2A77H

Anti-cocaine antibody 7.5.21, crystal form ii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
219
Chain Sequence
b'DVKLVESGGGLVKPGGSLRLSCAASGFTFRNYGMSWVRQTPEKRLEWVAAISGNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARHDDYPYFFDVWGAGTTVTASSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin Light Chain
molecule tags Immune system
publication title Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21
rcsb
total genus 47
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2005-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77H01
4I3GA 3P30L 3C8HA 2XA3A 4RQQA 2VDMH 2X4OB 1RFDL 3HAEB 1NMAL 2FJHA 2A9NL 4JFFB 4UTBL 1Y6NR 4LLYB 3SE9H 3VGFA 3HI6L 2Q7YA 4P2OC 4NWUH 1YEHH 2NCMA 4QRSB 5D7SL 3QG7L 4PLKC 5CD5C 1Z9MA 1WEJL 4ODBD 4R7DB 4K9EC 3KYKL 4DVRH 1LO3H 2BVEA 5CCKH 5JUEH 1BAFH 1TCMA 2HVKA 3KXFB 2BDNL 1GIGL 3ARFD 1RJCA 1BM3H 4GKSB 3MLUH 4P59H 1FL5B 4LCWD 3F7VB 5HYQA 1MHPL 1DEEA 5TH2B 3WNLA 2FX8H 5LJYH 5DZOA 3FTGA 4LRNL 1G84A 3MLYL 4QRUB 3QQ4A 1JTTA 3CMGA 5ADOH 1WGOA 4QWWC 4XNUH 3T65B 2AV1A 1TITA 3O41A 3IAPA 1PSKL 4YFLF 3GUTA 5GS1C 4QXUL 1U6AL 1PKQE 2LTQC 1KIQA 4P2RB 4U4BA 1HH6A 3RVTC 2AJZA 2IADB 3LKPA 1IAIM 4M8QA 1Q9LB 4J1UB 3HLAA 4IJ3C 5GRJL 4N9GA 3HZVB 3ULUD 1CXHA 4WHTA 3IS0X 5DJYA 4X8JA 4G42A 4OZFB 5DEFB 5J13C 1WC7B 1N5AB 1RZGB 1KC5L 2VLRE 5TDPB 3J7HA 5EPMA 4F7PA 3W82A 3MBXH 3CZJA 3VFSB 2Z0BA 3O0RH 5F6HI 2VKXA 2YN3A 4QXTA 3DBXB 1IM9B 3LIZH 4NNYA 2DQUH 3O6MH 4OFPA 1IJ9A 4R7NA 2D7OA 1L0YA 2EXYC 4DGVH 1A6AB 4IMLB 2EO9A 2OX5A 3K2UH 4ONGL 3CFJA 2QR0B 43CAB 4X6EB 3D3VB 4QCIA 4LEXL 4LSRH 5FUZL 3VFVB 3W11C 4NO5B 1IFHH 2AJ3B 2D2OA 5I1KH 3TNNA 2DL2A 5DC0A 3FFCD 4NHUA 1XF4B 1UQSA 1S5HB 3BRDA 2EKSA 4PYHA 5FYLE 3PGFH 1JJUA 4WW1B 1OF2B 1T1XB 5J1AB 4ZD3L 5CS7A 1DN2A 3DXAB 2DLTA 3C6LD 3D9AH 5I30H 1NGPH 3GRWA 3MUY1 2DBLL 3TIDB 2DDQH 4LFHD 2UYLB 2HVJA 4OLUL 2AV7B 2F15A 1BZ7A 5T1KB 1TJGL 4WIQA 2WP3O 3MV8D 12E8L 4XCCL 4DVBB 3PHQB 4WV1A 1Z0MA 2VE6B 1SMAA 4QY8A 2ARJQ 4XHQA 4OZIA 4R26L 2ZOKB 5GS2D 1KJ2B 3BWUC 1Z5LB 2C26A 1DSFL 4KQ4H 3FOMB 1PKQA 5HYSB 4Z7UE 1A7OL 5F7LB 2Z92A 2DD8L 4NZJA 2EXWD 4YX2H 2PYED 2VAAA 1G9NC 1KLGA 1QG3A 2GHWB 2WQ8A 2GSGA 3DXAD 3HE6B 2B4CC 2EDLA 2JCCB 4L4VB 3LEXB 1J0ZA 4MQXC 5DQ9B 4KKNA 1HYSD 5C0FB 3QIWA 3IU3B 5D7JC 5HD8D 5T1MA 3ZE2E 4PD4K 3HR6A 4GBXB 3DHMA 1Q9KB 2IQAB 4NUGL 2EICA 3QI9A 2V7NB 3HI1A 3SE3C 2OK0H 5EZLA 2HFFA 3RWHA 4QRQB 2X4NA 3KS0J 1YNKL 3CMOH 3T0WA 1ZHLB 4L4TE 4X7CC 5HSFA 3CIQA 5EBWA 4HGMA 3NPZB 3TGXA 1IM9D 3C87A 5GS0D 2MQ3A 2FYYB 3GSVB 5INDB 2VDLH 2ATKB 3T1FA 1AE6H 4NUJB 2WBJD 3ARDB 3L5WA 1KXQE 3RVWD 1PZUB 5E4EC 1E6OH 1YN7A 4GUPB 1JWSA 3TA3C 5IBLD 3M1BA 3T1WA 2Q8AL 1KG0B 3B43A 5C08D 3QAZB 5LVEA 1FYTE 3LPWA 4XPHH 5IT2H 5JLZA 4B5EA 4NN6B 1R3IH 3NTCH 3V6ZB 2ZKHL 4LPUA 2HVKB 3KXFA 3WFDL 3IGAA 5CIPA 5BV7L 4OV5A 1BOGA 4GKZB 1PYWB 3ZHLA 1WBZA 4JHBA 3G5XB 3KWWB 5KSAC 1BIIB 4QEGA 3SDCA 5J89A 5FAAA 3BX7C 1J05B 8CGTA 1UB5B 1OSZB 4OCXL 2NYYC 2G60L 1I7UA 3EFFA 4P2QB 2EXYD 3SGDH 3GSRB 1A7NL 2IG2L 3U0TA 4F9LC 3S3SA 3VDCA 4LBEB 1AD0A 5EU5A 3DX8A 3THML 5DA4A 5DURD 5IKCB 2HFGH 1OPGL 3QFJB 4JFDB 1HHHA 5C0DA 4DZ8A 3WKNA 5EU7E 5J11C 2YPKA 5SX5H 2XI9A 1UZ8A 3NAAH 5HGDA 1S3KL 4HK0B 1RUML 3RGHA 3VXTA 3MREB 1QBLH 2R0KL 5ICZB 1EMTH 4RDQG 3VG0H 2ZCKH 4E5XB 3ARGA 2FBOJ 1JPST 4HUWB 5EO1A 3UEZA 4PGJA 2GK2A 4M5ZL 5GS1B 4NC0B 3QG7H 4EDXA 2Z31B 3V5KB 2VDPL 4U7SA 3I9GH 1OAQH 4M6AA 3VW3H 1D5ZA 4K9EL 1IC4L 1BQHA 2DKMA 4D2NA 4Y4FC 4WTWA 1UXSB 2BVQA 3P4NB 4XAWH 5C0NC 1K3IA 5L6YH 3BI9X 4A2LA 1PD6A 4GRMA 1A7RH 3C2SA 5A2KH 4JM2B 1A14L 1I8IA 3FRPA 3QG6B 3HRZA 4K8RH 4YBQD 5FKAA 4K23H 1L6ZA 3WIFA 4JFQB 4KZEH 4NQVB 4L9LB 3F7QA 3LHPH 4PB9L 3WS6C 3O0RL 2W1NA 1IGYA 1ZGLA 1P7HL 1F6LL 5J1TC 5GRZA 2VLJB 3H9SE 5FM5O 4MX7B 3QUZD 2ZP0T 1FZOB 2J88L 4M5YH 1WC7A 4NQEE 2UV3A 1CLOH 1CXIA 3ALXA 1U8JA 2VXUH 3PJSB 3WJLC 2PYEA 1MJ8H 3PDOB 1A1NB 4K7PY 4Z95L 3P9MB 3MO1A 3C60A 2NY5C 4Z0BH 1ES0A 2H6PB 2H8PB 3WL9A 2ZSVB 3C5SA 3QH3A 3AM8A 3B6SA 5F93C 4LQFH 3P4LA 4AENA 1J8HB 4BJLA 2BNQE 1GPOL 1XZ0A 2A0LD 4PV8B 1WCBB 2VZSA 5GRVK 1I8KA 1BGXL 1J9CT 4DWHA 5DRXB 5ADOL 3QUMH 4WFGD 4U05A 3ULUF 4NO2A 4HMEA 3ILPA 3RUGF 1D6VH 1VFMA 5E99L 5F7EL 3S5LB 4FG6D 1MI5E 4MAUH 5HHNA 4MNHA 5E08L 1BFTA 3MNVA 4ZO8A 4ODHH 3JTSB 3V4VL 1V3JA 5T3XE 5ELIA 5DJ2B 3WV0A 5FXCH 4JFPB 3D0LB 2C9AA 2CMRL 4AG4H 1MLBA 2A83B 2MNUA 2DOCA 1KTRL 6CGTA 3VXQA 3DIFA 1CLZH 1I1AC 4DJMA 3OKMA 1XCTB 5IFJA 3VXSB 4HKXB 4GAJL 3WS6A 3EJYD 5HVFB 5H94A 1LEKB 2EECA 3QXWA 3GI9H 3GMQB 3P73B 4ZPTB 1F6AA 4EBQH 1KF9B 4S0SD 3F8UB 4DW2L 4Y16C 5B39B 4PJIA 1IC7L 2YD8A 4G9FA 3GSRA 5FUOL 2NY3D 2V17H 2V9RA 4FA8A 4OGAC 5DK2A 2D7TH 3M17B 2VXTH 5I8KH 3WEXA 4MB3A 4XXCA 4M6NL 4O4YH 2YA0A 2I60L 4U1IA 3QQ3A 3O2WL 1P53A 1IMHC 2ADJB 1CG9B 4TNWK 2VLLB 4UBDD 1JCKA 3BYTA 1VADB 3ULSB 5GISL 1CXEA 1Z3GL 5EZLB 3MRIB 2X7LA 3UAJD 3QJFB 4YK4C 3TA3D 3PGDB 3WNOA 1CFQA 5I1LB 2CRZA 1IGFH 2A9MH 1RZFH 4M7JH 2VAAB 5IGXL 1KJVB 3LAFA 2BJMH 4XP5L 2DBLH 3WXWH 5JW4M 4JRYE 5HDQL 3TZVC 1S9WB 4L8SB 4OLZH 4OZHB 5MI0B 3TA3B 5I30L 1U8MA 1WBYA 2J8HA 2WANA 5KVDL 1I9RH 1CD0A 3PWNB 5FDYA 1QZ1A 4W4NA 2VZUA 1HWHB 5LBSL 1EEYB 3C5ZD 1DQDL 1JPTL 1JZ5A 3D5OF 1EXUB 5E8NA 5I16A 4PJ7F 1W72L 3DVFA 5DJ6A 5TE4H 4PP2B 4D94A 4MLSA 4PJCA 1ACYH 3JUYA 5H2BB 3OXRA 1RIUL 3MFFB 2RCSH 5C70A 3PL6B 1S7XA 3A6BH 1M7DB 4YGVA 3EO9H 4OGZA 4POYA 3MROA 1MRFL 1C1EH 2EH7L 3MLTB 1MUJA 5ESVA 1T04A 2VUOA 3PABB 3BP7B 4XPHL 2GTZA 4KK9C 4PJ9A 1JI2A 4R96A 5IVXF 2NY1D 3CFEB 4MB5A 2VDNL 3SDDC 3U4EB 1GC1C 3SGKA 3NN8B 4UIKH 5CLTA 5ANMA 3FMGH 3MRHB 1I8IB 2HWZH 4PB0H 3ROLA 4EN3B 1AJ7L 1KB9K 1H3XA 1CR9H 2PUQT 3GHEH 4X80H 4JJHA 1NDGB 5DHVB 3T2NH 2H26A 2C1PB 2Q76B 5FKPA 2A77L 2XKSA 4BSVB 4NSKB 2FIKA 4MYWB 4NQCE 3BW9A 4YHZL 1QLRB 1HINL 4KHTL 5TFSH 4F33B 2BRRH 4Y19D 2DQCH 1XH3B 4MB4A 3QO1A 2DIBA 3MRGA 1MFCL 2OR8A 5JXAH 4B7IA 5D2NB 4O00A 3SE8H 1O0VA 3CH1B 3MREA 2H3NA 5KS9B 1YZZA 4ELME 2X41A 4AH2B 4CADA 2I27N 5TPWH 2D9CA 1ES0B 3GRWH 4MJ2A 1EEZB 1MCQA 2BSSB 3P3YA 3SBWC 4L3ED 1MCEA 1K2DA 5K59E 5JO5A 3GKWH 3GSXA 2VLJD 4ETQB 1LDSA 4X5XA 5JNYB 1IBGH 4NOFA 2ADFH 2FSEB 1UWEL 2DF3A 4QRPB 1X7QA 1QSEA 1OGAE 1FPTL 2OL3A 3S5LG 2XPGA 1JUFB 2VZVA 3H9HB 4Q9QH 3DV6A 3WHXA 3OV6A 2DMKA 4YO0A 5E2UH 2ICES 4M7LL 4QLRA 4ZO6A 2YD2A 4RFEA 1FNLA 2K3TA 4OCSL 2R56L 4R4ND 1A9EA 1MCLA 1V7MH 3U9UB 1MH5B 1WSST 3N1GC 1BVLA 4OAWB 1KTDB 4E0RB 4MVBC 4Q74A 2X4QB 1JVKA 3SKJH 2CO6B 1YJDH 5DTFB 3GSQA 1H3PH 4Z7OE 4GMSL 1X5ZA 2IMNA 2M26A 1G0DA 4JLRB 1BJ1J 2XQYG 1MFAH 2KH2B 1I85A 2A83A 4LSSL 4OT1H 4EVNA 3L3HA 4ZDHB 5GS0H 5H37G 1Q8MA 3QFJD 4JFDD 1ZE3C 5BVJB 3MRLB 5DD1H 1BFVH 1FGVH 5SWZA 1UM4H 3TBYA 1T66D 1S9WA 5T5NF 3EFDH 2HJLA 1LO0H 2HJKA 4PJDB 2Q7NA 4P4KB 3DMMC 2W0PA 3CVHL 3KR3H 1FDLH 3G6JB 5DDHA 4NCC2 4HUUA 3JUZA 5D8JL 5AWNH 1ZLUH 3S36L 5HI5D 4LOUC 1FL5A 3PXJA 2IG2H 2XZQL 3IDYC 3C5SB 3QH3B 2RFXB 5I17B 3CLEH 4AENB 4YHIB 3E2HB 3MV9E 4Y1AA 5ERWA 4Y4FA 4LHUA 1JMZA 1RAMA 1TZIA 5IF0B 1NCBH 3CVIH 3B9KA 3U0WH 2PYEE 3VXSA 2B5IB 5DUPL 5C08B 5IMLB 1X5IA 1OWRM 4MXQC 2HLFD 5KVMC 3QIBD 4PREB 4A6YA 3MA7B 4LPTA 3RWDB 4MXQD 1QFPA 2EDEA 1JF1A 1LQSR 4QHLB 3GMRB 4M62H 3UXFA 5CSZB 4NN7B 3VDBA 1IAOB 1U8PB 2C1PA 2JB6A 4YAQB 1SHMA 3GSUA 2ESVB 1IAKA 4NRZB 3DO7B 4RRPA 1G9NH 1J0JA 4AJ0A 4H88H 4G43A 1NGYA 4YDLC 1N8ZA 3MV9D 4G7VH 1JHTB 4MA8L 5DD5L 3RVXD 1HSBB 2PKDA 4ODXB 3S9DB 5IVNA 2H32B 4X6DE 4FMFA 3BYYA 2ESVD 3E6HB 5MERA 3LS4L 3PGDA 4WFED 3SKUD 2VSCA 2Z8WC 3L6FB 3D2UD 5E4IA 3MRDA 5FEBA 3IFPB 2DWEA 1KIRB 4I4WA 4P2CG 3HPJB 5A3ID 5ADPL 1YN6B 2E3VA 2BOBA 3VXUA 1MQKH 5GGQH 5GSRA 4PJGB 3EYUH 4KAQH 1BREA 1ZHKA 4LHQB 4U1IB 3EO9L 1D6EB 4R7DA 3TH4T 4FQJL 2HLAB 1RIUH 1TZGH 5I8CB 1INQA 1S5IH 3RGVC 4CDGC 5IHZA 4UB0L 3W81A 1UJ3C 3FQXB 3VCLB 2DD8H 4YHOL 3GSNB 4AT6A 3TN0B 1HDMB 3BZEA 1YMHB 1JZ6A 1QP1A 3B5TA 1RURL 4TSBL 3MRGB 2XRAH 4R97C 3WUWA 1VGEH 4GLRH 5T1KA 1I1FB 1QKZL 5D70L 3L1OL 5FGCE 3ZT7A 4Y16A 1JNLL 3PHQA 1DQMH 3B9KC 4IIQA 4NQUA 5AWNL 1A6UH 5EU7C 2AABH 3SCMB 1FYHB 4GKNB 1IRAY 1MFBL 1FDLL 5EOCJ 5FO8B 2K9UA 4DCQA 2F54D 5ID0B 1N0XL 2XTLA 4HIEA 4KMQA 5CLWA 5IR1B 5D7JB 5F8QC 4WEBH 1F2XK 1YY9D 3LKNB 4OFKA 1T1ZA 4LCIH 4H20L 2R2HA 5FO9A 2JCCA 1FAIH 3MMEA 1AGFA 5F1IA 1CLZL 3F5WA 2B1HH 2XZAL 1JYXA 1FG9C 4UAOC 4I5BB 2DQGH 4NPYB 3O81A 2C3GA 4G9FE 3ARBA 1UYWL 1JGDB 1VA9A 5DUBA 5A2IH 4KV5E 1P4IH 2AJSL 1EDQA 1IC7H 5DMGD 3RL2A 1IFHL 4QXTB 2Z4QB 1N64L 2NQCA 2P45B 4IRJA 5D1XC 4YXLH 1UEMA 3OZ9L 5M95B 5CHNA 3AXLA 4E42B 2GCYB 3KJ4C 2CPCA 5IVOA 3S37X 2BOCA 4X6BA 1Z0NA 3EDKA 4R8WL 2GUOA 3BDBA 2VDKL 4P3DA 4HGKC 1NGZB 4XP6H 3BIKB 3QDME 3DJ9A 5DMKA 3WS3A 1XGYH 1UWEH 3H3PH 1A7PH 2GSIB 4HD9A 5F9OH 4JRYA 4QRTB 2IANB 2ESVA 2VZTA 3UDWC 1QO3A 4Y1AB 5F1OB 1GGCH 2MMXA 1UVQB 2BNQD 1UA6L 2FGWH 4PJGF 1BGXH 3FQUA 1QBBA 1CQYA 3FHQA 4HCRL 1PLGL 1UB5A 1V5JA 4M48H 4W6WB 3KPPB 1PG7H 3S36H 2VXSL 2VDQL 1JUFA 4GW1B 3DUSB 2FX7L 1U0QA 4QHLA 5C08A 5IMLA 1FNEB 1ZKAA 3MXVL 4ZUUA 3VH8G 2OTWB 4ZG1A 3UPRA 1EO5A 1AC0A 4U0RC 5MEQB 1RMFL 4XWGH 1OTSD 5D5MB 2HYMA 1CD1B 5T1MB 1IGIL 1S7TB 3ARWA 4IDJL 1CDUA 3TPUA 3TF7C 3KPRE 4NBXB 4LF3A 1A6ZA 3OG4B 4OLYL 5FA3A 3FMGL 4YDJB 1DL7L 4NQEA 2X70A 4ELMB 4G43B 2IBZX 3CK0L 4UDTA 1F13A 5ICXB 4QYOA 2ICWJ 4LSQL 1VACA 1NLBL 1I9EA 4U3CA 2EEBA 4GG8B 3AFLA 1AQDA 3OXSA 4PY8I 4JGJA 5A1AA 2DBJA 3O6LH 4D0CA 2AXJA 4KUCD 4JY5L 4F57H 3IDIA 4HWBA 2XTJB 1HI6A 5F9AC 2JCCE 4HS6B 1U3HC 4ZMAT 4A6YB 4MJIA 2HJFB 1ONQA 4Y4KD 1I7RA 2X42A 1HEZA 1G7PB 3BEVB 4Y2DD 3VXUB 4FXKA 1CLYL 4KJYA 4PGDB 4KUZH 4PIRF 2Y7QB 5E9DD 3DGCR 1ZVHA 4ALAH 4OLZL 2ZUTA 4OF7A 1FZKB 4NQXB 5FCUL 1ADQH 1FIGL 2BJML 4XVUC 3GBLA 4FQJH 4Z7VA 1FL6B 1J1PL 4HH8A 4KAQL 3A6OA 5E24E 4N0UA 5HHPA 5BS0E 1H5BC 5B22A 2XQBH 3MO1B 4XXCC 2DWDA 3VFGH 4YGAB 3C6LA 2B1AL 1OL0A 1VEMA 3CFBA 3H3PL 3PWPA 1OVZA 1CF8H 2QJDA 5DRNA 5DZNA 2D4FA 3MRBA 2KDGA 3MODL 2IC2A 3MV7B 4UIKL 5E2TL 2UZIL 5LAXB 3I6KB 4L9LA 3NABH 3SDAC 3QHZL 1U8OA 1IL1B 2VDNH 3DPBA 4PRPB 3W39A 4FP8L 2R4SH 4GQ9L 3M45A 4UUJA 2ADGB 4UBDC 5I19H 3DMMA 1MVUB 4NCC1 2YUVA 3KS0H 2XQYK 1LNUA 1NANI 4OLYH 2EDOA 4JRXD 3PL6D 3FQRB 3K4DA 1I1AB 3PQYA 4IS6A 4PJBF 4XMKL 4ODVH 2H8PA 5F89A 2ZOKA 4K3JL 5E2JA 1NFDB 1ZLWK 3QCVL 3T8XB 3U7AA 1GGIH 1KLFA 3GMMB 1DP0A 4U31A 4X6DA 4NO2B 3QEUB 1QFOA 3QWRA 3KPNB 4OLXH 4BELD 4L4TA 3ELAT 4MCYA 1EMTL 1HHJA 3HNTH 3HE6A 4IOSD 3V5DB 4MNHB 2OK0L 4HT1H 1KJ3L 5JR1H 1F3DJ 1IEBB 2NW3A 1NAML 2IGFL 5L2KD 1MWAB 5T3XL 4OQTL 1FCGA 2FL5A 4HS3B 3BIKA 2ATPB 5JPNA 4M6ML 5C0RH 5D9SB 3BT2L 5GGVH 2Q86B 4MJ5B 4Y88A 1WITA 5I1HH 4UI2A 1IGFL 3MOQA 4JHAL 4KC3B 3BE1H 2NMSA 4BZYA 2ITCB 4GSDL 2CK0L 2L7UA 3O9WB 4Q2ZB 5GS0C 4ALAL 4LLDB 4JHWH 4V1DB 3MOAH 1AR1C 5D71L 3G5VB 3MCKA 5FB8A 4ZD3H 1MF2L 3EJJX 3BZFA 4FQXA 5CD3B 4NGHL 2WWMC 3UMTA 1JNNL 2C4FU 4L3CA 2FZ3A 4Z0XA 5JORA 2VXTL 2MQ0A 2VXUL 4XTRC 3O3UN 3SKOB 2ENYA 2AK4E 4X9IA 4X7TB 4KKAD 1MY7A 5KG9A 1I8KB 3BP5B 2Q6WA 3M17A 4MA7L 3BPCB 2DMBA 2VJXA 5C07E 2BHZA 3QISA 1Y18A 1VCAA 1KGCE 3BKMH 3N1FC 4EEEA 5C9JB 4N0RA 4I18C 1E4WL 1FSKB 5IMMA 1YEGH 1UT9A 4F9LA 2CKBB 4Z7VE 3G6AA 4KKBD 1N6UA 5FYKL 4M4RA 3ULSA 3EZ8A 2UZXB 2WMPA 2SEBA 1HHKB 1CXKA 3S96A 1NMCB 1ZANH 4U1JB 5AUMB 4YR6A 2R1WB 1RZJL 3FO9B 3T3PF 4MDIB 3IVKA 3VXUE 1GGBH 1ZXQA 5FECB 1XF2B 4HIJA 3MODH 4PRIE 3VRLE 1G1CA 1VFBB 5IVZA 2UZIH 3IETA 3OKLA 3BJLA 3F58L 4FFYL 2QKIB 4BSWB 3RWJB 3DTXA 4N0UB 4TTDD 2BNUB 4JQVC 2BHUA 2Q87A 3VXPA 1WBXB 5F1NB 5DVLA 4OGXL 2X4TA 5JOPD 3ROLB 2FEDD 1D5XB 4EN3A 3P40A 4DN3L 1FJ1A 3SDXE 1KCSH 2QLVB 4YC2B 1ZWIB 4D9RE 2OTWA 3IRPX 3EHBD 4UV4L 3OKOB 1UENA 4P2QD 4QXUH 2HFEB 3HE6C 1HHGB 1A6UL 1HE7A 2V5TA 4IDLA 2VR9A 4KY1L 4FZ8H 3HKFA 3R1GH 4Q9CA 5EZJA 3B2UD 4FFVD 1YY8A 1LD9A 5GRJH 1AKJA 1R3HB 2CH8A 2A6DB 5F7MC 1U8QB 1DBJH 1MOEA 5HD8C 4GW1A 4C56E 1ORQA 3I3BA 4I3SH 3FO0H 3LDBB 4I77H 3TC9A 4OM0L 2QHRH 3UTTD 4GG8A 1NFIB 1EFXA 1SEBA 4X7DC 2D7MA 1BD2E 2KQMA 2DL9A 4M5YL 5ANMB 4GRMB 5E6ID 3ET9F 4X6CA 3NTCL 1WZ1L 4NO5A 3EOAA 4YDLB 4KGLA 1EAJA 1C08B 4ZFGL 5ILTH 2DQHL 1ZV5A 3SDXB 3GSWB 3U6RA 1IAIL 5DJ8B 5EOCL 3RIFK 3TZVB 3GJFK 4PGCA 4OB5H 4Q6YA 3DWTA 5JXED 2P1YA 4NQTA 1FVDB 1FO0A 1NANH 2VDLL 4TPRL 1EVUA 3C60D 4OZFG 5E00A 1RZ8A 4YDVB 3TESA 5TQ2H 5HGBB 5I1AB 1R5IA 3LVEA 1I9RL 3F62A 3GSQB 1V3KA 2YD4A 4PJFF 3V0VB 1Z9OA 2LAAA 4NQSA 2FECL 1ZEAH 2W60B 3OPZH 5CGTA 4X4XB 4LVOC 2DLHA 3KPNA 4KUCF 1LNUB 4PD4J 2CSPA 4AIZA 1PZ5A 4FTVB 3OJDA 4JG1H 3MJ8B 1A4KA 5KJRH 3MZTA 2PETA 1I3GL 3X3FL 4RGNB 1Q9OB 2Z9TA 4LSPL 1PG7L 2MOVA 4WJ5B 3BPLB 3MOBH 3OB8A 5D96C 3S88L 3HMXH 3IFOA 3V7MA 5C0FA 4N5ED 4BQ6A 4K55A 4K3HA 5EZIH 3WO4C 4P4KA 3MV8B 5IP4A 5J11B 4X98A 2CKBA 5EUOA 4AEFA 4FN0A 3SJVD 3FFDA 5DA0B 3WDJA 3ROOA 4JLRA 3O11A 3HI1B 4XMKH 2VDOH 1VSCA 1JGUL 1XF5B 4K3GA 2HP4A 3WSQL 3QDJD 1LE5A 3AREA 2Y06H 3C6LB 2R8SL 5LCVH 5I18L 5CJBA 5L8JB 1UG9A 3BVNB 1MHHA 1OM3L 3QDJB 3KNBA 5E8OA 3T0ED 5FDWA 1RZKC 5DYOA 2APVA 3UPCA 3IFNH 4C55A 4LASL 5JA9A 1UYWH 3VXME 3ZO0A 5E94A 5GGVY 5E2WL 1IGTA 3U4BH 1NEZA 4ZODA 5C6TL 5HGHB 3FOLB 4TSAL 3DX7B 5DC9B 3OGOE 5BJTB 2BVPA 2NY6C 1P4IL 5J3HC 4AEEA 4QRSA 2NW3B 1IARB 1G7JA 4HH9A 3EBAA 2DQEH 2IQAA 2A6IA 4JY4B 3AROA 4CN4A 3QI9B 1T7YA 4WEBL 4MJ5A 4WVRA 4LCUB 1RIHL 4PRNB 4RGOH 4GAFB 2JJVA 3MRCA 4BSWA 1H3TA 3GMMA 3OL2A 3IJHA 4JN2B 3IAGC 1F3JB 4ZFOL 3NCFB 3AY4A 2P5WE 3B3IA 1XIWC 4NUJA 1KPUB 5JDJA 5B4MD 1KJMA 3EYQC 2L4OA 3RJDA 1DN0B 3VMPA 4MA3B 5D70H 2WINA 3MRRB 4RA0C 2MHAA 1QLEH 1UQSB 3DVNB 3KJ6H 3QEQE 1EHXA 4UU9B 4PBVC 5HGAB 1BLNB 2HLAA 4UIMA 3ALPA 5I8CA 3TT3H 1E0OB 5HYIA 2F53D 3AS1A 3IU4L 3G6JA 1GHFL 3TBSB 3V4UL 5EOTA 4OI8A 2WLZA 3NCEB 4K8RC 4R26H 4K94L 1ETZB 4R3SB 4H5SB 4OBSA 4PRPE 1MRCL 1SYVA 3FTGB 3RJQB 2GY5A 3HFML 3MLTA 4O2EA 4WU5B 3L6FA 4HIJB 1HH9A 4IOIB 1EFXB 1T1WB 2NY7L 3N85L 1QFUL 1A7BA 1AGBB 1WFTA 2FX8L 3BD3A 4X6CB 2GW5A 2DQCL 2HN7A 4GW4B 4R0LA 3RWJA 1EFQA 5EA0H 4K71C 4Y16B 1UXSA 1UZ6E 1MIEH 4XMPL 3Q0HA 3RNKA 1AO7E 5L7XH 4NRXA 4LLQA 1UWXH 2V6HA 1GOFA 3D39B 1PBYA 1NDGA 3GMOB 3UDWA 1BF2A 5IMMB 2QQNH 2AAVA 3SN6N 2F53B 5IG7A 5I8EB 4MHHI 2AK4B 4YDKL 2F53E 5DUML 1M71A 1UACH 3MLZL 2ZCKL 4LSUH 1IAOA 1U8PA 1K6QL 4QHMB 4IHOA 4YAQA 5T3XD 1FO0B 3LN9A 3MXVH 2DQUL 3O6ML 4KJQC 4DZBA 2A73B 2YPVL 3HZYB 3DI3B 5JW4N 1UH2A 1MREL 1TVDA 2HH0L 4NOBA 3AU1B 4E5XA 4BFIB 3ROOB 4NQDE 1KC5H 2BNUA 1RZ8B 4YDVA 4IIQB 3ARFC 3O4OC 4DOHB 4QOKD 4BFGA 1D5XA 4YE4L 4NKIH 4Q9QL 4X5WA 1MWAH 1QSFD 4XCFH 3MUJA 1J86A 4GS7B 4NIKB 1QVOB 1SEBB 3LRSA 5CD5D 4MAUL 5F88B 5I1JH 3UP1A 1MCRA 4A2MA 4RMSA 2RGSA 3VD5A 2QHLA 5MHSE 1KJ2A 1YN7B 5DO2C 4DKEH 2WZPD 4H8WC 4U6HB 1P2CB 3RBSA 4JFED 2Q3AA 3INUH 3VDAA 4NQVA 3HG1B 4BKLB 4Y4HD 3PE9A 5HDQH 3OB0K 3UTSE 3A0OA 1JYNA 1R3LA 1FNGA 4PRBA 4XP5H 1TVHA 1BEYL 1CN4A 1HSAB 4OLWL 4NC1E 2UYLA 4NYLB 3HPLA 4LQFL 5CEXB 2AV7A 3OPZL 3OKYA 4WU7B 3ULVL 3G5XA 1QR1A 3EYFB 3T0EB 3QCUH 5HHXL 3S97C 3TO4A 3FFDB 5CEYA 3KYMA 5T1LD 5HGGS 3SOBL 4KHTH 3F7YB 3BMVA 2R69H 3OHXB 2Z4QA 3JWDH 4GG6B 1P7QB 5KSUB 5ACZB 5D1QB 4NN5C 3HS0B 4NKOA 4FFZL 2C7UA 4LCWB 1RU9H 4HKJA 3WN5B 1E28B 4HWZB 3LS5L 4K7FA 5I76B 1FFPB 5JOFB 3NIGE 2R0WH 1AD0B 5B39A 1S7UA 1AO7A 4MQTB 3BQUB 4FQPA 1QR4A 5BRZE 3VJ6A 1C16B 3I02B 3MACH 2FH8A 3VXSE 3HR5B 3FN3A 1IGJB 5DJDB 1EO8L 1IGCH 2VQ1A 1AC6A 2VIRB 4YC2C 2DB8A 4PRNA 1UFUA 2JIXA 3TVMC 1HOCB 2W60A 1TIUA 3PHOA 2WK2A 4OCYH 4JM4H 4PS4L 1G9EA 1NCDH 1EHLL 4IMKC 4NFCA 4YX2L 2XZCH 1JP5A 2ZUQC 3VGBA 5KZCB 4O2EB 3HTLX 4MS8D 3L95A 2BP3A 4HXBL 1FNEA 4ZUUB 4YXHL 1NCAL 2W0FA 3DROB 1YEJH 4UILL 3UTZB 3OXSB 3NH7L 4LPCA 5L9DH 2NY0D 5KSVB 4RIRA 5HYSG 1M7IB 4OM1L 2PXYB 3FCTB 3RWIA 3QG6A 4IOFD 3AS2A 4ZUTA 3SBWA 3M1BB 5I1HL 1OTSC 2DKSA 5CZXC 5BXFB 1R0AL 3MRKB 1NEUA 3OMZA 5MEQA 3LZFL 1KCUH 2VZ1A 2XWTA 3ZT5A 1OTTC 4KDTA 3QQ3B 1BFOA 4QO1A 4Y5XB 3O6KH 1S7TA 3RIFF 1PYWA 5IK3B 4BH7A 3HNTL 1LILA 1UCBL 4OZIE 4P0DA 4JCMA 2PTTB 3L9RA 1U8JB 3V8CA 4U2ZA 3IDNB 3R4DA 1UCTA 4WNQA 2BY3A 4YJZL 2OL3L 4TVSa 4WI6A 1MCWW 4PJ9B 4L1DA 3V6BR 2X4UB 5GSVB 2A77H 1T5WB 1KPVA 1G9ML 2A2QT 2Q1EA 4ZS6D 2OZ4L 1V3MA 4X4ZA 3Q6FB 4G3YH 2FO1A 5I19L 4EI5A 1KPUA 1M71B 4OLVL 3MRJB 3LPFA 1X5AA 2BFVH 3LB6D 2QSVA 2RCSL 3HI5L 4LKCA 4NQXA 5D7LD 4WTXA 5CZVL 1AHWB 5DJCB 4R4FL 2NX5D 4FQXC 1GGUA 2FR4A 3U0PB 4LCUA 5I1EL 1WFUA 1YC7A 4D9RD 1DVFB 4FQ2H 4PJ5A 3MV8E 5GGTA 3RHWK 4UOW1 1FZKA 2DTML 1NAKH 1CXFA 1NDMA 1X4ZA 2YMXL 3X11A 1S7SB 1JNHB 3L3IB 1ZT7A 1B0GB 4MNQE 2JIXD 1MJUL 5IFAL 3E6FB 3LV3A 4IOIA 1I3UA 1QQDA 2O5ZH 3GNMH 3BGAA 1CD9B 4JZOA 2DM4A 4HGWA 3I85A 2ZUQB 1R3JA 3IFLH 4FQLL 4QRRD 5FFLA 3D25B 1G7IB 1XF3A 3FN9A 1U8LB 1NAMH 2IGFH 1LP9F 1NJ9B 1CT8B 4ACPA 3LRGA 1JF6A 1NBZB 3OQ3B 4FTVE 4LLVB 1OW0C 2GJ6B 2DJ4A 4X5LA 3NMEA 1HXMB 2EIEA 3L5XH 4OD1L 3QWRD 4K2UL 1MCJA 1P5UA 3AB0C 5FGRA 3VA6A 4X7SH 1YEJL 3FB8B 3LN4B 5JPMA 3VWJB 4QXWA 4U6VH 4KPHH 3QDMB 4RGMC 4R4NC 1IKFL 3W0WB 2ERJC 2BCKB 4KTYA 3P4MA 3T4YB 3UYRH 5H35B 3MNVB 2BVYA 3PP4L 4M6NH 2R1XB 5D6DA 1RK1B 1PY4A 2HT3D 3LMJH 5DMYA 3I50L 5BOZG 2AVGA 3WFDH 5BV7H 5JO5B 2F9BT 4P23D 2CLRB 4O2CA 3H6JA 1TPXB 4OJFL 3HAEA 3DXAE 5EO9B 3MR9B 4I0PA 5AZ2L 4FFVC 3CZFB 5C0BD 2HTLC 4D9QD 3G5YA 3MV11 5I1GL 1EBPA 2BX5A 4AG4L 3STZB 3U46A 2EDNA 3BXNA 2EDFA 4Z77A 3R8BB 1HHJB 4KRLB 5HHNB 5CJ5A 4L4JA 3BN9C 2UY6A 1QNZL 2I9TA 4G8FA 2EIDA 5HPMA 5EC1A 2OMNA 2DTSA 3U9PL 1BMGA 2YSSB 3MJ9L 2I9LA 4TULH 4X0KA 3OF6A 3QJHB 1EK3A 3TV3H 5IWLC 2NY2C 4S2SA 3NAAL 4HKXA 4TUJA 5CEYB 2QQLH 5CBAB 2O61B 3D85D 1GYAA 4I8DA 3B9KB 1F6AB 4EVNB 1S7RB 5IFHL 4L3CB 3TBTA 4U1MA 3WO4B 2ZJSH 4WDIB 5IJKA 3QULB 2IAMC 2Y25A 3H9SA 2BNQA 4LLUA 4N9GB 3UC0H 3VG9C 5FYKE 4C57C 5C0CD 4K3EH 3LB6C 4MJID 4OD3L 3BW9B 3HC3L 5I2IB 2NY4C 1KCVH 4XCEA 3PUCA 3WFHB 1CR9L 1IAKB 2VLMD 1CE1L 3N9GH 3NGBC 4NRZA 3DO7A 4MZ2A 4FS0A 3KPMB 4F58L 1T3FB 4JO2H 5L88L 1A7QH 2VN4A 3NFSH 2QKIA 1CICB 4IRJC 2IAMD 5I1DB 2EIZA 2R23A 4F9PC 1YPZF 4IJ3B 3VD4A 1DUZA 5FK9A 4LHUB 5TQ0H 2QR0A 2AEQH 1QFWL 5JIIA 2ATKA 3O2DH 5E2VH 2VR4A 5TQ2L 4LSTH 1JBJA 2FSEA 3Q5TA 3M07A 4GG6E 4XVTL 2WV3A 3ZKSD 1K85A 3HCVA 3G08A 5IM7B 3DYPA 2P5WD 2R69L 5D1XA 5FYJE 4KI5F 1Y0LB 5FYKU 2JK5B 1U8IA 3RX8A 1VGKA 4YEFA 3MLPA 4B53A 2FBJH 4XNXH 1CVSC 2VISB 2AEQL 2I5YH 1QYGL 4DGVL 1G6VK 2VC2L 5J1SC 2PCPA 3VFMA 4J23A 1GSMA 1RUQH 3V8OA 2M1KA 2CLZB 4OFIA 3MBEC 1RPQA 2NXYD 5DRZA 5F3HB 4KQ3H 4AZ8A 5D4QA 2ZCHH 4EDWL 2C1OA 5IROA 4HFUH 1NCWL 4M00A 5HPOA 5BVPL 1NJ9A 1XGYL 1INDL 1AQKL 5KANG 2JJUA 2FX9H 2JB5L 4JDZA 4HQQL 1RURH 5SWZB 5ID0A 1CIUA 3DECA 2AKRB 2YBRA 4NRYB 4APQB 3K0WA 4LNRA 1A3LH 1AXTH 1RUPL 5ESAA 5FA4B 5F1IB 1HXMA 4OKVA 3D69A 3GJEA 3G04A 2QQLL 2GT9A 4WW1A 1SJVA 5GRYA 3BJ91 4PY7B 4Z5RA 4JPIA 2R0WL 8FABB 3MLWL 5TDOB 2YOCA 4WFHD 1HINH 2DIJA 4ZUWA 5BRZA 3SGDI 4ONFL 3MLZH 5GGTL 3SJVA 1RSFA 3NIFF 1H8NA 3D2UA 4MQSB 3O2VH 4XC1L 1OSPH 2VH5L 1SM3H 1GIGH 5EU4B 2YPLA 3MLXH 5TE7L 1B88A 1R3JB 1FFRA 2IAND 2KUTA 4O2CB 1U3YA 3RPIB 3IKKA 1MI5D 3OAYK 7CGTA 2IH3A 2YRLA 1G7QB 3SDCD 5DJAA 1FNSL 1PKQB 1S9VB 1QFUH 4IM8A 4MD5B 3V5DA 3DX6B 4G7VL 3K2UL 2VLKA 1LK3H 4ONGH 4P3DB 1YYLL 1WAAF 3BP4A 3S6CA 2LVEA 2A6KA 4G8FB 2FDBP 2P8MB 4F7MB 4YDIL 1PKOA 3LEXA 3K4ZA 1OM3H 3CCHA 3LMJL 1BVKA 1BZ7B 1YPZB 5C07A 4PJ8C 3INUL 4KI5E 2P5WA 2H1PH 1SEQH 4ODTH 3JTTB 1G7HA 4Y4KB 4LCWE 2OTUB 4OD2B 5ITBH 3NCBB 5C2UB 2VLRB 5FGBC 3K80A 5LBSH 1HIML 1RD6A 2HKHL 3P0VL 2RIKA 1KIPB 4OGAD 5MHSD 3UJTL 2B4CL 1CLOL 4JFFD 5F44A 2JJSA 3O8XD 4MNQA 1Q94A 5FDWB 4YHNB 2G2RB 2RHEA 3D39D 5D1ZB 1CFNA 2I07B 3WO3B 2A9ML 3H2WA 3ZKXC 5GGRA 1EHAA 1ZLSH 3WLBA 4KROD 2VKWA 4U1LA 4YHPA 3IDGB 4PJ5E 1AI1L 3MA7A 1NGWB 3TEUA 5KS9F 1ZLWH 2GSGB 2YEZA 3MLRH 4HPOH 1VENA 3PIQB 1EFXD 1AY1L 3P4MB 1A64A 3IU3A 1DDHB 1YUHA 4XNZC 4XT1C 5DUMH 4YDJA 4TQEH 1QO3B 4H0GA 4JN1H 1NSNH 4MAYD 1CDCA 3GEWB 5I71B 5FUCC 1N59A 1UKSA 1N8ZB 1U9KA 1WICA 1CD8A 3BKCH 3WD5H 3FQUB 3X14B 3KXFE 4WEUD 5T5NG 4KRPB 4XCNB 5CJXC 4L8CA 5F8RC 3U7WL 5D2NC 2R0KH 2UUDH 1EJOL 5LG1A 3LEYH 4D8PB 4R0LB 5IIEB 1GZQA 1OP3H 3DLQR 2W38A 4OIIH 2BNQB 5L88H 4NZUH 1ONQB 3X13A 4GAJH 2NXYC 4F58H 2YRZA 5IEHB 2CLVB 3UJIL 1OAUL 3WEXB 2PO6C 1P1ZB 3O6FD 4PRAB 1YDPA 4XGZB 4RSVA 5GSRB 3OR6A 4JRWA 1SY6A 5HYJD 4GKZA 4YFDB 4XCEB 1SJHB 3RA7H 4OBRA 4MJ6A 3UCRA 4NO3A 4CN6A 4DKEL 1FFOB 4Y5VC 3DVGB 3B5HA 1T1WA 3HA0A 5LQBH 5CINL 3S35X 1KYOK 4JRXE 5I1JL 1GCFA 3CFCL 2HA1A 3VFPA 2ADFL 3MUZ1 2JJWA 1ORQB 5C0BA 3VWJC 1OAYL 3BZEB 2FJGA 1KCRH 1T7VA 1NPUA 1T89C 1LK2B 4JVWA 1BQLL 1AGBA 3QCTH 1RUQL 1NCCL 3OAUH 5IB2A 5D6DC 2C3VA 4RGOL 2BVQB 2Z91B 3T0BA 1ZEAL 1T1YA 4JFOA 4UV7L 3KPRB 5IESH 5A2JH 3EDJA 3DX6A 5BV7B 1MCOH 3HNVH 1CICA 2NLJA 2WWKO 4YWGL 4PJCB 4OFYD 3ARGB 2ZPKH 3RVUC 1AE6L 2IANA 4YNYB 4LSSH 3TH2T 5E70A 2NXZB 5D7JD 4XVUD 3VXTB 4FABL 1MLBB 2BNRD 4D0BB 3DMMB 4F7TA 3KHQA 5J4MA 3TP4A 1A8JH 2UWEA 1XGUA 2J6EA 4KMTL 4DTGL 4NZUL 1URLA 2XTJE 3KDMA 5TDOA 3RDTC 4EDXB 5ETUA 1S7WB 4CDHA 4W81A 1C12A 1N3NA 2CR3A 4ZNEE 1MHEB 5EIIA 4PJ8D 1CLCA 3MTRA 1A4KB 3NFSL 4NRXB 3PV6A 5IV2A 3CFIC 5HJ3A 3W0WD 4NP4L 4X9HA 3QDAA 3REWB 2V2WA 5HI4C 5DRXA 3GBNL 3RTQD 5DJAB 1DJSA 2IJ0C 4JN1L 4PUBL 5GJSL 4XPGL 4HUMB 5B38A 1INDH 5KSAD 5MEOA 4E41E 2V2XA 5EUOB 4NPYA 5EUOE 1HSAA 3BEWA 3GJFA 3OG6B 3MCG1 5KSBA 2VLJA 5A16A 3ZYIA 1MHCB 2VIRA 4AH2A 4NQEB 5IMKA 3C60B 4CADB 1CI5A 4CN1A 5JHDB 2Z31C 4UUJB 5DMJB 4XI5C 2K7QA 2ZUVA 4QYOB 3PJSA 1EAPA 1J87A 2EZ0D 4HXAH 1XZ0B 4PV8A 3S34H 3GB7B 1JZ8A 4PJFB 3ZL4L 5JHLH 1QYGH 3DIFB 3QXUA 4PYGA 1P7QA 4XVJL 5KSUA 4YEEA 3MPCA 1B4RA 5L2KA 3BSZH 1CU4L 1QSEB 2AK1L 5GGRB 3BWAB 5AYUL 1CDYA 4P2QE 3BGMA 1T0PB 2FO4B 1ZS8A 5DQJB 4PTTA 1EPFA 2YEZB 3MUGA 1X5GA 5EWIL 1X5FA 4OZIF 1UXWA 4MZ3A 4L4TD 1U41A 1DANT 2H1PL 3FONB 1WV7T 5C0GB 5DJ6B 4NKIL 2E7CA 4S1QL 3O6FA 4JDVA 5IW1B 4LEXH 4LSRL 5E2WH 4FQIH 3UROR 4HUVA 1TZHB 1P4BL 2OCFD 1GZPA 4LHUG 5FYKH 4R4FH 5AZ2H 3BRGC 1N5YH 1JHKL 1HHIA 2Q8AH 4G3YL 4KU1A 1KV3A 1FH5H 3T08A 1KIQB 5EZOL 4D9QE 2Q20A 5JW5B 4XXDA 5JW3H 3OJMB 5C0BB 4GXUM 1U3ZA 4NM4H 3WN5A 3TH3T 5D1ZC 4HJ0D 4GMTH 1S8DA 2D7PA 4PG9B 4MSWB 4O02H 5SWSD 4JFXA 4Y2DA 4RNRB 1BOYA 3ARUA 1M7IA 4PRAA 4Q97A 2WIIA 4B50A 1AH1A 2Y6SD 4ODHL 4G9FB 4N90D 5DVKA 3CDCA 4NNPL 5IK3A 4BH7B 4LAJH 4QTHA 1CG9A 4WHYH 3WJLA 1IKNC 4JFOB 1M1SA 1FV1B 1MEXH 2P43B 3KPRA 2V5RA 3SCMC 1P1ZA 1YEFH 2Y9RT 4GKOA 5F7DB 5EOTB 3KLDA 4XPAH 1C5BH 4PJ5B 1I9IH 4XCYB 2PXYD 4PV9A 1AI1H 3RX7A 4NKMB 4RBPK 4GJTB 2VOTA 4XC3H 1MVUA 4L4VE 4NQED 3L3KB 4XRCA 5DEGB 4NHCL 3TNMB 2MQCA 1FL6A 3X14A 5FCUH 1NFDA 1YY9C 3GHBH 2GJZB 1EHLH 4PREA 1MPAH 3D87B 3QIBC 4LLQB 4ZYKB 1UM5H 3RTQB 1BJ1H 1ACZA 5T1LA 1NAKL 4DGYH 3AM8C 1RZ7L 4HIHA 4U1SA 4NJAL 3TM6A 3L3OB 3JVGC 4HBCL 4OCYL 2E7HA 3SJVE 1T1YB 3QQ9C 4HJGA 1JPFA 3GI8L 4X8JB 1CFTB 1EA9C 1XF4A 3HC4H 1ULVA 1W72B 4OUUA 5KS9E 3SHSA 4ZFGH 5F7YC 1RZJC 1FVDA 4U2YA 2HAZA 5FCSH 4NO0B 4W4OA 4M02A 3DUUB 5C8JA 5CP3H 4UQ3B 2BNRB 5DHVH 3T0AA 5DJXA 1M7DA 4YGVB 3O3DB 5HYFA 1JNHA 4QRPD 4CW1B 1JL8A 3LKPB 5I9QB 5GRVL 1F02I 2DLFH 4PJ8B 1N4XL 1E4KA 2D7NA 1P7KA 1IGMH 5KG9B 3MRLA 4OZIB 1OGAB 3PWVB 1WIPA 2ZPKL 3GK8L 4S1RH 4HUXA 1OP5K 5A3IC 3I6GB 4YWGH 3BE1L 3RUGA 1X4XA 4JVUA 4F33A 5GZOC 3KPSD 2Z91A 5I1CH 5B8CB 3W2DL 4UT6H 1JRHH 3TBVA 2MCPH 5GGSY 3S96B 4PGCB 1C7TA 1N5AA 1RZGA 2P49B 5FIEA 5LXGH 2FD6L 1NCCH 1V3LA 2V2XB 3WFCH 3CFJB 3SDDD 3WUWB 2ORBH 5T3ZH 3UTQB 5D72H 3QJHA 3MGOB 5H35A 3RY5A 1JGVH 1HKFA 2NR6C 1IM9A 1XMWA 1AGEA 3JVGA 4N0UE 1XGUB 2UZYB 4ODSH 2E5EA 2OR7A 4P2OD 3IDMA 3T09A 4BYHA 1J10A 1E28A 1VPOH 1XF3B 3BZFB 4IBLT 5CD3A 2X1OA 4OFYA 2OSLA 2EEAA 2FZ3B 4UTAL 3N1MC 1SQ2N 3CFKB 4NBYB 4LRIA 1MRDH 1IGCL 5AD0A 4Z9KB 5TDNA 2R4SL 2GJ6A 2Y72A 4DQOH 3RWGB 3STZA 2EZ0C 2GAZB 1A22B 4L8BA 1EHNA 4HHAA 1A7RL 1UXWB 4JFEE 1NGXA 5I8OL 5DJDA 4OI9A 4WFHE 5CBEA 2F58H 2A6IB 4JY4A 4BZ2L 4BH8A 4IRZL 4CVWA 3QEQB 1X6LA 3F12A 4PJXF 4DAGH 4Y4HC 1ZOXA 5TE7H 2YSSA 3IJSB 4V1DD 1NC4D 1WBZB 4HAGA 2IANE 5J13B 4DGIH 1JN6B 2VERN 1WZKA 5KAQF 4KZDH 3I75B 1IT9H 4QXGL 5DFVD 4U6VL 4XH2A 2AW2A 3O4OB 1IAIH 1ED3A 4E42A 5KVFL 2ERJB 1B2WH 5IW6B 1RJZB 1YPZE 3BPCA 4JHWL 4PJXA 3QUZA 5AAWA 5JZ7C 2CK0H 5CMAB 4RWHA 4PG2C 4P2RE 5BVJA 4P46D 3S34L 3BMWA 2OLDA 4HCRH 1T6VN 1U91A 2J8UF 3ARYA 3B8YA 1BVZA 3MRKA 3LN5A 2QQQA 5HHQB 4UZGA 2HFFB 2B7DT 1BZ9B 5BMFH 3MNWA 4JZNA 4DFIA 4MXVE 4XCYA 5KW9L 4ZPVA 4P5TD 4HUWA 2P8LA 1JPFB 1ETZA 4R3SA 1SYVB 1AQKH 3U36A 4XAKE 1TZIB 1LO2L 3V5KA 3E1F1 3WIIH 1ZHLA 3B9VA 5ALBL 4HC1A 2PW1B 4XTRD 4JE4B 3VGHA 4F7EA 3RTQA 4ZYKA 5D93C 5D96B 4HJJL 1QRND 1H0DA 3KPOA 3CVHB 3SGEH 2APWA 5FYJL 1VEOA 3VWKB 1P7KB 4MD4B 3KPSA 1TLKA 1W0WA 3TCLB 3C8KA 5DQDL 4XP1L 3RWDA 3D18B 2VISA 3DETC 2ICWI 4TULL 4PJBB 1ZHKB 3DVNA 3TBWB 3EO1A 3MLXL 3EOYG 4NWTH 1VGKB 1F5WA 1FVCB 2EE2A 3TT1L 1GC1H 1DQLH 3HZYA 3FHAA 1KEMH 2XNAA 2QQNL 4Y1AD 4M1CC 5FHBL 4FNLL 1MIEL 1FAIL 4XC1H 5L7XL 4ODWB 1D9KA 4UOW0 4WUUE 1HH9B 3SDCB 5DQDH 3WFEL 4LU5H 3W9EB 5DMIH 5KVGL 2H32A 4OKDA 3CX5J 3VFOA 4F7CA 4GAGL 4QHNA 4MAYB 5HI4D 1RUPH 2YS4A 3ULUE 2CXGA 1JFQH 1K8IB 4R4BB 4DZ8B 4Y19E 2WUCL 3EO0B 4LGRB 2VABA 4IIQC 5SWZD 2VR5A 4IMKA 4L5FL 1XGPA 4X9GA 3QI9C 1OD7A 1DTUA 1PGRB 1UB6B 3CLFH 3DX8B 3MBXL 3PP4H 5IB5A 4MQ7A 4AQOA 4PG2A 2WLYA 5HYEA 3WIHA 4H1LG 2PW2B 1U95B 3NH7H 2PN5A 1TTUA 2WBJA 1FNHA 3RWEA 2EYTA 2R2HB 3KPLB 5E4EB 1F4XH 1KFAH 4CMHB 5DD0H 4HX1A 5JDSB 5C0ND 3FB6A 3L5XL 5CP7B 3GM0A 2PTVA 3MV8A 3WXWL 4JQXC 1R0AH 3S88H 2R1XA 2FJFA 3MXWH 2EDQA 2LU7A 2PO6A 3QUKB 3KYAA 3SPVA 5E6IA 3BKYH 3FT2A 3WYRA 3ARBC 1CTOA 5CJ8A 1YNLH 3L7FB 1J8KA 5EBMA 3R06A 3WIFB 1FL3B 1RIHH 3O3EB 3L3OA 4PJFE 1FCCA 1WCBA 5D2LA 5DK2B 3I84A 3KNBB 1QRNA 1MJUH 5JIKA 3NFNA 1PEZA 1E4JA 5ID1B 4HCRA 2YMXH 1D9KC 2ZZUT 4Z78B 3TPUB 5KSBF 2P8PB 3CGTA 4P57B 1NL0L 2PYEB 2DYPB 5CJQH 2BC4A 2E6QA 3O11B 4OT1L 3KYKH 3RWFA 5JQ6L 2W07A 4HUNB 1SY6H 4K71B 1JZ4A 1U3HD 5DD3L 4XHJC 5JW4R 3KYMB 5H37H 1LP9B 4V2BA 1XAUA 3VXQB 4I3RH 5D7IF 3V9FA 1OPGH 5ACLA 4JVPA 1C5CH 4WWKB 3VFTB 4PJGE 3RUGB 5IHBA 1S9YB 1A9BA 5CUSH 1ZVSB 5CHNB 4G5ZH 4Z76B 4O2FA 2UWEF 4HKZA 3RGVD 1FZJB 3CVHA 4PJXB 2GY7B 3Q3GA 1TTFA 1D5BA 1XCQB 5ITFB 1NCBL 1BHGA 4YZFE 5EDXA 2C3HA 3CFCH 3MLVL 5IMOB 3UTOA 1NAMB 1P69B 1NGWA 5I75B 5HY9B 5AYUH 3RUGE 2J5LC 3GMPB 4ESKA 3AB0B 5IB3B 2X05A 4R8WH 2WUCH 4Z7VB 4MJ6B 1DDHA 3RQ3A 3UTTE 2GSIA 4GS7C 1T83A 3QEQA 5MENA 5SWQB 5IT2L 5FYLH 3BKJH 1JHLL 2OJEB 1J88A 3PABA 1PVHA 1L7IH 1X9QA 3BH8A 1J8HE 4H0HB 5I1CL 5I74B 4H26A 1T2QL 2CGRH 2IBBA 3T77B 3UBXA 5LQBL 2JKXA 1NC2D 4KJPC 1A1MB 1GRWA 3RWGA 2BDNH 3TYFB 1T0NA 4YHLH 2MHAB 5DD5H 1IGML 4L29B 5CBEB 3MRFB 2VWEE 1NSNL 2ARJA 5H8DA 4H8WH 1K5NA 3QWQB 4MJIE 2QQKL 4PRPA 3VFPB 4HDIA 4Y5YC 2DQTH 4LPWA 3VRJB 1KTKE 2ESVE 3ZE1F 3VE0B 2GKIA 4DEPC 5EG6C 4RGNE 4PJAF 3UTPE 1ZT1A 3SO3B 4N5EC 5F1SA 2LV4A 3KYOA 1MUJB 5ESVB 1HK6A 3E6FA 4WO4D 5CP3A 5GRWA 3WFZA 4OCWH 5B38G 2FJFB 1FORL 2CXKA 3MGTB 3RDTB 5E56A 4YBQC 5ISZD 1GZQB 3N85H 3R1GL 1U2CA 2P7TB 5HJ3B 4LIQE 4XPBL 1G7LB 4Y8AA 4QRPA 1HQ4A 4Z7NE 2FB4H 3PWNA 1JGEA 3E3QC 1AHWA 4YBHA 5EN2A 4XVJH 4NHUB 2FL5B 3S37L 3EO1B 4ZSOA 1DZBA 3LKSA 2V9QA 5D1ZD 4PRHD 4CVXA 2AJUH 3O2DA 2FATL 1NKRA 3FQNA 4R96B 4RAVB 4R90L 2VE6A 4NQDA 1DE4B 1IL1A 1FGNH 1NMBH 1LK3L 3U2SA 1H15A 4RWYH 4ZUVB 5D7KE 5CZKA 4RGMB 2KKQA 1WFOA 2XN9E 4Y5VB 5GJSH 3IB4A 3U4EA 1JTOA 4CL7A 4J3TA 2X1QA 4NKQB 5ETUB 3KYNA 5HDLA 5JXEA 3T8XA 4Z6AT 4PJBE 4QNPF 3SQBA 5EZOH 3VXOB 4F2MA 5DHVA 3NZ8A 3L7EB 2IPUG 4ONOA 5DQJA 3GSWA 4G9FD 5C6PB 2F19L 1OHQA 4LDOB 5E1HB 1TVHB 1J0KA 2KZ1B 1TENA 3IXAB 2OQJA 3VFUB 5I73C 3MRNA 5GGRY 5DRWA 1U95A 3CCHB 1G9MH 4AY0A 4OCLC 4PJXE 4M6OL 1FC1A 1T03L 3O6FB 5JPNB 1HKLH 1YEIH 3L3DA 4N1CA 1YEEL 5D7LB 3IETB 4QRQA 1CF8L 2EDTA 3VFRB 4PGBB 1DQDH 1JPTH 1NQBA 4AEHL 5E99H 5EU6A 1MCSA 2VXVL 5KVEL 3S3JA 1CYGA 5GHWH 5C0CA 1NFDE 4GUPA 4ZDHA 5C0AD 4X5XB 3FB7B 4MHHG 1DBAH 5JXEC 3KLHC 2G2RA 3RVWC 4ZS7H 2IFFL 5C92A 4B7LA 4EDWH 1F11A 1KG0A 3H9SD 2OZ4A 4MSWA 1EGJH 3TNNB 5IMOA 4ONHB 5D8JH 1U6AH 4HJJH 1J1PH 1F4WL 1AO7D 4HKBA 4MCYB 3RWIB 2NY1B 3NIGF 1DQML 4LCCA 2NY5H 4XBEL 2X09A 4WGWB 4WUKL 5B3JE 1E4XL 2C3XA 2ARJB 3GJFB 5KSBB 4KK8C 1UM4L 1T3FA 5INCA 3JV4A 3UZEA 1Q9WA 4J6RL 1ND0A 4NT6B 4KQ4L 1YYML 4O4YL 3GHEL 1BBDH 1OAZL 2GI7A 1T7XA 3BH8B 3JWOH 5C0AE 1LO3L 1EEUA 2O61A 5D2LB 3FO2A 4DK3A 3KYOB 4WFGE 5IJVB 3VMNA 3TYFA 1FHGA 2J6EL 3H8NA 4M43H 2OBGA 3TJHD 3CK0H 2GJZA 1MCWM 1IVLA 3WUZA 1PQZA 4KRNA 3BQUD 4JFFE 2P8PA 3QUXC 4J1UA 1Q38A 2FIRT 1NEZB 4MNGE 4HUUB 4K9EH 3FRUA 4ZQKB 1K5NB 4ZTPL 1J1OH 1FVEA 5T3ZE 4M4PA 4JRYD 1ZWIA 1EJOH 5IB4B 1CGXA 1HILB 4CKVX 3WKMH 4PV9B 1NAMA 3SGJC 1NC4B 3KGRA 4QNPE 3RZCD 2QHRL 2E8YA 5BQ7B 1MJJB 4HUVB 1HHKA 3QHTC 5CIPH 4FQQB 5SX4I 3GIVB 4C58B 1F97A 3BDYL 4FQXD 1NCUA 1WTGT 5GJTL 2MPAL 3OB0H 4RFOH 2H9GB 4GW5B 3D3VE 4O58L 2WIMA 2HT2D 5EOQH 5TE6H 1BEYH 3TFKC 3DGGB 4LLMB 2PR4L 1LEIB 2B0SH 3P4OA 4ELKA 4U1SB 5IBTL 5C9KA 3RX5A 1YEKH 5IQ9A 2LVCA 2LFGA 1U8NA 3BKJL 4JFEB 3ZYOA 4XPTH 1TVBA 2P5EE 4HLJA 4LP5A 4XPAL 5E9DE 4BQCA 4J2XA 4TNVK 5T1LB 3AAZA 1UA6H 2FGWL 4J4PD 4OUUB 3TV3L 5HHME 4QKXB 2FR4B 4CVXB 5HHMB 5D6CB 1SBBA 4CRPA 1F90L 4OCRH 5DLML 1A7NH 4OF0A 1XR8B 4YZFF 1XFPA 3EGSA 2Z35B 3QXAB 4X4ME 4XNZB 2BNRA 5T3ZL 1D3CA 1NBYA 4ODVL 2DIAA 1FG2A 4NQCD 5DUBB 1AGFB 2OQJB 2BXYA 3X11B 3HMXL 3IF1A 3MNZB 1P5VA 4X80L 1XT5A 2YZ1A 4XPTL 4KRPC 2BY2A 3IDXL 2I26N 2NZIA 1OSZA 4ODUB 3EKCA 4ISVB 1R5IB 4K7PL 3BVNA 3O3DA 4FP8H 2MWCA 1H8SA 1YN6A 2Q8BH 1H15B 1N2RA 1IC5H 2C3WA 4IOFC 1CGSL 1QSFB 4AQ1B 3QNZB 3PWLB 4RMQA 1D5MA 3CH8A 5HYJB 3SDXA 1IC4H 4G8EB 5M7QA 4Z7UA 4JZJB 4TUKH 5HVHC 5D5ME 4HDIB 4WWKC 1RUAH 1A4JA 2KBGA 2W0KA 5K9OB 3VFNB 5SWZE 3AMLA 5GGTH 2B8OT 3LKSB 3H42L 4UMGA 5KVDH 2AK1H 2GFBA 1UC6A 1XCTA 1FFNA 1MFBH 3MZGB 3IFNL 5E6YA 3LZFH 4P49A 1E4WH 1LE9B 5HPMB 1F2QA 5BO1H 2OTUA 4OD2A 1F3JA 3D0LA 2ED8A 2W91A 5HGBA 5CWSA 4X83A 4F8TA 3KG5A 3S3PA 5C0RL 1L0QA 1RZKH 1R3KA 5EU6B 1Z2KA 1LEKA 5C7XH 5DD0L 3KPPA 4KDVA 3T0DA 3LY6A 3G08B 1CFNB 3V4PL 1JWSB 1I1CA 5CAYB 1OARH 1P84J 1LO2H 1RZIB 4P4RB 2LE9A 4ODTL 1E4XI 5BVPH 2X4PA 4WCYL 1HIMH 2HKHH 3C6SB 3EJZD 1KEGL 3ARBB 3LKOB 4EI5C 3HE7B 4LSPH 3ZSTA 1NGXB 2RB8A 4HG4K 4D0DA 4XPFL 1X3DA 5BZWA 4X4MA 3WFHA 4KKLC 1BIIA 4EIGB 1G6RL 3ZDZE 2AJYH 3EIFA 4KI1A 4XZUA 2YD7A 1MJJA 3PGFL 1ZGLM 1KCSL 4J3OC 1W0VA 5ACZA 1LO5A 3AREB 5T5FL 3I6LE 4XCNA 3CPLA 2HRPH 3VI3F 4XB8A 4U1GC 3AGVA 5H94B 2R2EB 3NCYS 1RUAL 5D7LE 4C56D 5FHBH 2EYSB 3NZ8B 3D39A 4FABH 4PLJC 1HZHL 2ZUXA 3K81A 4P3CL 1WLHA 1S7UB 1AHWC 5IIEA 4TPRH 3FOLA 1II4E 1BBJA 3MV9B 2G9HB 3JWDL 2GAZA 4NKDA 2HJFA 4OV6F 3QUYD 3MFFA 1KXTB 5SX4H 4S1DD 3ZTJG 4ZAKC 5HGHA 1OTUC 3U36B 5E7FA 4CVZB 4OLVH 4K7PH 4PJIF 2ADJA 2VXSH 3B8SA 5JOEA 5DHXB 2HFGL 4ZPVB 1IC5L 4PJHB 3ZTNH 5HHPB 1NBYB 5SWSB 5GS1A 3DYOA 4DUXA 1UJTA 1BJMA 4YUEH 4JANA 3MGAA 1KULA 4JO3L 1QFWM 4JFZH 4ZOBA 2PW1A 1KLUA 3OKDB 1AXTL 1TFHA 1OOAA 3VFOB 1WWBX 2QSQA 1F6FB 4QHNB 4K7PX 2NX5E 3QUZB 2J5LB 4U1NA 1EJ6A 3VH8B 2IH3B 2FLBT 5KW9H 1MIMH 4MA1C 3CVIL 4ZXBA 4R90H 1E6JL 3HZVA 4E41D 3UPRB 4CU8A 1T4KB 3BH9A 3SQOL 5JHLL 3D18A 1IEAB 4MX7A 3MC0A 2ICEA 4R2GD 4HPYH 5I9QC 1MFEL 3TJHC 4K23L 2PR4H 5H2BA 4Q9BA 3EGSB 3QXAA 5ADPH 5KVFH 4UNTA 1BD2D 3QO0A 4MMXC 1XGQB 2C4XA 4GBXD 1TPXC 2IBGA 2HN7B 4GW4A 5KZCD 1WFNA 3ARED 4CJ1A 4XNXL 1XGTA 2V5MA 4DVRL 1LE9A 1YQVH 1QNZH 3SPVB 3ARZA 3VA2C 2FRGP 4FTVD 1I3RA 2IALA 3U4AA 3IYLW 3X12A 5I76A 5JOFA 5B4MC 4XNYH 5C08E 3ZDZF 2W0LA 4EI5B 4FXKB 1LEIA 4LAQL 4U1GB 1N6VA 4Z7UB 4E41B 4WI8A 5FOBB 1EGJA 2I07A 5KOVC 1W0WB 3TCLA 2BSTA 2JJTA 3VI3E 1OP9A 4I2XB 3U9UA 5HHXH 4HX1B 3L5JA 4FQQA 1YNLL 4OUOA 1HYRC 3AU1A 3BKML 1NGQL 4M48L 4GOSA 5TF0A 2IQ9H 4DQOL 5DJ2A 2VRAA 3IRZA 1BIHA 2DWDB 5EU6D 1MRDL 3OKKB 3QQ4B 4KVCH 1J0IA 2ADGA 3BAEH 1FFNB 5LGHH 1CL7I 4KVNH 4P2RA 4KY1H 5F88A 1AXSA 4FQHA 4OD3H 1Z5LA 3S4SA 2NTSP 3RWCA 2CUHA 5D1QA 1A6VH 5BS0B 5DF0A 1KACB 1E4XH 1B6DA 3I6KA 5FYLL 3PWLA 3HLAB 1VB9A 3GKWL 3AS3A 4Z76A 1CDHA 2XN9D 3N50A 4M6MH 2O5XH 1UZ6F 2WP3T 3U1SH 2P4AB 3D6GA 3JV6A 3WDIA 4Y4HB 4GT7A 3GRWL 4HULB 2YXMA 4U1JA 4YR6B 2G9HA 5AUMA 3ZKQD 5C9JA 5LAXA 3HPLB 5E9DA 2FECI 1FYTB 4G42B 3D1MC 4OZFA 5DEFA 3TYGH 1MNUL 2WBJB 3ARDD 4U1LB 5GRXG 3RWEB 4YLQT 4LPVA 3MBEA 2H41A 2VLLA 5FYJD 4F80A 1OP5H 2GYSA 5AG8A 3EYSH 1CLYH 4Y5XC 1G7HB 3QA3B 4Y4KA 5DFWH 3ORJA 4P2OA 2EC9T 1K6QH 4HMDA 4NYLA 5BCAA 5BZWB 4ZUSA 2FLRT 3O9WC 1TXKA 1XF2A 3U4BL 5SWSA 1M6OB 1I85C 2F54E 4OSUL 4RQQB 5EBGA 3VFVA 3NZHL 3Q3GB 4QCIB 3QIUB 4URTB 1V8HA 3LKQA 3SKJL 1FLRL 5FHAH 1RZJH 3TA3A 1OQOA 4X4YA 1GJIA 1H3WM 4I0CC 3CDGB 3DSFL 3GSUB 5ESQB 3GBMH 1ACYL 3HE6D 3FCTA 3V0AC 2IBZY 3Q48A 4M61B 5GZOD 5J6HB 4CUCA 3K8LA 1XF1A 3IDUA 3C5ZB 3QWOB 3I2CL 4YPGB 4F37K 5TH2A 1YDPB 3MJGX 3PL6A 1IGJA 1Y6MR 1DVFC 4Y5YB 4P23B 1U8KA 4Z7WB 1G7MA 4NFBA 3VE0A 5DSCB 5DWUH 3DMMD 3O9WA 2G5BA 4WUKH 4PJHA 3MOBL 1A3QA 1BQUA 4XZUB 3K1KC 2Y6SC 4HZLA 4LPXA 1B0RA 4CU6A 1HN1A 4FQXB 3GSNL 4N8CH 4RIRB 3OSKA 1R5VB 3DRTA 3CXHK 3QPQD 1JPSL 3IDYB 2FB4L 3QUXD 5TPWL 1C5BL 3EDFA 3QDMD 1S8DB 4L29A 2LTQB 4PG9A 5D2NE 3HC0A 5F3BA 1WBXA 3MLYH 3OR7A 2ZUYA 2ADIB 3C8KB 5KSVA 3FFCB 3VCLA 4ZAKB 4N8VG 4PJDA 4LKXA 2NZ9D 4EIZC 4WFFD 4NM8H 5GQBA 5EU3A 1TCRB 2F8OA 4HXBH 15C8H 3PWPD 2YC1B 3IDNA 3GGWA 4S0TD 1W0VB 1DVFA 4OGYL 3T4YA 2OM5A 4LSTL 3BIAX 4L5FH 4JY5H 4F57L 1OT2A 1ZHBA 1KN4L 3QPQC 4P9ML 5I75C 4NQDB 1AGCA 1AR1D 3G6JF 4GAYB 2CLRA 3PWUB 3RVVD 4D0BA 4H88L 4PJ8A 1G9NL 3JZ7A 5DZLA 4HIIB 4KV5F 1IE5A 2HH0H 1YMME 2R56H 2AJ3A 2FWOB 4JPWL 4LIQL 3QDGD 3MGTA 4LKCB 3ARTA 1IC1A 4AIZB 2VYRE 2D31B 2IEPA 2Z93A 4S1QH 4I77L 2VH5H 3B5GA 4FQIL 4PJCF 4KWUA 1DBJL 3EOBB 3QIWC 5D7JA 4U6YA 4IRSD 1L7IL 5DT1L 3SGJA 2AGJH 5IEKB 1U92A 1FZOA 2XOTA 1EH9A 3BFOA 4LARH 2XQBL 1S7SA 3L3IA 4JG0L 1HWGB 1OLZA 4OZGE 3BSZL 2F54A 3ARGC 5EWIH 4ZFZB 4MS8C 4XP1H 1KNOB 5F7EH 4UV7H 2IPKA 3PL6C 4JPKL 3MJ9A 1QPXA 4BFEA 1JGDA 5D7LA 3NPSB 3B9DA 5FM8A 1U2HA 4YQXL 3U2SB 4L3EA 4OLWH 1S9XA 4HWBL 3A67L 1TJHH 5DS8A 1P4LA 4WUUA 5HXMA 5JXAL 1PDKA 3KR3L 2VDOL 4F2MB 3EZJB 3FQTB 4Z95H 1MHHB 4FTVA 2Y36H 3LEVH 5GJTH 4X8XA 1IAII 1G7IA 5B3JF 1B0WA 1PX4A 2F5AL 4TVPL 1ZLVH 2BOCB 4X6BB 1CQKA 3SDAD 3WS3B 5DMKB 3F58H 4FFYH 3VWKC 5E03A 1FORH 1G0YR 1NFDF 4WWID 3VXOA 1DSFH 1JGEB 1S78D 3PP3K 4JM4L 4PS4H 3N1QC 4PJAA 4OCWL 3P0YH 4EQ3A 5E00B 1ZS8B 1R5WA 4OKVB 3KAAA 1AJ7H 3BEWB 4TN9A 3W0WA 3ULUC 1O5DT 5E9DB 5E7BA 2ZUUA 3VFWB 4DW2H 5SV3A 3B2UC 3TLRA 3O3BA 4MD0A 2RFXA 1AP2B 3MACL 3P11H 3SEPA 2VLRD 3QXVA 2WAHA 4IRJB 4LNVA 4X6DF 1W2KT 3MA9L 2AQ1A 4TRPH 4ZXBD 4PRIA 3CAFA 3G6DH 3WIHH 5GGUA 1IGIH 3P73A 3L5WB 3NGBB 1MSPA 3CDFA 5KOMC 2MFNA 2CDFB 2DLEA 4JM2A 2BERA 5CMAA 1IKFH 3BKCL 5HYJE 4OM0H 3RAJH 3LKQB 2BMKB 1ZLVK 5KSAA 1JNNH 3VD7A 3VXRE 3AMKA 1EO7A 2PTUA 4BFBD 1NGZA 1YQVL 4G8GB 4XMPH 3QWOA 4PTUA 1HQRA 1DBML 2QSCL 3AVEA 4G6KH 4XHJD 1IILE 1IBGL 3DV4A 3NCJH 3KJ4B 4G6JH 2XT1B 1W72A 1LE5B 5MI0C 1FYTA 3PDDA 1PLGH 4X0KB 2AXFA 4P99A 5C71A 1CVRA 1HXYA 1VFUA 4Y7MA 1BQLH 3A6CH 1E6JH 3FO2B 5C09D 4RMUA 5GZNC 4KK6C 4WHCA 3P9MA 3CSGA 4XXDB 4JPVH 3THMH 2UY7A 2C1OB 5DD6A 1YEFL 2D7QA 1F45A 1Z6JT 3U7YH 2GTWB 4B41A 3AXLB 5FF6B 4MJIB 3O8XA 2H9GA 4M1CD 4MNQD 1U93B 3BD4A 4JG0H 4RZCA 1QLEL 3KJ6L 4LARL 5CGYD 3QIUA 2ORBL 4O5LL 1HNGA 2X9WA 1U8NB 3ILPB 4OCXH 2F8VA 2ILLA 4ONHA 1U58A 4XCFL 1YEIL 3MBEB 1INQB 5IFHH 4ZFFA 3C5ZC 5IB1B 5D5MA 1ERNA 5F97E 1BZ9A 4P2OB 1U8IB 1CDIA 3PWJA 2BFVL 5C09E 4RRPG 3TO4D 3EOBA 3WFEH 5KJRL 2AJVH 2E9BA 2AS5M 3F65A 4OGXH 3DRQA 2XTJD 2QL1A 2X4SB 5J12C 3UZVB 3S4SG 1BWMA 4G7YL 3QFJE 3QNYA 4JFDE 3UJJL 3SDDB 5E1AA 2DRUA 3BISA 1MHPH 5FGSA 4YDKH 5IFJB 4KROC 1T2XA 4PR5B 3UX9B 3CFEA 4ERSL 4PRHB 1BAFL 4I9WE 1UACL 2HRLA 3EYSL 1UWGH 4HWEH 1P2CA 5JHDD 5HGAA 3NOIA 1I7TB 3BP6A 5EUKB 1INEH 1DFBH 3LRSB 1FGNL 2FHFA 4NUGH 3LQMA 4JM2C 3MBED 1OAXH 2QADD 5HYJA 1OTUD 3RY4A 4FMKA 3Q1SH 4G9DA 3SGKC 4OF6A 1B4JL 4F7MA 2AABL 2COQA 3JV0A 3VXRA 1PJ9A 3FT4B 1JNLH 5K59F 4F7PB 1FBIH 5DSCA 3VFNA 1B90A 3CDYA 4TNVF 5BQ7A 1AIFA 1U8OB 1N7ML 4KDWA 2JELL 3FQRA 1T21A 2NY6B 2X7LB 3JWOC 2BSSA 2ZSVA 3O3BB 1K2DB 4L9LC 4GG6F 3UTPD 1RV6X 2ADIA 3FO1A 3ULVC 1SEQL 2J88H 2I60H 5IQ7H 4W70A 1CDJA 4JHAH 1N2RB 2N4IA 5E95B 4HW6A 3TIEA 4YUEL 2NY6D 5EU4A 4YHOH 3MLSH 4TNWF 2ITDB 5C0EB 4HWBH 5GS3A 3H9HA 4NN6C 1TETH 2VL4A 4MWFA 3BESR 5E8NB 5I16B 3CXDH 4MQ7B 3WJJC 4GQPH 4HFWB 2VLKD 3G04B 3IJYB 2VQ1B 5F7HA 1RZIA 4P4RA 4HWNA 4DKFH 1J12A 2Z8RA 3ZHDA 2Z35A 1FLRH 3HMWH 1MI5A 4BFIA 3T0EC 5DO2D 3LKOA 3QIUD 5CSGA 1DQQA 2NY4D 2ZG1A 3B9KD 2NZ9C 3D69B 3RFZC 4WGVB 3D85B 4LCYB 5F9JB 4D9LL 4YHLL 2APTA 1S78C 3EOTL 1A2YA 3TT1H 1GAFH 4NJ9H 2V17L 5IW3A 1DLHA 2YPLE 1JE6A 4HLZH 2HTKC 4LLWA 5CWSB 4G80B 4TUKL 3NN8A 4XX1E 1EVTC 3TO2B 4BZ2H 4N90E 1EIBA 4DKDC 4ZUTB 5DRNB 4BKLA 4UQ2B 1QVOA 4JR9H 2W65B 2YD9A 1FYTD 3FB5B 2JCCF 1FZJA 2E9JA 2P8MA 4PJIE 5DC4B 1MRFH 2EH7H 2VB5A 2Y06L 4PJBA 5B3NA 4TTGA 1DVFD 1CD1A 1A4JB 4D0DB 5DMGC 2F5BL 1KB9J 1YPZA 5C07B 1XGRB 2X5PA 3F7VA 5DUPH 5HYQB 1CGTA 1DR9A 1I8MA 2O93L 1RJYA 5FA3B 3REVB 3MRPB 3CJJA 3OKLB 5F6HJ 5JHDA 3IJSA 1EEZA 3O4LB 1P4LB 4WUUB 4P5KA 2JJTC 4QHKJ 1CFQB 4PFEA 5I1LA 2P8LB 1F58H 3VD9A 1MCDA 1Y6KR 3Q6FA 3SDDA 4JKKA 5IHUL 4LLYA 2DYPD 2CKBH 3BQUA 2OI9B 1FBIL 4H26B 3UBXB 2CK2A 5ALCL 3WBDA 1RI8A 2EYSA 5DGQA 1ZA6A 4L4TB 4NN7C 4PJAB 3NCJL 5C09B 3CSYB 4ORGA 1ZSDB 5A43C 1UB6A 1D5BB 5ITFA 4O58H 1A47A 4WY7H 3U0PA 1I7TA 3QSKB 2NLJB 3MYZA 3QUYA 1J1XL 1YUHB 4IRJD 4DGIL 4LAQH 2MSPA 2O5YH 3KPSE 1JF5A 2F74A 2WNGA 2ZSWA 3FZUC 3EUUA 4AL8H 4BSJA 2GIYA 1P6FA 4GKSA 1FP5A 3RI5F 1OT1A 3PHSA 5EZJB 4KK5D 2DQHH 2AJXL 4PR5A 4NNYB 5MENB 3WKML 2NYYD 4HGWB 1FQ9C 3GMLA 4RMRA 5K9JL 3IDJB 1FO0H 4EUPG 2VDRH 1YEGL 1YJDL 1DL7H 3SDAB 2N56A 2E27H 2XY2A 1QPPA 4XBPA 3QHZH 2AJXH 4RNRA 5DK0A 5IEHA 5HI3C 5HDBE 4AMKL 4J3VA 2EH8H 4AL8L 5K33A 3QR2A 4PJEB 2YKLH 3MCLL 3QIWD 1GOGA 3MV7E 3TIEB 3STLA 1RU9L 4GRWE 1WF5A 2H2SD 1C7SA 2J8OA 3C09C 5KTEL 5C0EA 5F6IC 5DJCA 3K7UA 4MWFB 5L0QB 3T04D 4CVZA 4XGZA 2D0HA 3RVXC 1BECA 1A1OA 3OAYH 5LGKA 3BQUC 1IQDB 4DOHE 3IVKB 2CQVA 2IWGA 1YMHA 5EO1B 3Q6GL 2A6DA 4AYFA 3DYMA 3RVVC 2Y36L 3LEVL 4GRWH 3W9EA 5T1DL 3PV7A 1JRHL 2X1WL 2YR3A 4YHKH 4YXKH 1F4WH 3OF6D 3OKDA 4WW2B 1J18A 1MVFA 1OAXL 5F21B 1DLHB 2J8UE 1JZ7A 5F1NA 3TWCL 2R1YA 5C3LD 3PQYE 4GKNA 3X3GL 2LAGB 4WFFE 3LKRB 4U1NB 3VH8A 4ETYA 5J0BA 3KPRD 3ALWA 3OZ9H 1BF8A 4X7EC 2IF7A 4DN4H 4L8DB 2P7TA 1BJ8A 1N64H 1OF2A 1T1XA 3PWJB 5J1AA 4NCDA 7FABL 1MJ8L 2HT3C 3LKNA 1T4KA 4JCLA 1OSPL 4YE4H 4LL9A 2NR6D 3U6RB 1MAML 1VKXB 4G5ZL 1B6UA 2PXYC 3IKCA 1A21A 4NQDD 1Q0XL 2DQIL 2XA8L 2XG4A 3HG1D 3LQZA 1H8OA 4TRPL 4PLNC 3QDMA 1HSBA 3ARDC 4L3AA 2F19H 1YY8B 4UQ3A 1A2YB 1NMAH 4PRHA 1QSFE 4Y8DC 4LLDA 4LIQH 3WE6A 5DR5H 3D85A 4LCYA 5F9JA 1KCLA 4P5TB 1T20A 3TBTB 1WJ3A 3CXDL 5EBMB 4U1MB 2NY0C 4XX1G 4OGYH 3ZYZA 3NABL 1D7FA 2WSKA 2ZNWA 1TQCB 4H1LH 3DHJA 3D25A 3EOAB 3BOVA 5FOJA 3VXNB 4A6YH 1MF2H 5F9WB 5IOPA 3MRQA 2BSTB 3BRFA 2HRPL 3CDGA 4NFDA 3ZLQC 3MV01 1NCWH 4HFWA 3C6SA 4NGHH 3DX7A 5BS0D 2KQNA 1F4YH 2FX7H 2XKNB 3VWJA 4AT6B 5KBNC 4QRTA 3FT3A 3M8OH 1I1YA 1XF5A 5I1AA 1KJ3H 1P9MC 2I9LB 3PDGA 3RWHB 1KEGH 3TNMA 3EFDL 2VL5B 2VO5A 4XNMA 1BQHB 1M05A 2RBLA 4Y1AE 4XPGH 2R2BA 4XPBH 5L2JB 1MFDL 1NC2A 1L9MA 5GISH 3RWCB 3WXVH 3DUSA 2OJEA 5FO8A 1CICD 3MUGB 1LVEA 5F96H 3QFJA 4JFDA 1A6TA 4JFZL 4WI4A 3C5ZA 3RZCA 4L8BB 1IGYB 1ZGLB 4NNXA 3BGMB 3GDBA 1A02N 4KKLD 1JV5A 1DEDA 1MJ7L 2WINB 3MRRA 3DURB 4XAKD 3GMPA 3STLB 1VFAA 9CGTA 5MEND 1CGYA 3JWDC 3BUTA 5DJZB 3G5ZB 2BSRB 3KLAA 1GGTA 5DRZB 5F3HA 3K1DA 2ED7A 3TJEH 5E5RB 4LLWB 5L6YL 4WW2F 5DJXB 1TJIH 4RFNB 4TTDC 2H6PA 3IDJA 4H8WL 4NKMA 1T22B 1L7TH 2OI9C 4JKLA 1HHIB 1QBMH 3UAJC 3RGVA 4F37F 5HHOE 1BD2B 1KIRA 4I4WB 5C6TH 4C56A 1RJZA 4WW2A 4PJGA 3FQWA 4ONFH 2OL3H 2V9TA 2HTKD 3SKMA 4H25A 2YPKB 3QI9D 3UBXG 3LKRA 1HEZB 5JW4Q 2Z93B 3OKEA 1WIOA 2X4RB 5I15L 4JM2F 4PJAE 1HHHB 4JEGB 5EFIA 5TGBB 4WUUD 2YD6A 4Y16D 2ZG2A 4X7FC 3QFDA 5FK9B 5FYLD 2WUBL 1ZA3A 4MVBD 4WWKD 4O5LH 4S1DC 3VFMB 5F7FA 4HEME 2F54B 4ZFZA 3BPOB 1IQDA 3ILQC 4RGNC 4HIIA 3AREC 5LGJB 3SY0A 3BUYA 5D1QC 2AGJL 3S35H 3GIZH 1CGUA 1JZ2A 4K3DH 3IAQA 3P4NA 2Y5TA 3V7AE 1SBSH 4YFEA 1KT2B 3GBNH 2HKFL 2YKLL 1QFHA 4Q6IC 1UJ3B 1HKLL 3I2CH 4D3CL 1YNTB 2CO7B 3P4OB 5KTEH 3Q5YA 1G6RA 5C2BH 4APQC 5C6WH 3ZDXE 1PSKH 3QUYB 5AG9A 3DETD 5DD3H 4XNUL 2MJWA 1A6WH 3VXUD 4OIAA 1MQ8A 3O6LL 1EZVX 1QSEE 5FV1L 4B0MM 1VESA 3NCMA 3U7WH 3IXTA 1QR1B 2NY3B 4YXLL 2A6KB 3WD5L 1FO0L 4K8RL 2APXA 2DQJH 2YK1H 5DJ0B 1JTPA 3CH1A 2Z31D 4Z7NF 1WCQA 5I0ZA 4UDTB 3FT3B 3OKMB 15C8L 1AP2A 5FGCB 5C8JB 4KPHL 2VTFA 4KK6D 5F7KC 4P9HC 4QT5B 4MAYA 3CUPA 1OGAA 3PWVA 3NBNA 3D2UB 1S9XB 1V7NH 1BX2B 1DCLA 4PJEA 1PY9A 2FATH 3UJJH 4TVPE 2ZOLB 4P9HH 1YNKH 3C8DA 3CMOL 4HPYL 3P11L 1QBLL 5DURB 3BT2H 5GGVL 4BQ8A 4F15B 5CILL 2Q7YB 3JV6B 3RDTD 2GT9B 4X6FA 5D1ZA 1QUNA 4LRIC 2BVPB 2AP2A 4QHMA 3B2VH 1F58L 3H3KA 1D9KD 3O4LE 1ADQA 1MWAA 4J8RB 1G7JB 1WZLA 2BY1A 1DQTA 8FABA 4ZUWB 5BRZB 3L3DB 5DFVC 3VXMB 5DTFA 2EEDA 4Y4FD 1UVQA 4XP6L 4QRRE 3GUTB 4PRIB 1KBGH 1A7PL 3RA7L 3JTTA 4JN2A 5CGMA 5DT1H 4NBZB 4L3EB 2AJZB 4QRUA 2NNAA 4JHZA 2EE9A 1LMKA 5J7CC 4ZOEA 3CFKA 1T03H 4MD5A 1S5IL 3PF2A 4XH2B 2VLKE 2JJSC 32C2A 3NVQA 2ZKHH 3LCYA 4BSVA 3T0EE 5FV2A 1NGPL 3UO1H 2G75B 3CX2A 3FQWB 3E8UH 2Z8VC 2EIBA 5K9KB 5EORH 3BDYH 4NJ9L 4UIMB 2R39A 3VXMD 5GZND 5BXFA 2DAVA 3C5JB 35C8L 4DUVA 3OX8B 5F7UA 1JI1A