 4K40A 3DV8A 2OUJA 4UW3A 3JU9A 1W0OA 3TN92 1PGW1 4YZ3A 2A3YA 4K20A 2ES3A 2DVFA 4IEYA 3WUCA 3D0JA 1O3RA 3OJBA 3BU7A 2VNOA 3ZXFA 1BVVA 1ZZ9A 5C4WC 3EQEA 3DPRC 4QPYA 1VBB3 4RFT0 2DCZA 2ZGUA 4XF4A 2BUKA 3WW1A 1JXNA 3D6EA 1BBT1 1W6NB 4Q4X1 1NCQA 2ZGNA 1J58A 1U12A 1AR92 4J6GA 2H6CA 4Q4V3 4Z92B 3WY6A 4AHZA 5T55A 4IEVA 4OHZA 4WZCA 1QJU2 3MPBA 3H3ZA 3WDYA 3RMXA 3USSA 4PIXA 3R4UA 4KWLA 4FPFA 4Q0PA 3FWEA 4XFBA 1FT9A 3H1WA 4PCRA 3AKTA 2QDRA 4WM8C 3VZNA 1LEDA 2ILMA 2VU9A 3AFKA 5DUUA 3WINE 1S1AA 3ZYRA