2A77H

Anti-cocaine antibody 7.5.21, crystal form ii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
219
Chain Sequence
DVKLVESGGGLVKPGGSLRLSCAASGFTFRNYGMSWVRQTPEKRLEWVAAISGNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARHDDYPYFFDVWGAGTTVTASSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
molecule keywords Immunoglobulin Light Chain
total genus 47
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2005-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77H01
1RUQL 2R4RH 3HC4L 3RPIA 3L3JB 3PWLB 2F5AH 4FFWC 5C1MB 1GRWA 5CIPA 5D96B 5IESH 4LPYA 5CEYA 1GGIH 1KSRA 3RVVD 43CAB 1EVUA 3MR9B 4NWUL 1F3DJ 4PJFF 5DQ9A 1C8PA 5T5NG 3MV9D 2ATKB 4GUPB 3MLYH 4ENED 8FABA 4M62H 1MQ8A 2Q76A 1JF5A 4CJ1A 5EOTB 4F9LA 5DJ8B 4XH2A 2J3SA 4IMKA 3TZVA 5JR1H 3WFEL 1CTOA 2XWTA 3TT1L 2D31A 3D39A 4FZEL 1U3HD 4HGMA 4K2UH 4GBXB 4NUGH 5EFIB 1N0XL 2ZSVA 3QG7L 1MWAL 1HEZA 1NC4D 1YNKH 3SDCB 1C16A 2D03H 3QEUB 3QQ9C 1ZWIA 2E8ZA 1KBGL 3KPNB 3ROLA 3MLTA 4FQCH 4P57A 4JFXA 2YPLB 4P2OD 1JHLH 5E08H 3FRUB 5CEXA 4KJQC 1U6AL 2MOVA 1MUJA 3H8NA 2APFA 4ZSOB 3CJJA 2P5EB 3QUYB 4X6EA 3ARGB 2O5ZL 3W82A 4NNXB 3SOBH 1X4ZA 3JTTA 3PHOA 2D4DA 3I75A 4HS3B 4O2EB 4XZUB 3LKNB 4PJAA 4R0LA 4N5UA 4XT1C 5DMGC 3CVHB 4DOHE 1HHHB 5D8JH 1J7VR 5J56B 5C7XH 3VRJA 5FYJE 1G7IA 2J7LA 1F6LL 3LKRA 5FYKH 1TJHH 1FFQA 2IFFH 2N7AA 3DSNA 3TT1H 1EXUB 2X10A 4LVEA 3SJVB 4WHTB 1I3RA 4Q9RH 4JPIB 3KYMA 1G1YA 2ADJA 4XAKD 4DGYL 5KS9A 2DWEB 5TDNB 3SHSA 3ZDYE 3TFKD 5C0CA 5EUOA 3RVTD 1I1AA 2H1PH 3AROA 1U3JA 1HH9A 4QRTA 3F12B 5E2TL 5IM7B 2ED9A 3CFJA 2VZUA 5E08L 4U1HB 2VL5B 5BZDB 5TE7H 3KR3H 4H5SA 1MAJA 1A7QH 3EZJB 3T4AB 3DTXB 4M7JH 1G0YR 2Z31C 5IHUH 5JXEA 1F4YH 3DMMB 4MA1C 3HG1A 1R24B 5IK3A 2D0FA 4L4TE 5SX5H 4JHWL 2XG4A 5FGSA 2F8OA 3WUZA 1D6VH 2H8PB 4QEGA 3S4SA 1CDHA 1IAMA 5E99L 1A1MB 4AT6A 1AR1C 3S8WA 3HZKB 3IS0X 3M1BA 2BNUB 2FO1A 4NN5C 4Z7UB 5J6HA 5E70A 1H9VA 3RKPA 1J0YA 1QVOA 2V5SA 3QWRD 1NL0H 4K9EC 3ISWA 5D7SH 6FABH 1N7MH 4HXBH 4KQ3L 2OI9C 5LCVH 4KPHL 1ZLUH 1OSZB 1F00I 1AO7A 1I1CA 5TQ2H 3P11H 3FN0L 4NCDA 4NBZB 3AAZA 2G5BA 2G75B 3BT2L 1A6UL 1EPFA 4LSQH 4D8PB 1YDPA 5I1AA 1UQSB 2BNQD 1U8MB 5MEQB 5A43C 3CPLA 4L4VD 3I50L 4KDWA 2F19H 1OOAA 5FYKU 1AGDB 2NNAB 2HFFB 2ICWI 3D87B 3GIVB 3MC0A 4JPVL 4F3FB 3HFML 5I8OL 1AY1L 1MCJA 5HGBB 2FX8L 1X5KA 1AQDA 1N6UA 2A6DA 5SX5K 5JW5B 3AB0B 5L2JA 2R1WB 4CMHC 4UNUA 2FIRT 4PJCA 4D0DA 3B3IA 4YGAB 3BXNA 5MENA 2OTUB 4MD5B 5EC1B 3Q3GA 3ZYIA 4XNMB 3QUKA 5A2FA 1QSEE 3BSZH 4MNQA 4HJGB 3A67H 4WU5A 2VLRA 1YQVL 2DJSA 1IARB 3OXSB 3HHRB 2ESVA 3QI9D 3OF6A 5DK2A 5IV2B 3NCCB 3EYOA 3VFRB 3CCHB 4LHUD 4MSWB 5GGVH 3N1FC 1I8KB 4IDJH 4M8VA 5DYOB 2FIKA 3H3BC 4HG4J 1K5NB 3JWOC 3BZ4B 4XHJD 1IQDB 3W0WE 1CYGA 3H9HA 4HUWB 1AH1A 3VFGL 2HN7A 4WW1A 4IMLA 4CRPA 1EEZB 1W0YT 3QH3A 1B6DA 4K3EH 1X5YA 4JHBA 4DUXA 2R0ZL 3B2VH 4XCFH 3FO1A 5IB4A 3GM8A 1Q0XH 4G43B 2VAJA 1EEYA 3C5SA 1E27A 4HT1L 4BUGA 1IGCH 4UIMB 1RAMA 1QD0A 3BAEH 2UWEF 1CXIA 4UDTB 1ZTXL 1MREH 2BRRL 3GMNB 4AQOA 1LDPL 5HYEA 5CP7A 2F54A 4ONGH 4B0MM 4UQ3A 1A0QL 3VXSB 2NYYC 4XWGH 4YDJB 4WTZG 1UKSA 3SJVE 4X6EB 2APVA 1A6PA 2CXKA 2WK2A 3VXOA 1RZIB 5C0BD 5I74B 4XP6L 3MRRB 1BF2A 2DLTA 4PJEA 1A6AA 4M61A 4PTTB 4NQCE 1IBGL 4O58H 3IFLH 1SJXA 4KJWC 4YBHA 3L95B 1R0AH 2EDOA 3ARTA 3O9WD 2A74B 4ZFFB 1BWWA 4TTDC 3PGCB 3CSBA 5HHQA 1JWMA 1OGTB 3L3OA 25C8H 3S5LA 3N9GH 4WTWA 3U4BL 2VABA 2H6PA 3HUJA 1RHHA 1KXTB 4U2YA 5C0AB 4JVWA 2Y36L 1AP2B 4P46C 2I60L 3BRDA 5HGHB 1CXKA 5KS9B 1OSPL 5IFHH 4LKXA 2L7UA 3U4AA 1Y0LA 1OHQA 1E28B 1EX0A 4JFQB 4QXTB 5IQ9A 4AIOA 5K59F 2VLME 3VMNA 4WHYG 2J8UE 3ZL4H 1RURH 3GSXA 3PWPB 1QLRA 2BHYA 5EN2A 5KVMC 3L3DA 5HGHA 1OVZA 4EIGB 3CFBB 5KSBB 1H3XA 4NYLB 2PO6A 2VQUA 1IFHH 2I26N 1T0MA 3WE6B 3U0WL 3QFDB 1NCCL 2ZG3A 1RZJL 4OLWL 5EZLA 3KPMB 1A7RL 1EUTA 3SDCA 3T1FA 2HFTA 5TE6H 2DKSA 5C0IA 2OP4L 4PJXF 5D7IF 4AMKH 4XPBL 4AG4H 1OAUH 4EI5C 4KMQA 2C4FT 1RVFH 1TTGA 3EO0B 2DIAA 4ODWA 4FQHB 3WIFA 3ZE0E 1QKZH 3MNVB 3K4AA 1FG9C 4NNPL 5IHBA 5JXED 1T20A 2D0GA 4UT7L 4S1DD 3UBXB 3B5HA 4KY1H 4YBLC 2A77L 1CF8H 2HT2C 4YPGB 4U7MA 2WBJD 4U6XA 5KVGH 4JRWA 4PJBB 2F8VA 1J10A 1N26A 3G5ZB 1HZHH 3CZJA 2IEPA 5ENWA 5H35B 4O9HL 3QEQB 5EWIH 4JG1H 4G9DA 1QBAA 3HPJA 2DOCA 1VEMA 1RU9H 2BNQA 1GPOL 4OZGA 3GSUB 1M05B 5GS0D 1G7LA 5D4QA 5CILL 1JVKA 5IHLB 1KEGL 3GSWA 32C2B 1LE5A 1YEDA 4CMMA 1OAKH 3RBSA 3UPRA 2BNQB 2BVUA 1ZVYA 2ZJSL 2Z8SA 2P5WE 3V4UL 3T77A 4HK0A 3TNMA 4HJJL 4DVRH 2DL9A 5CJXA 5D1QA 4MD4B 2AJZA 3BGFB 4JFOA 3RL2A 2VRAA 5JQHC 1HKLH 1RVFL 3D48R 4U3HA 1EUUA 4ZYKA 5CAYB 2WINB 1L9NA 3VH8B 1OL0A 2CLZA 3GKZA 1FZJB 4OLVH 1LEIB 5E4IA 4U05A 2NY2B 4OT1H 4W4NA 3G6JE 4Z18A 5ID0B 3MOAL 1HE7A 4QHMB 1NPUA 1YY9C 2V7NA 4LVOB 1BZ9A 3GBNL 1N8ZB 2IBGA 5FF6A 5D7JC 2DLGA 2A83B 4ZDHB 2NY1B 2Q86A 4FFWD 3OAZK 1L7IL 4X7FC 2AK1H 3JV4B 3TCXA 2AK4D 1RUKL 3BKYH 3MV11 1R5VB 4WI4A 1RULH 4XAWH 1BIIA 3UAJC 5F7HA 4FOMA 4Y16B 2NXYC 2YD4A 2VIRA 1T5XB 3DX6B 4S0TD 1EO7A 2EIDA 4H25B 2P5ED 3DPBA 4Z76B 4HULB 1DEEA 2Z35A 1NC2A 1FG2B 3WLBA 3HUJB 1I85A 4XNYH 3P2TA 5B3JF 1WZ1L 3LMJH 2EDWA 1B2WH 3RTQB 1KCLA 4X9BA 3PWNB 1NGXA 1YEKH 3AUVA 4LHJB 5I0ZA 5D7SL 3FKUS 3GNMH 3DXAE 4MA8L 2C3XA 4GMTL 2DQFA 5F1NB 1ZKAA 1V7NH 1EERB 1J0JA 1Y18B 2G75A 2DTML 4K3DL 1IGFL 3O0RL 3B3IB 4MQXD 3W0WB 5CZXD 2IG2H 1I1FB 4P2OC 3TC9A 1ZGLM 2ADGA 4PJ5E 4PJXE 2VZ1A 5HVHB 2SEBB 4MD0B 2HLFC 3FQTB 2R2HA 2AEPL 4AH2B 5FUZH 5C86A 3D18B 1OP9A 3C5ZD 5DQDH 4OV6F 1R3LB 2XOTA 4PJCB 1OLZA 1QA9B 2J6EA 2OQJA 2SEBA 4YAQB 4H0HB 4X7DC 2OSLA 4D9RE 5D71H 3ZHKA 2BMKA 4P23A 2K9UA 2VNCA 2CRIA 2EXWC 2H8PA 2YRLA 3MLXL 4NRZB 5ICXB 1SYVB 1ZANL 2JB5L 3RI5K 3BSZL 4U0QB 1KEML 1I3UA 3L7FA 4N8VG 3RA7H 4BA8A 4M48H 3NA9L 5DEGB 1D9KB 3GHEH 2DQIL 3DO7A 5ADPL 1VGEL 4GRMA 4M9PA 3FO1B 4WUUD 1DUYA 3K1KC 3QDME 4HBCH 1FVDA 5BVJB 5EBLB 1A5FL 4U1JA 1OD7A 3MLUL 4DGIL 5HBBA 1UB5B 5DJ6A 2DQCH 2VAAB 1B0WA 1JZ4A 2OBGA 4KJPC 3MREA 1FNAA 3RL1A 4EDWH 2CUMA 4HC1L 2FEDC 3MA9L 3GM0A 5EOCJ 1K2DB 5LG1A 3T77B 2X4NB 4NQCA 3INUH 4JAMB 5KSUB 3CMGA 5C0EA 2CMRH 2F54D 4D0BA 1IGTA 3B9KC 3RHWF 2N1KA 1BD2D 2FEEI 2QADB 1FZMB 2FD6H 4WV1B 5HVHC 4CMHB 3U48A 3ARSA 5FYJU 5F9OH 2FCBA 2VDML 5EO9A 3NTCL 1HIML 1UJ3A 2CUIA 1JTPA 5GGVL 5J11C 2Y23A 4L4TB 4MZ3A 5E5UB 1AKJB 3EJZD 4LOUD 3MXWH 2R1YA 2J12B 2ZP0T 3FFCB 4J4PD 1MHCA 2XZAH 1N0LA 3T2NH 1OARH 2BSTA 2IFGA 3F62A 4GT7A 3TBVA 2B5IC 1AQKL 5BQ7A 2BCKB 2VLKD 5EIIB 2X05A 4GKSA 4JQXA 3GBLA 3TO2B 4O9HH 3TIDA 3KLHC 3N1PC 3C8KA 3BAEL 1MHEB 4KAQH 3VFSA 3MRHA 4S1QL 1I85C 4JO4H 3DRTB 1ULVA 4C56A 2R0KL 4R4FH 3RWEA 4N0FA 5L2KD 2XA8H 1AI1H 1QLFB 3HR5B 4FFVC 5J6HB 1DBAH 2GTZA 4NWUH 3WFCH 5D2LF 1WC7A 1NMAH 1OAYL 4HH9A 2QV2A 2Y5TB 3SDDD 2E6JA 5M7QA 4M62L 2E7CA 5DT1H 4DVRL 1GGYA 3NBNA 3GMMB 3RWDB 4J6RH 4XPFH 4WNQA 3IDXL 2NCMA 3TPUA 2YUZA 1LP9A 5ESAA 4JR9H 2I5YL 4RMVA 4A6YL 3MJ8A 4OCNC 4GS7C 3LH2H 4PP1D 1JV5B 4LCCC 3AM8C 4U3XA 4TSBH 1YNLH 3D9AL 5FHAL 1P7QD 1RUQH 4IDJL 2IH3A 1MWAH 4XC3H 1LK2B 1URLA 2R1XB 3BN9C 4QWWC 4PTUB 5EORH 4Z5RA 1NLDL 2X4TA 1KELL 3RX7A 5DO2D 3MRLB 2DWEA 4N5EC 5TDNA 2XKNB 1TTUA 1DZBA 4P3CL 4ZFFA 3D2UB 4X5XB 4LHQB 3O8XB 4E0RA 3WFHB 3T8XA 3MPCA 1PZUB 4NKMB 1B9ZA 2B5IB 2O5ZH 1MHPL 2VDRL 3UP1A 1KENL 3HRZB 1IKFL 4WWID 5IOPA 1RJLA 4DZBB 1PAMA 4WY7L 3MTRA 3RVXD 5TFSL 5L8KB 2VLRD 3VFVA 1DTUA 1BX2A 2NY6D 2AKRB 4CVXB 2GFBB 1NBZB 2EEBA 1CD1A 4HIIA 5FKAB 5E5MA 5TDOB 1OAQH 3DRQB 4OF0A 4QO1A 3F58H 2G9HA 1YEGL 5I1CH 4NM4L 4X6DA 3OJDA 1YUHA 4RSVA 2R8SL 3S3PA 1U91A 1JBJA 5A40E 2YPLA 1KCUH 3C5JB 3L5HA 3MLRL 4KUCD 4R4ND 4U3CA 1FP5A 4RWHA 4YZFF 4GG6E 2H26A 4GO6B 4OLZH 2W38A 5KSBE 4W6WB 5KSUA 3HE6A 3V6ZB 1FYTA 5EWIL 3ULVE 3L5WB 5DJZA 5DD0L 3RTQA 1NUGA 2GHWB 3S37H 4V1DB 5CJOL 1JHTB 2NY3B 1BBDL 2NX5B 3RRQA 4JQIH 1IQWH 2W0KA 5INCA 1Z9OA 2HLFD 3K3QA 5HHOA 5DJ8A 2DMBA 3CXHJ 2HT2D 1PJ9A 1MFEL 5TFSH 4WUUB 1RUKH 3BKYL 3ARFB 2YSSA 1SM3H 2IJ0C 4NZRL 5KN5A 3C87A 4M5YH 5DEFA 4XWOC 3TH4T 2G5BB 1A22B 4M4PA 3BDYH 3LHPL 1GZPB 2FJFB 3FQRB 3VGFA 2FECL 1PW3A 1G7IB 3VXQA 4X8XA 4PYGA 1L0YA 4NM4H 4YHIB 4WI8A 1N5AA 1WBYB 5D7LA 5GGRY 2DN7A 4XBEL 5HHOD 4DTGH 2Y5EA 4YH6A 2M1KA 4XNUH 1JNLL 3FB5A 3IDGB 4OGAD 4WO4C 1BQLH 3R0NA 5FCUH 2V7HB 3EFDH 15C8H 3QNYA 5ID1A 1KJMA 5EUKB 9CGTA 1UXSB 2Y1VA 1A7OL 3H3KA 4F2MB 5D7LB 3UC0H 4Q9QH 3SKJH 3VH8A 1R3IH 1KB9K 1HQRB 2CO6B 1G84A 5FDYA 1HNFA 3PDDA 1OT2A 1B0GA 2FLBT 4LP5A 5ADOH 3UZQA 3QWOA 3C2AH 2YXFA 1WEJH 4OLYH 2ADGB 3EYUL 3GK8L 3EDJA 3HUJF 2XFXA 5AYQA 2NW3B 1D5BB 5F9OL 1A7NH 1I3GL 2YPLD 3C60A 1MCHA 2Z8VC 5F7UA 3CH8A 2Q86B 3DVFA 4HXBL 5CILH 3JWOH 1KEGH 4PRPD 1PX4A 3X11A 1OW0A 4HD9A 4U6HA 2J4WL 3V8OA 1MCPL 1O7SA 1E4KA 4GRWB 1DSFH 1J1PH 3RY4A 2GJJA 2VDOH 3RIFF 3MRFA 2XZQH 4L8SC 5IB2A 2RIKA 3WFDH 2OK0H 2JELL 4PJBA 4GMTH 4U6TA 1EEQA 4F57L 1FFRA 1MCOL 4TNWK 3V6BR 5LAXA 3I85A 2W65B 4G7YH 3O0RH 5F7EL 4C58B 3ZYJA 3K2MC 5CGTA 3IJYB 5JOEA 2KBGA 5IR1A 3H9SA 4PRIA 4G9FE 3OKOB 5GISH 3CD4A 3IDJA 2BSSA 4PGDA 4QRQA 5DRXB 3H42H 2NMSA 3QIUC 3PL6D 5DFVD 4LRNH 1P1ZB 4RAVB 2ADJB 2ZPKL 1N6QH 1PSKH 4ODTH 3MLSL 3MV8B 5DTFB 5A3IC 3NFNB 4MAUL 3SDYL 5CZXC 5JMOC 1X5LA 1CE6A 1FNLA 2EE6A 1BM3L 4YZFE 3KYKH 2CLZB 1EHXA 3QHZL 5J6GA 5EBWA 5IM7A 2EH7H 4G8GB 4MNHA 3QO1A 5F8QC 3TNNB 3MV9A 4JO3H 5JW4Q 2GI7A 3OB0K 4QY8B 4HIXH 3HS0A 3KDMB 1CFQB 3OKNB 1NFDE 3QQ9D 5GGVY 4OKVA 1SY6L 4LKXB 2ICEB 1MF2L 4HCRA 2K7QA 3DUUA 5KOMC 2GSIA 3PV7A 4X5WB 4I9WE 3KPPA 1N64L 3KYMB 2F5BH 2YN3A 3QUYA 3L9RA 1DQTA 4M7LH 2FBJH 1CFSB 4JPVH 1NGZB 1KPRB 1M7IB 1CDBA 3UPCA 2DF3A 3HAEH 4JKKA 5HDQH 4WI5A 1XF5B 4TSCH 2WWMD 2P5WD 3GFUA 5T1KB 1QFWH 4UV4H 1LO0L 4E41D 2CH8A 2JKXA 2IPTL 4Z7QF 4CDHA 3AXLB 3EYSH 5E94B 3WL9B 4NO0B 5IMOA 4UT9L 3DX7A 1Y6NR 4JRXB 5DS8A 4YBQD 4J3XA 4XB8A 1OTUC 4DOHB 1JGUH 1MCEA 3VRIB 4PGEB 3RWIA 3QIUB 5TE4L 1MLCB 3LQMA 1TZIB 1AGEB 4OBSA 1JZ6A 1A64A 2QADC 2Q6WB 3SDAA 5D5ME 2R1XA 3QULB 5H94B 2EIZA 2XN9B 4XCYA 3PF2A 2ORBL 4U7KA 1FZMA 3QDJB 2VH5L 5HD8D 3S9DB 1CK0H 4M48L 4Q6YA 5HYQA 5FYLL 1RZ7L 1WT5A 5L2KB 3LH2L 4OQTL 5IB2B 4IOIA 3IDUA 4XVJL 4I0PA 2VSDA 4WWKA 2YD1A 3DBXA 4QXUH 2I07B 2J88H 3SY0A 3QRGH 3ULUD 3ULSA 1LEGA 3VCLB 1JRHL 3FQUB 1L4IA 1QO3B 3BYTA 2W9DL 4JY5H 5T33H 4P3DB 5D6CA 4P9HH 1W72B 4TSCL 2JTDA 3DETD 3LSOA 1JP5A 2GY5A 4YIQB 3RUGF 1EFXB 1TZGL 5DD3L 4YPJA 1JYVA 4JDZB 4PJFA 1M6OA 2CPCA 2GJZB 3QUZD 3WNLA 4P2QE 1T21A 4ONGL 5FO8A 3FFCD 3QPXL 4GMSH 3LS4H 5D96C 1MFDH 4UBDD 2CMRL 4AG4L 5DEGA 1VEOA 3HE6C 5GIRB 1RZIA 3LB6D 1F6AA 1W0VB 1DBKH 3RTQC 4QRSA 4I2XB 3KPRD 3H9SE 4PRIE 3S34H 3T65B 5I30L 1YMHB 4F9PA 4MAUH 4IRJD 1F11B 2Y9RT 3UZVB 4M1CC 2AK4A 1FQ9C 3H9SB 4PRIB 3NVQA 3MRCB 3DURA 3PNWB 2QL1A 1FL6A 3QUMB 2O5XH 3L3KA 5DK0B 1CI5A 5DRXA 4OLVL 2JJSA 4IOFC 3QXWA 3OR7A 5CP7B 5C07B 4UQ3B 3H2WA 2VXTL 3QEGL 2AJUL 2YD5A 3HZMA 3SDCC 1YEJL 1U8QA 2NXYB 3PWPA 3QQ4B 2MPAL 1GGCH 1TVBA 2EDHA 2AV1B 4DKFL 1NFKA 4XNMA 3RDTA 5ISZE 1MOEA 3VFMA 1WITA 5BV7C 3GSOB 4I18B 1GZPA 3VA6A 2AGJH 1CD9B 1BJMA 3RHWK 5CEZL 4ZD3H 4QY8A 3FQXB 2NY7H 1FH5H 3QUYC 4R7NB 4DN3H 3EYOB 3HPLA 3QHTC 4B41A 5HYIA 1P84J 1F4XH 1II4E 2C5DC 3UTQA 4L8BB 1XF4B 5T1MA 1IGYB 3O6LL 2LVCA 5EO1A 1IGML 2RFXA 5E00A 2BDNH 2HFEB 3R8QA 3TBVB 2P5WA 4Z6AT 3F6IA 3TYFA 5I1EH 1IAII 4PJ5B 4NO0D 2PYFA 3IXAA 1LO5A 5T1DH 4A6YH 1RD6A 2EC8A 1KJVA 1IAKA 5GHWH 1E6JL 3VJ6A 2XQBH 3EHBC 4LASL 2CJUL 4S1RH 3H7LA 4G6KL 2NR6C 5HHXL 1AD0B 5GGQL 4LDEB 3RJDA 4UUJB 2D7MA 4ERSH 4RFOH 3RJQB 4WEMB 1XGTA 1CGXA 5CJOH 4L3CB 3MBEA 3QDAA 3QEQE 5FYJL 4N5ED 4H1LB 1AR2A 4NWTL 3B9KB 4PRBB 1KJ3H 4X4XA 5IP4A 3RZCA 1QFPA 4OCRH 2I25N 5E8DH 2FWOB 4GXVH 4H25A 3BYYA 1J05A 3GMQB 2F74A 2J8HA 5GRUH 4HLJA 4JFDB 3HN3A 2DKMA 4KV5E 2JJTC 2PR4L 4OLXL 1LO3H 3WS6A 2NY3C 1F4XL 1C5DB 2BERA 2B1AH 4M5ZL 3TIEB 3GSNH 1DQML 3VFUA 4F8TA 3PHOB 4YC2B 4MJ5A 3DV4B 3ECBA 2BNRB 1FDLH 5F93C 4M6OH 3X13B 5GGSB 1N59B 4NHUB 3IFNL 2JB6B 1MJ8L 1QSFA 1AE6H 2M26A 4OB5L 3SQBA 2QSCH 3ALPA 1MJUH 1GXEA 1G1CA 1K8DA 4XCFL 2I9LB 4I0CC 2JELH 1YEFH 3DI3B 5MENE 1CLOH 3BXNB 3TT3L 5E4EB 4OLZL 3T0EC 2BVPA 3OKLA 4K3GA 1I8LC 2G2RB 3ZTNH 4R8WL 1FZOB 3IDGA 2AJZB 5EUOB 2IPKA 4XNQB 4JKWA 3K2UL 1ZGLA 4KJWD 1A0QH 3IU4H 4DKEH 4OCRL 4CVZB 4Z7VA 1XT5A 2VUYA 3KJ6H 5FOJA 5C3TA 4HHAB 1MJ7L 5TE4H 2DQTL 1P7HL 1CG9B 3DMMC 4JDVA 3BWAB 5D6CB 3RWJA 4PJ7B 2PR4H 3DO3A 4OLXH 1ORQA 4JGUA 1MCPH 4U33A 5I15H 1AXSA 3EIFA 3ZE1E 3K80A 2AJSL 5IWLA 1NCWL 2VISA 1XCQB 1YY8B 2DI8A 3NA4A 1R5IA 5D7LE 5EO1B 1WUNT 4XNZB 5TH2B 1AO7D 2NW2A 4XP9L 4HPOL 3O3DA 4WNQB 2YR3A 5E5RB 4F7EA 1PX3A 3RKDD 1INQB 2E8YA 3PXJA 3UDWA 3LKPA 4KUCF 2BFVH 2C26A 2VISB 3Q6GL 4QKXB 2C7UB 5CGYD 3QG7H 3IT8D 5J3HC 1TZIA 4WHYH 2E3VA 3CVHA 4LPVA 1KT2B 4X7SL 1I8IA 2VUOA 3FO9A 2H1PL 1S7RB 1WF5A 1MNUL 2XWJA 1LILA 5D1XA 1V8HA 2LTQB 4NIKB 1VPOL 4YHZH 1OP5H 3VXUE 2A38A 4CNIA 4KWUA 4L8DB 3BZEB 1K85A 1T2QH 1UJ3B 2IAMD 3T0EB 4X0KB 4AYFA 1F58H 3L95A 3LV3B 3AB0C 4YHKL 4GS7B 5AUMB 1CFNB 1YNTA 3KYOB 1IGTB 5FM5O 4L29B 2HH0L 1CICB 3QUXA 3T0EE 1U8IA 5IUSA 4TYUA 3QIUA 5K9JH 3BQUB 2NPLX 3DGGB 1JF6A 1HHKA 3VGBA 3VFGH 5IB5A 3FRPA 8FABB 2X4PA 3K81A 2AS5M 1CLCA 4HBQA 1TJGH 4UT7H 1XIWD 2ZCKH 4KK5C 3AS2A 2WSKA 2GFBA 1RI8A 3WIHL 4G6ML 5EIIA 4NCC1 5EO0A 3O8XC 1N7ML 4TRPL 3ZDXF 2YUWA 3MV9B 5TQ2L 1PBYA 4DZBA 2KZWA 4PJAE 5FYKE 5JPMB 1AI1L 3PXHA 1ZA6B 2B4CC 4OQTH 3IXTA 2YA1A 4JM4L 4RZCB 3MBED 4YHLH 4G6JH 1RJZA 1INEH 1DBBH 4OGYL 3O41B 5EZOH 3MNWA 3V4VL 5K9QG 5J1AA 3OMZA 4KK9D 4FTVB 5KG9A 4IMLB 4TNVK 1IC7H 1ZHKA 2QSQA 4FABH 4XPFL 4QNPF 3QHFH 4HUUA 4WY7H 2DL2A 4BH8A 1UVQB 4MD0A 4OF8A 1Q9WA 2XI9A 4M7LT 4FQ1H 5GS3A 4X6DF 4H1LA 2DAVA 4U1JB 1FV1B 3SDYH 3PDOA 2HLAB 3O6FB 2P8MB 4Y5XA 5GGRB 3VGHA 4R2GB 2UZXB 4WU5B 3LS5L 3RGVC 3UO1H 5EU6A 3T04D 3U1SH 4RGMC 3M17B 3VXNA 4GRLB 4L9LC 3VG9C 4GAFB 1AHWA 5E2TH 3EDFA 5I1IL 2DM3A 5DJ2B 1J9CT 1D6EA 4G6MH 1WLHA 1NL0L 1SYSA 4P4RB 4C4KO 5AD0B 3OL2A 2R1WA 1EO8L 3PWUA 2J88L 3TVMA 3K8LA 1ZVSB 1DFBH 3A0OA 3HG1E 4FQXB 3O6KL 3L7EB 2D2OA 4Y19E 3LRSB 1AC6A 5HDBE 3RWEB 4PRPE 1ZLSL 3OBAA 2WBJC 4OZFH 4K7PY 4WEBL 5E8DL 4ETQA 4X9FA 1NUDA 3IDYC 3PGFH 4D8PA 4QRRE 4DGVL 5L88H 3MBXL 5HHPA 3U79A 3P30L 4OCXH 2VDPL 3RPIB 1S7QA 1JPTH 1MFDL 3GMNA 3EYFA 5C0CE 5FKPB 3T3PF 2HTKD 3OGCB 4KRMB 4LLVB 3S98A 2HFGH 1SYVA 1L0XA 1VESA 3MACH 5F70A 3ZKQD 5MI0C 1Z3GH 1QTYT 5SWZE 4D0DB 4UAOC 5LQBL 1KJMB 4KVNL 4PREB 4CADB 2Y07L 1G9ML 4HF5L 3ILQD 4D9QD 1UM6H 2DLHA 4MA7L 1CGSH 2ZCLH 1NCAL 5CUSL 2C4XA 1H8SA 4D9LH 5J0BA 2VXUH 2P8PB 3PABB 3O6FC 3OKKA 2EYTA 3P4NA 4PR5A 5K9JL 4QRSB 1UACH 3BI9X 2VH5H 4XBEH 4EI5B 1G7MA 4KJYB 5EOCH 1NSNL 4HEPG 1B3JA 3DMMA 4FZ8H 4Z7UF 5IK3B 4MSWA 1EMTH 3QFJD 3LKQA 3NCFB 4PP2A 1KCSH 1OF2B 4XP1L 4P3CH 1WBZB 4EJ1C 2H3NA 1OSZA 4MQTB 3ARDD 4M93C 4MMZC 3J7HA 3K2UH 4I0KA 4R7DA 1XR8B 4LVNB 1JWUB 1T03H 4WJ5A 2Y36H 1YEDB 4XX1E 1A6VH 3OR7B 4FN0A 1I1AD 3IJYA 1IEBA 1C5DA 1KN4L 3IFPA 1GIGH 3DYPA 2AKRA 2UZYB 1GHFL 3BPCB 3WMSA 1HSBB 2F74B 2YWYA 4PFEA 3QA3A 3IU3A 3OKDB 3G5ZA 2DQEL 1Q94A 3MLZL 2ZOLA 1EGJL 1HYSD 4MWFB 1RZJH 3PL6B 1FC1A 5DVOA 4GRLD 1YMME 5HPOA 3MSPA 3BPCA 3JVGC 1UJTA 4IDLA 1U8MA 5T1DL 3W2DH 4EOWH 5JIIA 1EO5A 3C09C 3DBXB 3VRJB 4JE4B 1A7PL 4ETYA 4UU9A 1QR1A 3KYNB 2Y6SD 4Y4KC 4PJ8C 5CUSH 5LGHL 1A02N 1DQJA 2V7NB 3QAZB 5JOPD 5C70A 4EVNB 3SKJL 4MXQC 4WFHD 4XCNA 4U1MB 4CN6A 2EXWD 4KTDL 5H2BA 4HWZA 4UV7L 4NQSA 3FT3B 3BN9D 3CLFL 4QWWD 5L7XH 1BX2B 2FJHB 5GRJL 1JHTA 4OF5A 2ICES 3QZWA 3U0TB 5EZLB 1KIRB 1J12A 4RX4D 1HXYB 3QJFA 1NCBL 3B2UD 3TBYA 2NXYD 3O6KH 1GGIL 3BP7B 5ENWB 2X1WL 4NQDD 3MROA 3N1QC 3MV7A 4TQEL 4GW1B 2E7HA 1ZXQA 1EV2E 4XP6H 1ZGLP 5DUBA 3HI5H 3HI6L 4K7PL 2GTWA 2X6MA 4X5WA 1S7TA 2IF7A 3UBXA 1RZGA 4U1GB 3UPRB 2ADIA 3CFBA 4P2QB 4CNIB 3TZVD 2IQ9L 1LK2A 1FLRH 4KQ4H 3LKPB 4MCZB 4X4YB 5DHYB 3RNKA 4CN1A 2PCPB 2CK2A 1E6OH 4NO3B 5IHZA 4NUGL 3T2QA 4X4ZA 3T1FB 4X83A 4G9DB 5D93C 3EOBA 1BQLL 4XBGA 4YC2C 2CR3A 5BS0D 3FFCE 4DAGH 3C09B 2XQYK 4JFHD 4NBYB 5CHNB 3JUZA 3RWHA 3V4VH 3GSQB 4Z0XA 4ODHL 3KXFE 1U8OB 3H9SD 4PRID 4D0CA 3NCJL 5KVGL 1UWXH 2XN9E 4Q0XL 5B3JE 5KZCB 5D1ZC 5I8EA 4DN4L 1G7HA 3VXOB 4K8RD 2DJUA 4RZCA 1JPGA 3MLXH 1CDGA 1KCRL 3ZYOA 3H6JA 2AABH 2NTFA 2BVEA 3FHAA 5IVZB 5FB8A 5EN2B 3G9VA 2XRAL 3NIGF 5DLMH 5IGXL 4QRPE 4X6BB 4O51B 3HUJE 2BSRB 1YPZA 1VDGA 1MRDH 1LO4H 3L3IB 1QP1A 5EU6D 1CFSA 1WFOA 2NY5H 4HDIA 5J11B 1Q38A 4JN2B 4P9HC 5IBTL 4APQD 2R2EB 3WHXA 1Q0YL 2VTFA 5FYJD 3DUUB 4GG8B 3O2VH 3R1GL 5FGBA 4HMCA 1FCCA 3H9HB 4HUWA 5IJVA 2XZCL 4UT9H 5HGAA 5C0JA 4E41B 1IAOA 2BXYA 3ILPA 3GO1H 4UIKH 2X70A 4LKCB 3BIBX 4JM4H 2GCYA 3QIWA 1KLFA 5IHUL 3EOAB 4Z7NF 3QEHB 1FORH 3C5SB 3DX8A 4RGNC 5C09A 1ZLVH 1HXYA 3RNQB 4F33B 1AHWC 1EJOL 4I0PC 2AXFB 3DUSA 3RL1B 4QOKE 1MEXL 2IH3B 4HW6A 2N56A 1BFVH 4LCWA 3GSVB 2IH1A 4K94H 1C5CH 2AEIT 4XRCB 2UUDK 3UJJH 4JANB 4LAQL 4Y5YA 2V7HA 4KK8D 5FA4A 1PGRB 2XKSA 3K8KA 5BXFB 1CICC 2Q1EA 1U92A 4NZUL 1D9KA 2CDEB 2DBLH 4OZHE 5HHME 2DDQH 1VGEH 5I8CB 2XWTB 1TZGH 4PRAA 1E6OL 3ZLQC 1T03L 1I8MA 4KI5F 2BNRE 1TFHA 2VLJA 1QSFB 1S7QB 1HSAA 2IAMA 1CG9A 5EC2B 2H6PB 2Q76B 5H37H 3AREB 3UYOD 2DQUL 1MNUH 2YS4A 4IS6B 5KANG 1KCVH 2FX8H 3UJIH 1CE1L 2DLEA 2HKFH 1AP2A 1ERNA 4AEEA 1XH3B 1ZHNA 3K7UA 1UZ8A 3TO4C 3VFOB 3HG1B 4H8WH 2NY4D 2Y72A 1YECL 3Q48A 5TF0A 5AEAA 2VDPH 4XWGL 1BGXH 5BO1L 1P4IH 5GJSL 1S7WA 2OTUA 4L4VE 3EFFB 1Q8MA 4YHKH 2B1HL 1EFQA 1MAMH 2FWOA 5KVDH 4NT6A 3BP7A 4OFPA 2ARJA 1RSFA 4LCWE 3QUKB 4K8RH 3C08L 3BKMH 1YYLL 4KJYA 1KIPA 3I84A 4ZOBA 1V7NL 3GHBH 2YZ1A 2DIBA 3SCMA 1D5IH 4LLUA 4QHNA 1JZ2A 2KDGA 4R2GC 5FV1L 5AAMA 1Z5LA 5TF1H 3CPLB 3EYQC 5HYJB 25C8L 3S7GA 5DMYA 2W1NA 4ZUSB 4MAYD 5T5FL 1NC2B 4D9LL 3WLWD 4L9LB 3VG9B 3P0VL 4PY7B 3QRGL 3BKCH 1HQ4B 4OV5A 1MCKA 2CDFB 3TZVC 1JN6B 1CXEA 5ICZB 4EDXA 2RAMA 3B2VL 1Z5LB 3AY4A 3KYNA 4LSVH 5E6ZA 2X4RA 3DYOA 4N0RA 2YKLL 1BFTA 1YN7B 5B39B 3K4DA 5HGDA 1U58A 1QOKA 4LAJH 1A7NL 1I3GH 5ICZA 1I9EA 2L4OA 2RQ8A 3MRIA 3OB8A 5DJ6B 2RCSH 2MFNA 3ILQC 5CBAB 2HFGL 1ZHBB 4MDJA 4MVBD 2HVJB 1MCFA 1XF4A 5T1MB 3LDBB 3OHXB 4TVPE 1NAMB 2X9WA 4WWKC 3JBG7 4U1SB 1PEZA 2I27N 3SKOB 3OJDB 5CGMA 3SPVB 2D7PA 5DRZA 1AD9A 1KXVC 3I9GL 4NUJB 1EFXD 2PW2B 3FFDA 1FPTH 2GAZA 2KUTA 4QXGH 1K5NA 5DZNA 5C0AD 4KZEL 3L5XH 4KK6D 4TULL 3SGDI 3WNNA 1YNKL 1FRGH 3O4LA 1I1RA 1U93A 5FDWA 3KPNA 5ESAB 5HJ3A 3E6FA 1OY3B 3CFJB 2N7BA 4IRZH 3ES6B 2YC1A 1AE6L 3V5KA 3MXWL 5CJ8A 2XN9A 4XCYB 2LTQC 2E7BA 2R29L 5E24E 4L1DA 5E2WL 4CBPA 1J86A 4XXCA 4BZ1H 2VLJE 1R6VA 5I0DA 3TT3H 3UTSD 2MPAH 3DUHA 1UJ3C 1TQCC 3G04B 4OGXL 4XP5H 2W0PA 4G7VH 4LRNL 4I18A 4OZHA 5ACMA 3S88L 3FL7A 4V1DE 2HWZH 3LN5A 4HIJB 2NX5E 3H9ZA 4MNGA 1NCBH 4X4MA 1NANI 5SX4H 2B7DT 4JGMA 3MCG1 3DRTA 5F21B 4PUBL 2QQNH 3VU2A 2IFFL 4OI8A 4Y1AD 4Z7WA 3ARFD 2FR4A 2EIBA 4NQED 3OG4B 4FRWA 3RWCB 1GGBL 4HX1A 4X6CB 3TEUA 2BHUA 4LU5L 4NQDA 5BOZG 1Q9WB 1OLLA 5JQ6L 1CLZL 2VLMD 5F6IB 1QG3A 1QACA 4GKNB 3D2UA 4X5XA 1G6VK 1SQ2N 5DC4B 4AM0A 3F58L 4BSWA 1LEGB 3VCLA 2XQBL 2R2BA 4LNRB 3QYCA 2AJYH 1F11A 4DUVA 4PJ9A 3SKUD 3S5LG 5I16A 1KJ2B 4FQ2H 3MGTB 3MJ7A 1FVEA 4U6YB 4L8SB 8CGTA 5DXWA 2A77H 5J06A 4KTYA 1P5VA 1OGTA 3L3OB 5C0EB 3VD5A 2W9LA 3T0WA 3V5DA 4KK8C 1ED3B 1M7XA 2F58L 3OR6A 4YPGA 3C5ZA 1BREA 4YDLB 4WFGD 4ZPVA 2BVPB 1IGIH 3P73B 4KKNA 5EBWB 1IGJB 1YMMB 3FT3A 2YEZB 2J4WH 4H1LG 3WDJA 5ILTL 3UJJL 1FJ1B 3O81A 4PGCA 4LARH 4RMWA 1H3PL 1PG7X 1YMMA 1ZHKB 3HG1D 3PP3H 2JLLA 3HR5A 4P2OA 4MXWH 4DFHA 2BVTA 4FQHA 1NEZG 2Z4QA 2OL3H 5B38A 4FMFA 3VWKA 4NP4L 1T0NB 2FGWH 4F7EB 3FRPG 3FMGL 3L3GA 4LLDA 4XPTL 5I8KL 3V4PL 5C0IB 4NOFA 1TETL 3GSNA 3KPOB 1OAQL 3IAQA 4NQXB 2Y06H 3R06B 1CVRA 4PV8A 4KZDL 5F88B 1NLBH 3FB6B 3S36H 1JTOA 1BAFH 4RX4A 5C0CD 1BQHA 2IQAB 5D1XB 1E4KC 4JFDE 5I8OH 4M6ML 1AY1H 5GS2H 2JK5B 4PLKD 4O2EA 2X7LB 1M4KA 2AI0L 3HAEB 4OD3L 3W81A 5EBMB 5IHZB 3TBSB 5CP3H 1TQBC 4GH7B 2IPKB 3DOSA 4XNQA 3W11D 4CJ0A 4Q0XH 2HVKB 2FX9L 2BVYA 3O2VL 3R1GH 4P2RB 4OZ4B 4LIQE 3X12B 5T3ZH 1IC7L 3ZDZF 5EUOF 1RULL 4XAWL 5ESQA 2PXYB 4P48A 2X4UA 3REVA 3RWFB 3UTPE 2NY0D 3VA2C 2R8SH 2DD8L 2X4NA 5GZND 3ULVF 4YXHH 1TZHB 3JUYA 4ZTPL 1JHKL 4PD4K 3H0TB 2NY2C 2P4AB 3R4DA 3KPLA 4OCLC 2OL3L 5IMMA 3BW9A 2QQNL 4YNYA 1HHJB 4ODSH 1PLGL 1T7WA 3SKNB 2IQ9H 3TO4A 3MV8D 1N2RB 1L6XA 3MLVH 1JPSH 2FYYB 1GVIA 3QIBD 5DD0H 5C8JB 2VN7A 1I9JH 2WMPA 3IF1B 3JWDC 1DCLA 3ULUH 3VXQB 3GUTA 4V2BA 1DFBL 3JVGA 2Y7QB 1BBDH 1KLGB 5E94A 5TDPB 4LLAA 4OM0H 1Q1JL 4P2CG 3WLWC 3MRBA 5HJ3B 5MERB 5DR5H 4WUKL 4KROC 3QFJA 4X5LA 5BS0B 4FFZH 1O0VA 1JPTL 2D9CA 4DN4H 5JDSB 3QNXB 3JV4A 1MH5B 3UTSA 3VFPB 3FB7B 5HHNA 4PJ8B 3NPSC 4OFIA 2HRLA 3QAZC 5HHVH 1J8KA 2HMIC 1AHWB 3EO1B 3ARUA 5ILTH 2YK1H 1I7TA 4G8GA 1CGWA 2DM7A 2Z9TA 1C7SA 5DMJB 3BZFB 5DHVA 5DUML 4ZXBD 4WW2F 2J2ZA 4J2XA 2CJUH 5ADPH 2P42B 4NQDE 1T22A 2EYRA 1NDMB 1DDHA 5IMLB 1T1XA 3D0LA 4P9HL 2EIEA 1SBBA 4GQ9H 4TUJA 4CKVX 4YHNB 1RY7B 4OLYL 5MENB 1RK1B 3T1WA 2PUQT 1AIFB 2EICA 4HWUA 3V8CA 4FTVA 4KAQL 4JQVA 1BFOA 3D3VE 3BKCL 5HI4D 1JI1A 4MWFA 4LCIH 4LLVA 4ACPA 4OM1L 2XA8L 4NO5A 1LEIA 3MUJA 4FFYH 1OP3H 2VDNH 4PLNC 1MI5E 4KMTL 5HYJE 4S11A 4XCEA 5GJTL 4UU9B 3QDMD 5JW4N 3INUL 1HYRC 5DFTA 1F6FB 3T4AA 4JM2D 1A7RH 1D9KC 3V5HA 2MKLC 3Q2CA 1DQQA 4LU5H 2E7LA 2FRGP 4NQXA 5DMIH 3D0VB 4JFHE 4I18C 3AS0A 3G6DL 4FXKA 1LD9A 4NJAH 3VFTA 1A1MA 1SY6A 4J3TA 5D5MB 4HCRL 3MXVL 5I1IH 3BD4A 4ZSOA 3O4LE 1YN6B 4Z7UA 3NPSB 4PP2B 3HE7D 1I7ZB 2PO6D 3GB7B 3QJHB 1UWGL 3OJ2C 4HUXB 2AV1A 5D2LB 2NLJB 4Y16D 3O3AB 3LQZA 3QCVL 1JNJA 3BN3B 1MVUB 4TVPH 2GYSA 5T1LB 4M7KL 4I13B 1KJ2L 3UEZA 5I66B 4G6FB 1QFUL 3WHXB 5FYLD 2FDBP 2JIXD 4ZUWA 1XGUB 4QRPD 3WJLA 5KVEH 3QR2A 3OQ3B 1BM3H 4GKOA 4U1IA 3KPSE 1MHHB 3WIIL 2WAHA 4MX7B 5DWUH 5H37G 4M7JL 3OF6D 1FVEB 2IALA 4M3KB 5EU6E 5ITFA 5J1AB 1D6EB 2ICWB 4JFEA 4G80B 1TCMA 3NOIA 1D6VL 1I7RB 2AJVH 5C0CB 1F02I 5TQ0H 4BSWB 5CSZB 5D93B 2B1HH 4F7CA 3ZSTA 3ARFA 1K4DA 4ISVB 1QKZL 1F90L 5E8NA 1T6VN 4QXWA 4QRRB 3RX8A 1TVHA 3T3PE 4P5KB 4PRHA 3KR3L 4GKSB 1FJ1A 5BJTA 1VGKA 4OD3H 4LPTA 2PXYD 2OI9B 3MFGB 5FF6B 4RFEB 1QFWL 4UV4L 1H5BA 3MJ9L 2NY2D 2IANE 4DWHA 2UYLA 4RAVA 5T3XH 4B53A 4TPRH 1NGWA 5DVMA 1T6WA 4HXAL 4OZIA 5DD5L 3BWAA 5HXMA 3QCUL 4I0PB 2N4IA 4ONOA 2XPGA 4L3EB 2A9NH 3CX5K 4DCQB 2MJWA 4YQXH 3TH2T 1MPAH 1QSFE 1HEZB 4M03A 3GMMA 3KS0H 1YC7A 3GSNL 1CIDA 5E8EB 2X4SA 2HN7B 4WW1B 2NZ9C 1M6OB 2VXVL 3NH7H 1J8HE 1TJGL 4LGSB 4NRYA 1S9KC 5DVKA 3BT2H 4LSQL 3ULVC 1H3WM 1YEKL 3MRHB 2RGSA 3I50H 1FAIL 4RWYL 3VD9A 4PLJC 1KPVB 2VE6A 3NCYS 4NKOA 3DARA 2AAVA 3VXTB 1JNLH 3E3QE 5H35A 4N90E 4X98B 5F6IC 5IB3A 2XWBA 4ODUB 15C8L 1KXQE 4Z78A 3CLFH 4MJIE 1ZHBA 1MCSA 2F15A 4RGNB 4Y19B 5JMRA 1YEEH 4LSDA 3FAWA 2NLJA 2R1YB 2ZOKA 1D5ZB 1N3NA 2LAGB 1KYOK 4OTXH 4MJ2A 1ZLWK 2B39A 5E99H 5LKNA 2OQJB 1JNHA 2DQTH 1NH6A 3CSPA 5ALCH 5ALBH 3U82B 3MUZ1 4LSTH 4HT1H 2BMKB 1AGDA 2KZ1B 2NNAA 3GIVA 5BVPL 5TPWL 4HC1A 1WWWX 4QRQB 1JYWA 4HAGA 1PG7W 3LD8C 1I9IH 3VMPA 3QIWD 5TH2A 1HK6A 5D8JL 1LO4L 4ZPVB 4G5ZH 4JG0H 4UDUB 4F7TA 5GS0L 5IIEB 3RUGB 4ZD3L 2O61B 1NJ9A 4NQTA 5J7CC 3WE6A 4RDQF 1HYSC 3CK0L 4HH9B 3QZWB 4G43A 1I8LA 2QADD 1CDIA 3TZVB 2PW2A 3E8UL 3FFDB 3NN8B 3PWVA 2WBKA 4HWBH 4NC1E 2X41A 3GSXB 4BZ2H 3JV5A 1MCOH 3IFLL 3MA7A 5HD8C 5JLZA 2F53E 1JWUA 1ZT7A 4XNZC 4DK6A 5FCUL 3VWJC 1ZAGA 2ICEA 4JPKL 5DF0A 5CBEA 3BZ4A 1ACYH 1G9NH 4N9GA 1QPPA 2PF6A 1KFAL 4W81A 4H8WC 4HUNB 1U8LA 1MHEA 4UTAL 3O3DB 4U0RC 4GRWF 1CN4A 1RIHL 1FYTB 4EDXB 1QNZL 1OSPH 5IFHL 2MHAA 1ES0B 1SBSH 1CBVH 5C0RL 2R15A 1AO7B 3OX8A 4HK3J 1MY5A 5EA0H 1T1WA 5LQBH 1BGXL 1F4WH 4M1GL 3M8OL 1LEKA 1MIEH 4LRIC 2ID5A 3FFCA 2DLFL 3VXME 4F58L 5HHMB 2A0LD 4XXCC 4WO4B 1P6FA 3MUGA 3F5WA 3WIHH 4NOBA 5JHDE 2OJEB 2W0FA 3MJ9A 3BH9A 2DQHL 4XRCA 2W60B 3MMEA 3U2SA 1MF2H 1NGYA 4N0CC 1F3JA 1YN7A 1KN2L 4MJ4A 4JRYA 2E5EA 1VENA 2YBRA 5SWSB 4L3ED 4QOKA 4MQSB 3RGVB 4LEOB 3MNWB 2P5WB 3V0WH 1RURL 1DN0B 3ULUF 1ZSDB 1T1ZB 2PETA 4GXVL 4PJHB 2GCYB 3X3FH 1IFHL 3WIIH 5DK2B 4YDVB 3LCYA 3WFHA 1P4IL 5GJSH 1KB5B 4MD4A 3IDIB 3LKSA 1FORL 4OJFH 3FQUA 1QO3A 4HKBB 1UWXK 4NRXA 2DM2A 5DDHB 3WNMA 2HP4A 2VQ1B 1UH2A 35C8L 4NJ9L 4YIQA 3LS5H 3IDYB 1MEXH 2GUOB 4LSUL 5JUEL 1IBGH 1FDLL 2EKJA 2YK1L 1DLFL 2VDKH 4TSAL 2XPGB 3UTTB 1FL5B 5FAAA 5L9DL 1X5IA 2OL3A 1N4XL 5I15L 1WZLA 4PRDA 1F2QA 4PJ7E 4KHTL 1N5YL 1WCBA 1WIPA 4CVUA 2JIXA 5MI0B 4NJAL 4PY7A 3CFCL 1SY6H 3CFKB 4K7PX 1T89A 1P7QB 1KN2H 2EZ0D 2PKDA 3B9KA 3TJHD 2FZ3B 2OYPA 1A9EB 2BZDA 3TN0C 1I7UB 2R39A 2MTPA 4YDLC 3V0WL 3QDMB 3LEVH 5GRJH 1J18A 2XV6B 5EOQH 5JPMA 4POZD 1WAAA 4XWOD 4GRLA 3KJ6L 2YRPA 3OGCA 4ORZC 4LVHC 4X6CE 3QNZB 4QYOA 5D2NE 2E27H 5E6IA 2C1PB 1QRNE 1T0MB 1W8OA 2QKIB 3QT2A 1FFNB 2WQRA 3B9DA 4OZHF 3MLWL 3T4YB 1H3VA 1ZTXH 3IDMA 3HI5L 2WBJB 1MFCH 3WUWG 2CRMA 3KPMA 5EU4B 4JDTH 5F7NC 3OZ9L 1NFDA 2G9HB 4E42A 4R0LB 4WRLA 2CLVA 4HWBA 3QHFL 1VADB 3P73A 4PB9L 4YE4L 1NCAH 4JFDD 1FAIH 3IETA 1VFUA 1U95B 3PGDA 4R7NA 3NFPA 5HHVL 1TJIL 5IQ7H 2R2EA 5F3BA 2LFGA 5CEZD 1UGNA 1Y0LB 4JCMA 5D1ZA 5JZ7C 2HJKA 4UT6L 1DJSA 1I9RL 1RIVL 3OSKA 3U0PA 2YN5A 3P11L 1BIHA 5E8EA 4PPTA 3QDJA 1X6NA 1AJ7H 3KDMA 5D1QB 3T2PA 1S9VA 3DXAB 4POUB 3V7AE 1JPFA 2X44D 4I5BA 3KPOA 2ERJB 1CIUA 4GLRH 2JE8A 5CZVH 2J8OA 3C6LA 2UZIH 3FB8A 4CW1B 5I1HL 1CL7L 4PJEF 5KTEL 4KGLA 4Z7WB 1X5GA 4LVNC 2ZG2A 1A4KB 3MLZH 4PJBE 2ZUYA 1EIBA 2OR8A 1I3RB 4JFFB 3MJ8B 4UDTA 4Y19A 3DLQR 5L6YH 1FVDB 3O2WH 3SE8H 5EZJB 3DX7B 1T04B 3MZGB 3WJLC 1TMCB 1OD9A 1BWMA 4EUPA 1BOYA 3OXRA 2IALB 5A2KH 2W65A 4BM7A 1C1EH 3VD7A 1IEAB 3MOAH 4R0LC 2J1KA 2RJMA 2H9GA 4XMLL 5E9DE 3IU3B 3MJ9H 1NEZB 3D25B 3EJYD 4RRPA 5MP6L 4WDIB 5IVNA 3QO1B 4LNRA 4KRLB 4LLWB 3NIFE 3JV0A 4YHMH 5K33A 2GY7B 4QHLB 5CGYC 1EO8H 3MNZA 3DSFH 1EK3A 3LV3A 1DDHB 5IMLA 5GRVL 2ZUTA 1F5WA 3TO4D 1QFUH 5JDJA 2NTFB 1UB6A 5A16A 2D7TH 1ZA3B 2UYLB 3PV6B 4PJ7F 5I1HH 3L9RB 2ERJC 4N9OB 4ONFL 1EBAA 4JM2F 4M5YL 4MJIB 5H8DA 3STBA 4GUPA 1LK3L 1HDMA 3FMGH 4JRXE 3LQAC 1A6TA 4CUCA 5D1QD 2AVGA 3U4EB 1I4FB 2OK0L 1YDPB 1T5WA 4UTBH 2V5TA 5DURD 1MRFL 4KTEL 1MVUA 4ODSL 1M7IA 1NGZA 3J8F7 3DI2B 1NKRA 3ZE2E 5SWZA 4OLEA 3T0XA 3MA9H 4PBWD 1UM6L 3C9NA 3MO1B 1Z9LA 5F3HB 1XIWA 1EZVY 5BV7B 1MHHA 2BOCB 3VXRA 3BRFA 2EDBA 1AGCB 4BH7A 1FFPB 2PNDA 1RPQA 3H42L 5DHYA 3RNKB 4AH2A 3AU1B 1AD0A 1MIML 1AJ7L 4G3YL 3VDAA 4ZTOL 5CKGA 2EYRB 3GK8H 1U3YA 4I5BB 3U46A 2XTJE 35C8H 2EZ0C 3HC0B 3NTCH 4JREB 4RISL 4X80L 4LSUH 5KJRH 1SEBA 1XGPB 3L7EA 2PN5A 4UTAH 2AXGB 2B4CL 3IFOB 2FJGA 4R4FL 3TCLA 2X4OA 4P2RE 2DYPB 3GSRA 3EYQD 3OG6B 5J89A 5I19H 5D1ZB 4OLWH 2CIKB 1X4YA 3ARBD 1IRAY 4MS8C 3V6OE 5JNYA 2ITDB 4PB0L 4HBCL 3QP3A 3GSRB 2XZQL 1N0XH 4L4TD 1RK1A 4XPTH 1FO0H 2A6JA 4Y5VA 1MCBA 4ZNCD 4MJ5B 4NGHH 3BH9B 1QYGL 3KGRA 4OFDA 4PJHA 3Q5TA 1C1EL 3LSOB 5MERA 2R4SL 3HRPA 2XFXB 1KJVB 1ZT1A 2HA1A 4Q97A 4XC3L 3BUTA 5LJYH 1DN2A 5FM8A 3B83A 3GUTB 4WGVB 5I76A 4MNGB 5ETUB 3NZHH 5F6HI 3VWKB 5CMAA 4NT6B 5KSAB 3IXTB 1PSKL 4PRHD 4PJGA 5C08A 5EA0L 3IDXH 5GJTH 2A83A 4NQEA 1MHPH 1IILE 3CLEH 4BSJA 3CC5B 3MRDB 4UNTA 3OV6A 4TULH 5DHVH 3BZFA 1JFQH 1F6AB 1W0VA 4Y88A 1H3GA 4N0YH 1RZ8B 4Z7OF 3AAZB 1I1YB 2AABL 1FCGA 1H15B 1E4XL 4GQ9L 2CKBH 1JMZA 3EJZC 3EOYG 5K93A 1I7TB 3NA9H 1Q9LB 4RFNB 2OTWB 3PQYB 1AFVH 5HGBA 2FSEB 3C5ZB 1YYMH 1A47A 2BOBA 5EIVA 1BQHG 5TE7L 1K8IA 3DROA 2P1YA 3G5YB 5KSBA 1A7QL 1J0IA 1QLFA 3PQYE 1ACZA 1CL7H 4PLKC 5KTEH 1P7KB 4WENB 1V7ML 4AZ8A 4JHWH 3W0WD 3EUUA 3BKJH 5DT1L 4R97B 4PJIB 3HMWL 1DN0A 1CD1B 5FKAA 5TDOA 4K3JL 1PQZB 2FL5B 4GJTB 2D7NA 1JZ7A 2FATH 1XIWC 3G6DH 3QEQA 4H20H 4KK5D 3AREC 3P0YL 5INDB 3HS0B 5DC9B 3ZKNC 2YA2A 1CBVL 4PGZA 3FO0H 4K8RL 3T8XB 1D5MA 4FQ1L 5IMKB 1VFAA 1XGYH 1PQZA 2FL5A 1KLUA 3BO8B 1PYWB 3QDGA 1MELA 4EUPG 5C08E 1MCLA 6FABL 2Z0BA 1ND0A 2CIIB 2FO4A 1JGVH 2J6EH 4KC3B 4L4JA 3TA3A 5DK0A 2CXGA 4E5XA 5K59E 5D7KD 3S35X 5HI5D 3NZ8B 1MUJB 2AEWA 1A4JB 1G7QA 4O2CA 2IPUK 2DQHH 5JO5A 3P3YA 4JY6A 3N9GL 5F89B 3SDXF 3IJSA 4PBVC 1T0PB 4J23A 2F19L 2YMXL 1JK8B 2HRPL 3QEHA 3T2NL 1HHIA 2FX7L 3NIGE 3X12A 3EJYC 5DO2C 2FJGB 2XXMB 1ZLVK 2C3WA 3UROR 3TN0B 4GLRI 3VD3A 4MVBC 5F1IB 4MNQD 5E8PB 4Q6IA 3LD8B 3OKEA 1BECA 2HTKC 5E1AA 1S7RA 1BHGA 4D94A 1MLCA 1VHPA 1MFAL 1KGCD 1QLRB 4ZS7L 2A9NL 3P9WB 5IVXB 4OJFL 4P23D 1V3KA 1DANT 2H2SD 4WHTA 1NMCB 4WFFE 1U8OA 4PV9A 3OKYA 4HKJB 4N0UB 4R97C 1UCBH 3C6SA 3PP3K 5I30H 1FFNA 1OB1A 1OAZH 2A74A 1NDGA 3MV01 5B21A 5I8CA 3LDBC 4WWKB 4W68A 5DD1H 3CLEL 4YXKL 2P46B 4OI7A 5IW3A 1KNOB 1I7ZA 2CK0L 3O6MH 4ZAKA 5KVDL 5C6PB 5I6XB 3RWDA 3PJSB 4M9OA 3C6SB 4GXUM 5FO9B 1MFBH 1IM9B 4OFYD 4S1RL 3IRPX 3LQZB 1ORQB 1JNNL 4LLQB 5GGTL 2VXTH 3BGAA 4JFQA 3WN5C 5IQ9B 1SMAA 3BP6B 5I8EB 2WIIB 4MQ7A 2GITB 2Q8BL 4TNWF 3BESR 1MAKA 2ZUUA 2CDFA 2A6JB 1QR4A 1M1SA 4U1MA 5GS1B 5JPNB 3ZT5A 1VACA 4FXKB 3ES6A 5KVFH 2BVOB 5L8LB 4MNHB 5DJ0A 5DSCA 2GT9A 2DIJA 5IB4B 2EDKA 1FH5L 3STLB 3MRFB 2ICCA 4RDQG 3FQTA 1CFTB 4RGMB 1UZ6F 3QUZA 1U8LB 5DJYA 4NYLA 4O2FA 4L3EE 1M7DB 2EC9T 3MROB 3GMPB 2LV4A 3RWJB 4FFVD 5J8OA 3DVIA 2Q20A 4PJIF 5AZ2L 2CUHA 5F1NA 2V9TA 3VFOA 4DZ8A 1S7TB 4K9EL 2D3VA 3D0VA 3OJMB 1YEGH 4LASH 5GISL 4WI2A 4HGWA 4UT6H 4QYOB 1G7JB 2AXJA 3X14B 1IKNC 4GW5A 1P9MC 5FXCH 5DR5L 1UFUA 1JHLL 4U31A 4I1NB 4LEXH 1VCAA 2ZCHL 1MI5B 3QISA 5ABDE 5SWSA 3WXWL 3CFIC 4JO4L 4ZPTA 3FTGA 1NFIA 1A6VL 1A8JH 4QRPB 1JGLH 4YHIA 1R5WA 4RA0C 4G6FD 1E4XI 1ZS8A 2R9HC 2J5LB 4HJ0D 3CMOL 5D2NB 1IM9D 1IAIH 4JAMA 1JE6A 1UH4A 4IRJC 4EXPX 4X8JB 5C0DB 4YHYB 4G8FB 1P2CB 4MB5A 3SE8L 3KXFA 4F57H 3QQNA 3L5IA 5HPMB 1EH9A 2AK4E 5JXAL 4GSDL 4U1LA 4HPOH 2V5MA 5LBSL 1AFVL 4L5FH 4M93B 3EFFA 3MV9E 3VRLF 3AREA 2W07A 4FG6C 5FOBB 4NM8H 2FBOJ 4PG9B 4AEIL 1TNMA 1TDQA 1X44A 2C4FU 1ZHNB 2R56H 5J13B 2DTSA 4GBXD 1JPST 2W59A 3M17A 4FQ2L 2Q8AH 1A7OH 2BJMH 3GMLB 3UTSB 4PGJA 3WNPA 1A9BA 3TJEH 3EDDA 1FE8L 1OAXL 1ROWA 2LE9A 4DKEL 1RUAL 5F9WB 4CAGA 2OMNA 3PDOB 3RVVC 2BHZA 1TQBB 1HQ4A 1RUML 4G9FB 4U6XB 3GJFB 1VACB 4YXHL 4DKAA 1OGAB 2AK1L 2HKHH 1S3KH 2X4RB 3MUGB 3QUMA 1A1OB 2VXQH 1DBJH 1F97A 3B4NA 3CSGA 4PJ5D 2YOCA 5EPMB 4RGNE 2JF1A 3ALXA 3WKNA 3CVHL 2B20A 4Z76A 1XGQA 4ZXBB 3RUGE 1A1OA 4QXUL 4Z77B 4KQ4L 1S78C 3MYJA 4M7LL 3LPFA 4IRJB 4MHHG 3SDXA 3WFZA 1IM3A 3QCVH 4OM0L 3OXRB 1KTLA 2ED7A 3ARDC 5F88A 3NFSL 1UZ6E 1CZ8L 1WISA 3EOBB 4XBGB 3PV6A 3S36L 3VXUB 3O3UN 4ZAKB 2KL6A 3MRJA 2OZ4H 5LVEA 5ERWA 2ED8A 3DX9A 5KVEL 5GIRA 1HH9B 2VDQL 2D7OA 3GO1L 2P8LA 3O45B 1AGBA 1MWAB 3GMPA 3HMXA 1ZLWH 3TNMB 5C0RH 3DHJA 5C07D 3SY0B 3HZKA 4IRSA 4HUMB 5EC2A 2HG5B 3VD4A 2AEPH 2DI9A 5L9DH 3I3BA 3O8XD 2WWKT 3KPPB 5E2UL 5A16B 4EI5D 4RBPK 1U3ZA 4YO0B 1RJLB 3TBTA 3RAJH 1WJ3A 1KCRH 2BVOA 3WDHA 5E8PA 3K4ZA 2O5YL 1MRCH 4Z7QE 1JF1B 5GZOC 2Y5TA 4YHPB 1KULA 2XN9D 3FO9B 2AJUH 5DRWA 2F54E 1T04A 1MH5A 1C5BH 4LL9A 1ZANH 2JB5H 4KK9C 3JTTB 5DZLA 2W9DH 4GSDH 1MQKH 5CIPH 1N3NB 2AXHA 4NGHL 1LNUB 2VITA 5DS8B 3OKMB 4UINH 3ZSSA 5F7DA 4YWGH 3EFDL 1D3CA 3VXPB 5A3ID 5DI8A 3RU8H 1EBPA 4C83B 4RFNC 1DLHA 3C9NB 3GKWL 5DK3A 4ZFOB 2X5PA 1OWWA 3LRGA 2ARWA 3E2HB 2Q7YA 4HWEH 5IBUB 5JHDA 3TWCH 2EE9A 4LLWA 1JRHI 4ZAKC 4XCCH 1QQDA 4LQFL 1VERA 1IT9H 4Q74A 2H9GB 1S9WA 5BO1H 4ZO9A 3I75B 2X9XA 4XZUA 4PY8J 4AIZB 3G08A 2ESVE 5C0FA 3F7QA 4P5TA 1NBVH 3OKDA 4PRPA 3PE9A 3RY6A 2FD6L 5JIKA 5I16B 4X6FA 1A3RL 3A6CH 4G6KH 5DZOA 3GI9L 4OD1H 2ESVB 4M6MH 4ALAH 1FNFA 2EYSB 2QQLH 5F9AC 4Z7VF 3WFDL 3TIDB 1WBZA 3SO5A 4N1HB 3EAKA 4O51A 2GTWB 4XMLH 2Q87A 4OZIE 1XR8A 4KI5D 3HC4H 4RA3A 1P4BH 1KJ3L 2DWDA 1IM3B 1QSED 1OPGL 4PJGE 4LMQE 1A6UH 1F3JB 5I1JH 4FQIL 3FB8B 1B88A 2ZUQB 4BH8B 1JZ3A 4J7RA 4NQEB 5FO7A 4HS8H 2E27L 5J57B 3PIQB 4PJDF 3UTTD 4I4WB 1XAUA 3U0TA 4DN3L 5L6YL 3GB7A 2F54B 3QJHA 4ZO6A 3QWRA 4OLUH 3T3MF 3RP1A 2ZNWA 3ZTNL 1QBBA 1KV3A 5DC0A 1A3LL 4OUUA 4ISVA 2V2XA 5HHMD 3D85B 2PTUA 5AZEH 4LHUA 4L3AA 1TCRA 1CQKA 4M02A 4NQVB 2EE2A 5CWSB 3ARBA 4NSKA 3RZCB 4JFFA 4JFEE 4HWNA 2ENYA 3A6BH 4DQOL 5F3BB 1G9MH 4HF5H 1QFOA 4L5FL 5DJAB 5C2UB 5M94B 4QF1B 1YEIH 1OAUL 2VXUL 4CGTA 4ZS6C 4U6HB 4M3JA 3MREB 1CDYA 3W5MA 1ADQA 5C09D 3B8YA 4LFHG 1FGVH 4K9EH 4NDMA 4PLJD 4JPKH 1CWVA 5EZIH 2IBBA 3BISA 3N85L 5IMMB 1ZGLB 3PGCA 2EEDA 3VWKC 4XVUD 3SJVD 3QZWG 2M8XA 5DHVB 2NW3A 5I1JL 5DFWH 4YJZL 2CRYA 4GAJH 4HUVB 4MNQB 1U42A 3PQYA 3QRFM 5I1GH 4YX2L 1GC1C 5FUCC 1T3FB 3BPLB 2RFXB 1AGFB 1UZ8B 5JNYB 4YO0A 4NQCD 3RVTC 4KI1A 4JG1L 1WV7T 3RU8L 2O61A 1IQWL 4EQ3A 3I02B 4F7PB 1NC4B 5ELIA 3EOTH 4DK3A 1EHNA 5IEKB 1U58B 1PKQB 4BFIA 5HPMA 4Z7WF 5FK9A 3NZ8A 1JGEA 1HQRA 3ARGD 4R4BB 2EYTB 3P4NB 4PR5B 3PABA 3LZFL 4P49A 4H1LH 1CICD 4CDGC 3REWA 3HPLB 4MLIA 1K4CA 2MSPA 3VXSD 4OCYL 5HYJA 3DRQA 3QO0A 4OF6A 4PLOB 5F96L 4ZQKA 3WS6C 5I1EL 2DQJL 3LB6C 3JZ7A 4YDIL 5JXAH 5HYSB 3REWB 5ICXA 2DTMH 4YLQT 4UV7H 3CH1A 4JY4A 2GQHA 4JFFE 5K9OA 3IFPB 4JEGB 4WCYL 2IANB 3DSFL 3MYZA 4AEIH 4JY5L 3QH3B 1Z9SA 5C08D 1G7JA 1X7QB 5L8JB 4LSPL 1FNSH 4U1KA 3NZHL 3VWJB 2VWEE 5DD3H 3WFBL 2DKUA 4XNXH 5D7KE 3B8SA 4XI5C 3LRSA 4A2MA 2IPUG 3MNVA 4HK3N 4Z7VE 4MJ6A 3C8HA 4GMSL 5D9SA 1TVBB 1WWAX 5FEBA 2V2WA 4JQIL 2WUBH 1ZHLA 5AG9A 1SEBB 1XGPA 3BIAX 2W60A 1MRCL 3U2SB 2W92A 1DUZA 1NGQH 2DMCA 1MFEH 4PJGF 4HS6B 2DQFB 3HTLX 5JTWA 5LGJB 1UXWA 3NCEB 1L7TH 4KKBD 3F7YB 2BSED 3REVB 2D9QB 2X4UB 3C5ZC 4RGOL 4KQ3H 3V6OA 4BK5A 3KPTA 1S7UA 5TQ0L 1RK0B 5SWQA 4IRSB 1LP9E 3UTQB 4OZIB 3IKKA 3HB3D 2FHCA 1DQDH 1RMFH 2VL5A 4R96B 4G8IB 2PYEE 5F3HA 4H26A 4QF1A 2V5RA 1KT2A 3ZYZA 1K3IA 3TA3B 3RUGA 1FNGB 2A6IB 3BP4A 4MA3B 4Y1AE 3HFMH 4U1LB 2NY3D 4A6YA 3F7VA 4OUUB 3TJEL 3AGVA 2V2XB 3IF1A 4XGZB 3C5JA 1SJEB 3N85H 3V95A 3SOBL 1TNNA 2ZCHH 1NFDF 1FLTX 5KJRL 3KWWA 3C8KB 5JIPA 1ZA6A 4JN1L 4WI9A 4HV8A 5DJDA 4ZDHA 4W4OC 2X1OA 4PYHA 4KJPD 2WBWB 3SDAB 4U0RB 4O2CB 2YEZA 5F9WC 1UENA 4NKOB 1BMGA 5DJ2A 5I6XC 2XA3A 1T21B 2BX5A 1QLEH 5SWSD 3AY4C 2X1QA 4JHZA 4IIQA 2PTTB 2MHAB 4F37K 1YYML 1CLYL 4JRXA 1S8DA 2APWA 2FGWL 4Z9KB 5IBLD 5KSVA 1DQDL 1RMFL 3WV0A 2R69H 3MZTA 5K9KB 5EFIA 1XEDA 5JW4M 3FOLA 1JWSA 4ELKA 5DD5H 1QHOA 2YD3A 5HDLA 4PY8I 1AXIB 4HS8L 4FG6D 2HAZA 1ZT7B 2YD8A 4HKBA 4CMMB 4NHUA 4YDKH 4TTGA 1W8NA 4EXKA 2VYRE 3OAUH 4POYA 4JHAL 3S35H 2R56L 3LIZL 1RV6X 1U8IB 3KPRA 1KOAA 4X6CA 5IEHB 2IPTH 4M6NL 1WAAE 2DMKA 5K9QI 2Q7YB 2X1XR 2ZKHL 3ZDXE 4ONHB 4XMPL 1S9XA 1DE4A 5E9DA 5CD5C 4PJAF 4J6RL 2CD0A 1IAIM 3UO1L 1BFVL 5JW3H 1CTNA 1IC4H 5E8OA 1LE9A 5EU7C 1CE6B 5E9DB 3GHBL 4RNRB 5HYFA 3W9EA 2FZ3A 5T3XD 3VMOA 4UB0H 1A5FH 1HI6A 4KPHH 4OIIH 3DMMD 4L29A 4ZOEA 4M6OL 3CZFA 3BW9B 4JO3L 3LEVL 2R69L 3BEVB 3P4OA 4G7YL 4OKVB 1NANH 1YEEL 5SX4I 4NZTL 2VLLA 2EXYC 5IROC 4JJHA 4CL7A 4Y4KB 3R0MA 2X4QA 1K6QL 3E8UH 2VZ3A 4FQPA 3MV7B 4ZAKD 3T09A 1IAKB 1BD2B 1YQ2A 3BVNB 2KQNA 4XXDA 4LSSL 1ONQB 4FXGA 2D4FA 5EG6C 2VE6B 3HAEG 2P49B 5D1QC 3RY5A 3BH8B 1A1NB 4A6YB 2R2BB 1RZ8A 4BFBD 2B0SL 2ICWJ 3ZTJH 2ZPKH 5T1LA 5DRZB 4JKPL 5I9QB 1DQLL 3SQOH 4LVHB 3GIZH 1MJJB 3CFDA 3GBMH 4NQDB 5DDHA 5EBLA 5HYSG 4OAWA 1UKQA 1YQVH 4HIEB 4Y5VB 1H0DA 1A3RH 4O02L 1RIVH 2VABB 1D5IL 4OUOA 2WBJA 4U1GC 2OR9L 2EDTA 4OIAA 3BIKB 4M43L 5H94A 3S37X 5AYUH 4XGZA 1B0GB 1B0RB 3HC3L 4Y2DB 4FQIH 2E9IA 1MQKL 1H8NA 1QRNA 2XZZA 3MLUH 3SBWA 4Z8FL 2WP3T 3O11A 2WNGA 5D6DC 5BJTB 5EU3B 1B0RA 2APTA 4QCIA 4ZNEA 4H26B 4RGND 3KPLB 4LLYA 1QRNB 2EDYA 1U3HB 4HKZB 2ZUQC 2HJFA 2ZWLT 3MBXH 1KENH 3Q6FA 4AQ1B 3Q5YA 1MSPA 1A6WH 1AXTL 4NO3A 4PJDA 1IL1A 1ZT4A 4JFPB 2VLKE 5MHSD 1IT9L 3O6LH 3AMLA 5FOBA 1OF2A 4G6AC 4A2LA 5DMIL 4XTRD 4TNVF 4XPHL 3EDKA 1MY7A 5JR1L 3D25A 5KW9L 5ISZD 1JYNA 2HFEA 1R3JA 1WCQA 2EDXA 3W39A 2HJLA 5CBEB 3JWNC 4BQCA 5L2KE 1WAAF 3FO2A 4FZEH 4MB4A 2FIKB 3GI9H 4OD1L 4UNVA 2L0DA 3QI9A 1ZLUK 2GJ6A 1J0ZA 1MRDL 3QXUA 5HYSA 2AP2A 2R23B 4RIRB 4KROD 3AC0A 2Q8BH 3RPKA 3QUXC 1NSNH 1W72H 3THMH 3AM8A 1EGJA 3RVWC 1JK8A 4JN1H 1U8KA 5JOFB 3EBAA 5LXGH 3BUYA 2UV3A 3P9LB 1YEJH 4C83A 1IJ9A 1UKTA 1NUFA 5FA4B 4C4KT 2BSSB 1S7XB 4JRYE 3ZKXC 2EIZB 4OD2B 1H3PH 1CU4H 3GSOA 1GIGL 3PP4L 3LZFH 1L6ZA 5IW1A 3O3BB 5IOPB 3IKCA 4L4VA 1U3HC 4X4ME 3QFJB 1DQMH 3BP6A 5CSGA 2Z91B 3V5KB 3QDHA 5FKPA 1JPFB 4GAYA 5AAWA 5F96H 3VJ6B 3VDCA 1FO0B 5EOTA 2UWEE 1GH7A 1Q94B 4ODVH 4DAGL 4HK0B 5I73B 4NNPH 4P0DA 4J3WA 2PYFB 4NFDA 1ADQL 2Y25A 5FO7B 5IBLC 4TSBL 1IE5A 4XI5D 3ZKMD 4WTXA 2VLRE 4RMSA 3ARXA 3M45A 1M71A 3NFSH 1HOCA 3Q5OA 4TUKH 3LPGA 1W72L 1Z6JT 5I1LB 3HC3H 4QHKI 2ESVD 3ROLB 2PXYA 4UI2A 1G6RH 4F37F 1WT5C 1PFCA 5SWZB 3TPUB 5DGRA 4NN6C 1R24A 3B43A 2VZSA 5JPNA 3ZL4L 1KTKE 5TPWH 5T3ZD 4N8VB 1Z2KA 3DGCR 1XGYL 5MEND 4M1DH 1IAIL 2FEDD 5GSVA 3FOMA 5DSCB 4UBDC 3MACL 5KSAC 3LKNA 4PJAB 3RVUD 2VOTA 3TO4B 5GRUL 3ESVF 2BY0A 1V3LA 1I7UA 1XF3A 1AXTH 1AQKH 2PO6C 4P5KA 5CD3A 2LU3A 4PJEE 3GGWA 5CCKH 4BQBA 1F13A 3KYAA 2X2YA 3WIFB 3SJVA 3MRBB 2ENSA 3E2HC 4HPYL 3VFSB 5LGKA 3BDBA 3V9FA 5HDQL 5HGAB 5C0JB 1KPVA 4EIZC 2H2SC 4IOFD 3LY6A 4UINL 4KKBC 3T4YA 5ECJE 3QCTL 1IGJA 1RJCA 3EYUH 1OCWL 4QGTA 2LQRA 2IADB 3OWEA 1I7RA 2ILLA 4KGJA 1F4HA 4KY1L 4JZJB 4X99A 2OXGA 5BRZB 2M2DA 3P0VH 5D7LD 2WLYA 1CLOL 3ELAT 1KPUB 4PGCB 3BP4B 4MA3A 4Y4HB 3RAJL 1RIHH 5C0AA 2AJ3A 4ZO7A 3VDBA 4JZOA 1REIA 3WUWA 1AGBB 3PHSA 3AS1A 2G60L 1NAMH 2CDGA 4XXDB 1M05A 1E28A 4QXTA 4CU7A 4DCQA 3GSNB 3RFZC 3ZHDA 1YY9D 1MJ7H 5IW6B 2CIKA 4Q6IC 2E9BA 3IJSB 4NZUH 3ABZA 5I19L 5IFJA 1SVZA 2DBLL 1RZKH 2WANA 4O5LL 5F6HJ 2QBWA 1A4KA 4WU7B 4Z7NE 3SDDC 4BQ8A 3IFNH 1A7PH 1DBML 2Z91A 3MOBH 1OTUD 1OARL 5F7DB 3KHOA 1CGTA 4UOW0 3ULUL 3D39D 4LSVL 3AS3A 2YPLE 4QNPE 4K8RC 4ELMF 1FNHA 3UYRL 3VFUB 4NC0B 1CZ8H 4G6AD 2GEEA 1B4JH 4K3EL 4WI7A 4ZOCA 3PWPD 5FCSH 5DQJB 1CGVA 5E8NB 2CR6A 2VITB 1WTGT 4NQUA 3RY6C 1A9EA 1FBIL 4YDJA 1JWMB 3SE9H 4UIMA 2IANA 5BCAA 3VXSE 3FT2B 1XGQB 3TV3L 4ZXBA 1KYOJ 1WEJL 3U7WH 1TQCB 1L9MA 1QNZH 1WFUA 5CEYB 1OP5K 5KSBF 1K4DB 4IJ3B 2IWGA 3BKML 2G2RA 4MLSA 1OT1A 2J6EL 4WI6A 1E4JA 4LNVA 4JVPA 4DEPB 3JWOL 1GAFH 5EU4A 4G8GE 1PKQA 3IDJB 2YSSB 3MRJB 4S1DC 4K94L 4PJXB 5F8RC 1WIUA 5FHBH 4HFWA 3CFEA 4PGBA 4R4BA 4KVCL 2VLRB 3SGEH 1BZ7A 4FQJL 1AGFA 1IL1B 1X5HA 1WZ1H 3LMJL 2CO7B 1Q9LA 3WHE0 3SGKA 1NC4A 4WTZA 4J4PA 2O93L 3SDDB 1U93B 4MXVF 4XC1H 1H3UA 5FDWB 4BJLA 2RBLA 1U8JA 3KNBA 2G5RA 3QNXA 1DR9A 3STZB 2W9EH 2VDRH 1P53A 4MDJB 3OAUL 1UVQA 4JKPH 4PUBH 1ZT4B 2OLDA 4W6YB 1OP3K 4ZFGH 3ZKMC 2DQUH 3EOTL 1T83C 4OCSL 4PRBA 3AU1A 4Z7UE 4WO4A 1BOGB 1FRGL 4PJ9C 3NCMA 1HKLL 5CMAB 3VXRE 2X09A 4MMXC 3MJ6A 1FGVL 3MO1A 4HGKC 3V52H 3U7YL 1RIUH 5FIEA 3MXVH 4IJ3C 4YGVB 2EDRA 3CX5J 3IB4A 4XPBH 4OCYH 3KPQA 3UC0L 4Q9QL 1IZKA 4JANA 2ITDA 2QHRH 1UM4L 4ETQB 4LLUB 1RK0A 5SWQB 1V3MA 5IWLC 3SDAD 5IKCB 1G6RL 1CDJA 1Q9KA 2F5BL 1JGDB 3G6JB 4IRSD 2VN4A 1H3TA 5I1AB 3D3VA 4S1QH 4PTUA 4Y2DC 1RUAH 4OIBA 3QXDB 4YK4B 5IB1B 4OLUL 1BBJA 3B5GA 2VLJB 3VG0H 1K2DA 4F7TB 4N0UE 3BWUC 5F7KC 1H5BC 1FZKA 1KCKA 3JWDL 3WNOA 3AFLA 4N1CA 5GS1C 3S34L 4R2GD 4JKMA 2GK2A 1GGBH 3UBXI 1HCVA 3O6FD 4PREA 1G7LB 5HGGS 2HMID 4OKDA 4HIHA 2WUCL 3CZFB 2PXYC 1UCTA 5KG9B 3FONB 1UM5H 4K3HA 3SGEI 2R0WH 1W72A 3T3ME 2J5LC 2H41A 3ZT6A 3L3KB 1MJUL 2D31B 2NY4C 1LO2L 3HNSL 1QR1B 2NXZB 3DVGB 4OZGF 5E7FA 3ZKSD 5I76B 2Y07H 2P5EE 4YXLH 5FUOH 2F58H 5GHWL 4ZFOA 1ODAA 2Z4QB 4Y2OA 4OCWH 2IBZX 4WO4D 1GOGA 3BHBB 1CGUA 4XVJH 1JNNH 2LAAA 1QBLL 4PV9B 4X7TB 4WUUA 5DQDL 2P24B 2AEQH 1I75A 4JFEB 1OM3L 1J0HA 4Y8AA 4LSTL 1F8TH 5E6YA 1KTRL 5JOPE 2P5EA 1TZHA 4TUJB 4YHNA 3TLRA 3DXAD 2Z8RA 2X89D 4BFIB 5J13C 4HMEA 1NBYA 1K8IB 1WCBB 1XZ0B 1QBML 4YNYB 4NKDB 4MXWL 5TGBA 2RB8A 1ES0A 1HHKB 1I1FA 3STLA 1IM9A 3IJHB 2BXZA 5E7BA 1OQXA 1PEWA 1A6WL 3JV6A 1PKQE 4PJ5A 4EI6B 4XHJC 4NQCB 2ZSVB 3MLVL 1GGUA 2AJXH 4ZUTA 5KAQG 5D2NC 3OR6B 3QB7C 2PTVA 1BAFL 3IDNB 1HWGB 3GSVA 3LRHA 3CDYA 2X89A 1NGWB 4NUJA 1CFVL 4AENB 3V52L 4Z7WE 4C56B 1S78D 5BRZA 4RNRA 1U8NA 5T5NF 3MX0A 4XVSL 1GC1L 4O4YH 2AJYL 3EOAA 4HQQH 2NY4B 3PJSA 3KLAB 4E42B 2FEEL 1ZSDA 4YHML 5GGTH 1RHHB 4XVUC 3K46A 1NLDH 4KH2A 3CUPB 4JGJA 2IG2L 3HZYA 3HKFA 5BVJA 4XNXL 3L3JA 4LHUB 4LPXA 5J12B 1V05A 4NKMA 3TO2A 1NC2D 3QO0B 5BW7A 4OZFG 2JJSC 4LDLB 3V79C 1BVZA 1FL6B 5FM5M 3F5WB 4Q9BA 1VA9A 3UX9B 3MYJB 4N0FB 4ORGA 1T7XA 1NBQA 4IOSD 4BUHA 4UUJA 4BFGA 3G5VB 5AD0A 1MJ8H 3U30B 1TENA 4NPYA 5B8CC 4D0BB 4NZDA 5D6DA 4OGAC 4PRNA 1NCWH 3BQUD 1HHGB 2V6HA 3FCTB 4NP4H 3VXUA 3RA7L 1UM5L 2PTTA 3VWKD 2KPNA 3M07A 5CIPB 3I3DA 4QTHA 5HSFA 1UADC 3X17A 1DVFD 5F97E 4MJ6B 1BQUA 3WXVH 4XBPA 4WFED 2R29H 3ALWA 5J3HD 4DFIA 3GSWB 1QQDB 5MHSE 1JMXA 1HSBA 4FABL 4ERSL 1CXFA 1FSKC 2VKWA 1NAKL 2NXZD 1KTDA 1HH6A 1CGYA 4HIHB 3DROB 1L7IH 3A67L 3EJJX 3LQAH 1A2YA 4NWTH 5GXBB 4JZJC 1LDPH 5E6IB 4HWZB 3X13A 2HWZL 1WQVT 1I8MB 3VXMB 1YA5A 5E0QA 2BNQE 2FJHA 2P45B 5HHQB 4J1UA 4QGYA 4YFDB 4YBQC 4MD5A 4F7MA 2NY5C 4GG6F 2DLFH 3MRNB 4HCRH 1IZJA 4APQB 5DRNA 3DVNA 4KJQD 2DQIH 4XCNB 1UWGH 3B6SB 5KSAD 5INDA 4DUWA 1DBJL 1EEZA 4L3CA 3NAAH 2XTJD 3ARYA 3CXHK 4NHCH 2JCCB 4G42A 5FYLH 1DQQB 1B2WL 1HXMA 4AJ0A 1GAFL 3CVHH 1XGUA 3WDIA 4ZUUA 4Y5XC 3OJVC 1XF1A 5ANMA 3FONA 4DVBA 5LBSH 4JREC 2BRRH 3WXVL 4I3GA 1HXMB 5E1HB 3P9MB 1IGFH 4JHAH 1FIEA 2AGJL 4WEUD 3SDDA 4NKDA 2ZUXA 3NCYP 1T2QL 3UZEA 5B38G 4M8QB 5GS0C 3Q3GB 1T89C 3EO1A 2AXGA 2HTLC 4Q58C 2GW5A 1AD9B 2VAAA 3VRLE 3KS0J 4YEEA 2BNRA 3MCLL 4HJGA 3BFOA 3FJTA 5GQBA 5I18L 2AQ1A 4PB9H 4I3SL 3FO2B 1BVLA 5I1CL 5ACZA 5B4MC 4PG2A 1WGOA 5E6IC 1NFIB 5HGDB 2X4OB 4I3RL 2YBRB 4ALAL 3QNYB 5ID1B 4QOKB 3S5LB 1LE5B 1C08B 1FVCB 1WBXB 2F53A 4UZGA 2ARJQ 3CNKA 3TA3D 4CU8A 1A7BA 1CD8A 4BKLA 3U46B 1S9YA 5DJXA 5E2VH 5IG7B 3RZCC 4Y1AB 1RIUL