2A77H

Anti-cocaine antibody 7.5.21, crystal form ii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
219
Chain Sequence
DVKLVESGGGLVKPGGSLRLSCAASGFTFRNYGMSWVRQTPEKRLEWVAAISGNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARHDDYPYFFDVWGAGTTVTASSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin Light Chain
publication title Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21
rcsb
total genus 47
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2005-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77H01
5DC9B 1F97A 3QEUA 3WXWH 3VFNB 5CJQL 3ULVL 3K2MC 3F12A 3X3GL 5I8EB 4I5BA 3HNVL 3I3EA 5AG9A 4S1SH 3OTTA 1M7IA 2GTZB 2R69L 4XI5C 1HZHL 1LDPH 5BW7A 2VXTL 3TESA 3H3PH 1EUUA 2E6JA 3QH3A 2F19L 2V2WB 4RGOH 4IMKA 3CGTA 1W2KT 4HUNB 1HHGA 3FB5A 3B3IA 4F15B 3FRPG 4X9HA 4LNVA 2J88H 3KJ4C 4PP1C 1HSBA 4U6YA 5JOEA 4Z7WB 2IH3A 3UX9B 1A14L 4MZ3A 1FH5H 2R4SL 3BE1H 3FL7A 3WL9B 2HT2D 4QRTB 1N4XL 3BKCH 3HS0A 1HCVA 2V7NB 2G60L 4F7EB 1LNUA 1H3WM 4OD1L 1LO5B 2JB5H 5KTEH 1KLGA 4NO5A 3TN0B 2XQBL 3SGJA 1AIFA 2BSTA 4L8DB 4HHAA 4J3WA 4UNUA 3U0PB 4HS3B 1JNNH 3GI9H 3VFUB 5D7IB 4PG2C 1MF2L 3L3DA 5DZOA 2IEPA 4G3YL 1FNSH 1CLZL 3S96B 1FV1B 1I3RB 3W9EB 1HH9A 3HC4L 3VI4F 5JMOC 4HIIA 3RL1A 4DK6A 2FSEA 4X4XA 4YHNA 5FAAA 3QO0B 4AH2B 2J3SA 4YHPB 5JDJA 3QDGE 3UBXG 1NEZG 2VYRE 3HMXA 4X80H 3VG0L 3ZT6A 3BW9A 4ZUTA 2R4RL 2CMRH 4K7PL 3BMVA 4GW5B 4KJQC 1T5XA 2IMMA 2ZWLT 3MNVB 5EOCJ 4GW1B 2LU3A 3KPSE 4K3JH 3LD8C 5T5NF 1DQDH 2F74B 5C08D 4WTZA 1RI8A 2ZOKA 2OL3H 1JGEA 4UINH 4DGIH 4HC1H 2CJUH 3MRBA 2WBJB 1T5WA 3BSZH 1FFPB 2G9HA 2AK4A 2Z31D 5ID1A 1QRKA 5IW6A 1CI5A 2NY0C 2Z31C 1L0XA 3IS1X 4RAUB 4GS7C 3CUPA 3VXUA 4HFWA 5D8JL 5J13B 1PZ5B 4AL8H 1UH3A 4P9HL 3MRPB 1ED3B 4U3CA 3TV3H 3ZHKA 2OP4L 3IU3A 5FV1L 4POYA 4S1RH 3RWEA 5E6IA 2B2XH 3PNWB 1W72L 3SDDA 2V9QA 4HGWB 4BQ6A 1D5ZA 3GKWL 1UZ6F 3O3EA 4OCSL 1YC7A 2HFFB 2DIBA 4J23A 5CEZL 2FX9L 1JK8A 3FMGL 3U83A 1MREH 1FGNL 3BVNA 3KJ4B 4QHMA 3DO7A 2P5WB 1LEGB 5HPMB 3IDUA 3O2DL 5EZLB 1EJ6A 4PJDB 1UB5B 3BD4A 1JNHB 3V6ZB 4YIQA 3O6MH 4N0YL 3FB7B 3KLAB 4WTXA 4YE4L 3L9RB 2FX8H 4W4OC 5DZNA 5MP6L 1Q1JL 1YECH 1HQRB 4WUUD 5DFWH 5FKPB 2XTJD 5HVWA 3SN6N 2XTJC 3E2HC 1FYTA 4NQED 4MA3A 4TRPL 1D7FA 4DGYL 3HRZB 1J8KA 2EDLA 1A22B 4M8QB 4D0DB 4I3RL 3S9DB 3TGXA 1U8QA 4GKNA 4UIKL 1Z0MA 1MJ8H 3P73A 1CG9B 1YY8A 2VIRA 4WO4A 4JO2H 1BGXL 3QA3B 3TJHD 5F1IA 4XNYH 1IAMA 3LQZA 3TJHC 1A1MA 1YMHA 2FIRT 4XC3L 5F7WC 1PYWB 3V9FA 4KXZI 4LSUH 2FO4A 4C55A 5F97E 1Z5LB 5I1LB 3DUSA 4HQQH 5C08B 1S9VB 4JN2B 5IVOA 3FCTA 5KSBA 4ZOEA 1ZV5A 3ZTJG 3RDTD 3IJHB 3MREA 3QUYC 2RB8A 4LPTA 4X6DA 4TNWK 2NY0B 2NY7L 2Z31B 3CDGB 3MLRH 3P30L 4GS7B 1DBJH 1G7LB 4V1DD 3T4AB 5KG9B 5HDQL 5FYJD 1CQKA 3ZKXC 4PJFB 2ATKA 2P5EA 2IPTH 1FVEB 4FTVA 3SY0A 4HKJA 4L1HA 1N7ML 5J7CC 4YH6A 3QJFA 3I2CH 2APXA 2GFBA 1RV6X 5BO1L 5IWLA 4J1UA 5I0ZA 3B9KA 4ETYA 2DQIL 1T22A 1FL3A 1T2QH 1Y18A 1AD0A 1FZOB 4GMSH 5IBUB 1VKXA 3RGHA 1KJ3L 1OSZA 1I9IH 3DYMA 2CLZA 4PJ9D 1I8LC 3KPLB 1NCDH 3DROB 3LEYL 3G5YA 4JB9L 2XWTA 3MO1A 3RY6A 1MCKA 5JHLH 1SQ2N 1MEXH 1MIEL 4JHZA 1M4KA 4TTDD 4F9PC 2HLFD 3PQYE 3FQRA 4TTDC 5T5FH 3GBNL 3SJVD 5TH2A 1ZTXH 1U95B 1O7SA 3E6FA 5GGVH 3VD5A 4LPYA 2ED9A 2I25N 2MWCA 1A9BA 1ADQL 1IGTB 4WUUB 5CBAB 4DKEL 1UZ8B 1CXHA 1JV5B 2XTJB 3G6JE 3E2HB 4D9LH 2FEDC 1JPGB 3AB0C 2OI9C 1CLYH 3O9WD 1T0MB 3IYLW 5MEOB 4NQEB 4OI9A 2QQKL 2IC2A 3T8XA 4M1CD 4AZ8A 1X7QB 4WU7B 1QR1A 5CIPA 2DKUA 1NAML 1JNLH 4OB5L 1E4KC 5T33L 1LDSA 2HYMA 5A2JH 2BHUA 1U8NB 4IOIA 3WIHL 2IBGA 1N59A 4RGMC 1XR9B 4MQ7B 1M7DB 4FXKA 3HE7C 2DQCH 4PJEB 3BRFA 1MFEL 3HLAB 3ULUF 5D9SA 3T0WA 4TVPL 1A3LH 4MJ2A 1WFTA 4OKDA 4PRNA 4C57C 1BFOB 3G5VA 3EDFA 3TPUA 4FRWA 5DMYA 3VJ6B 2BY2A 5CLTA 3VXNB 4CKVX 5HHQA 4IJ3B 2Q87A 5L6YL 2YSSA 3S35H 1D3CA 4ZD3L 5BS0E 4OQTA 2OS7A 4X6EB 4KKLC 2D0FA 3BAEL 2JK5A 1NKOA 3V0VB 3MRMA 4HZAA 2ZNWA 3EYSL 4LLYB 3REWB 1ZS8A 1F2XK 4QWWD 3SDYL 1K8DB 4NNYA 5GZOC 4CVXA 4QWWC 3BGAA 4YZFF 1OTSC 4NZUH 4PUBH 1RURL 1IT9L 4WEMB 1UXWA 4EDXB 3X12A 2EE3A 3GRWL 1YPZA 1ACYH 3NFNB 3P11H 4XPFL 1I7ZA 1KPVA 3HG1E 4A2LA 2PW1B 1NGQL 1NBYB 5GIRA 3CDYA 4P9MH 1X5HA 5DD0L 3D2UD 8FABB 4RZCA 3PHOB 4XMPH 1RUML 4ZSOE 4PJ9B 2PCPA 1X4XA 4FHBD 2PR4L 2XZCH 3GMRB 5JW4Q 5IVXF 1P4BL 4LHQB 1MFAH 4KJWD 4AEIH 4XT1C 3LN4B 1B0GB 5T1MA 1T1XB 4Y19A 4KJWC 3U9PH 1SYVB 4TSAH 3OKLA 5IMLA 4OGXH 2X1XR 5F93C 3ARQA 3SJVB 4CNIA 4O4YH 3WIFA 2N1KA 4JVUA 5ESAA 5BVPL 2ARJQ 4K9EL 1OAXL 2BRQA 1RZ8B 3NCYP 4LQ1A 2PW2A 1AP2A 1OCWH 1IGML 1NCBH 1I1CA 5DJXA 2ITCA 1HDMB 4ONGL 4ZFZB 2OI9B 4MQSB 5IFAL 3V0AC 4BZ2L 3BPCA 3GM0A 3NA9L 1GZPA 4WU5A 5E2VL 1WFNA 2EDKA 5T5NG 1U8IA 2YRLA 4PJGE 3LS5H 1NCWH 5HGDB 1DANT 2VXSH 3MC0A 3HZMA 5D1XC 4HF5H 4X7EC 3D69A 1V3KA 3WUWA 4JE4B 4LDOB 4O9HH 4RGMB 1MFCL 3O8XD 4PJBE 2MCPH 4QHUB 2L0DA 3DLQR 4OGZA 2APFA 2DQHH 4GKOA 4QOKE 4QTIH 1CE1L 1CFNB 2H9GA 3BT2L 5BXFB 1OARL 2YUWA 3BGMA 4QNPF 3BDYL 3Q3GB 3WMSA 1U9KA 3GJFB 3MV8A 5I66B 4JN1H 2AV7A 1YNKL 4BZYA 3HUJB 3DX6A 2CD0A 1G7HA 3E8UL 1P1ZA 2VDRL 2RAMA 4ZO8A 1OQOA 2EDYA 1A6AB 1TQCB 3VMOA 4JQXA 1UWGL 3IJYB 1UVQB 2XN9A 4OLXH 4HH9B 5SWSA 3R0MA 4ZAKD 3TNNB 3LZFL 1II4E 3MLUH 1PG7H 1IEAA 1MPAH 3PHQB 4ZAKC 3SGKA 3LCYA 5DJAA 1OGTA 1QNZH 3SDXA 5EA0L 5A3ID 1DLFL 4UILL 1YNLL 5A3IC 4ZTOH 4LCWD 2F15A 3MRLA 5DJZB 1G0XA 5FOBB 1JUFB 1VCAA 5GS3A 3L3JA 3VFVB 1MIMH 3GGWA 5JR1H 3SGDI 3ARVA 2YC1A 4LVNC 2YKLH 2RCSL 4KZEH 3U9UA 1JL8A 2W0KA 1RK1A 5DD5L 4JGJA 5D7SL 1DDHB 3S97C 3ZT7A 1IAIL 3D2UB 3DMMD 1KTLB 3BIKA 1RZGB 3P2TA 4UTAL 3GSVB 1CE6A 5IK3A 1S7SA 2UUDK 5JW3H 3B2UD 2ZNXA 1AQKL 4LHUA 4ZPVA 1E27A 2XFXA 1GAFH 3B2UC 2AV1B 3GSOB 3HNTL 1F11B 1G6RB 2W9EH 5JXEC 1AHWA 3FQNB 3I3BA 4JFEE 1UWEH 1JGDA 1FLRL 3B43A 5B39B 5ACZA 2BFVH 3HNSL 3U0WH 2CDGA 1RUAH 3TA3C 4YHLH 2YRZA 3C09B 3HZYA 2JJTC 1WCBA 3TO2A 3SCMA 3VFWA 5EBMA 3VXRE 2O5XH 3QUXD 4MNGE 3B5TA 3MFGB 3TBYA 5D1XB 1IAII 3MRGA 2W0FB 2X4UA 5FO7A 1NGWB 4RIRB 4BQ8A 1MHCB 3O8XB 4HS6B 2ADGB 2QQNH 4NUGL 1S9YB 3HC0B 5F3HB 4WW1A 3CC5B 3G08A 4L4TB 4DW2L 1NMBH 1NGPH 3O81A 5F7EH 3RZWA 1X5KA 1IC7L 5IW3A 2AJVH 2VDOL 4YDIH 3R8QA 4DGVH 5I1JH 4ZPTB 1CGUA 2R29H 3I6GA 2EDQA 2VWEE 1X5JA 4KROC 1QBAA 2IANE 3RL2A 2VC2H 4Q7DA 2Y06L 1KEGH 2GJZA 3JWNC 5C92A 1ZGLP 5DUPH 4ZAKB 4JQIH 2GUOA 5KVMC 1NDMA 3MXVH 5CGTA 3OPZH 4WHYG 2J8UB 3MNWA 5HHPA 3OR6B 3AVEA 1UWXK 8CGTA 1EEUA 1U8MA 2OK0H 3TCLB 1DBBL 1S9XA 4GT7A 1TZGH 4KJYB 3DSFL 4AEFA 2P7TB 4LCYA 1FC2D 5TPWL 5LG1A 1RUQL 3QCTH 4U6HA 4H8WC 5C0BD 4UBDC 3STZB 5ACMA 3UJIH 1A7OL 4NIKB 4OZFG 5GRWA 1MI5E 4OF8A 4E41D 3DMMB 5D2NE 4LL9A 1PLGH 3VMPA 5ICYB 4ODXB 4ZFGH 5IR1A 1KJ2B 4XBPB 4I0PD 3BH9B 2R2BB 5JPMA 4XP9H 4HPYH 4OM1H 5I1CH 3B2VH 4JFPA 2Q8AL 1T0NB 4HIHA 3JTTB 4RRPA 4NP4L 4YX2H 3QUMH 4TUOA 3MJ9H 2E5EA 3PWJA 2W91A 4FQHB 1ONQA 1MCQA 1FGVH 1F3JB 5DUBB 4N68A 3TA3B 5D2LB 3PV7A 4MJIE 1R24A 2OR7A 3MRDA 4DVBB 3N85L 4ZUUA 2W0PA 2ZUVA 3INUH 5I30L 3QEGH 4Z78B 3UBXB 1DEEA 1B90A 1DQML 4M03A 3IFNL 1JF6A 2BVOA 1MLCA 3GSWB 3TO4C 1IQWH 1NGXB 4O2CB 5TE6H 1ZXQA 4PYGA 4GJTB 1LEIB 4D3CH 1JWUB 3QI9C 1OTUC 4P5TA 5DJYA 4NM8L 1OAZL 2D2OA 2R1YB 3SE8L 5IEHB 1DUYA 2FATH 1WT5A 3CFKA 3W2DL 5E94B 5E5RB 1QSFE 2DWDA 3VXSB 1DLHB 2VLKA 5IIEA 1IGFL 1V3LA 2BX5A 4KH2A 3UJTH 3V7AG 5ETUB 1OW0A 1YJDL 4JAMB 4ERSH 4MA7H 5DK0B 4XXCA 1T20A 4KROB 4LK4A 2O5YL 3I50L 3L5XH 3ALWA 4HKXA 3M45A 4AEEA 1BM3H 1R3HB 3MFFA 4IRSD 1E4XH 1UB6A 4X5LA 1S7XA 1GC1C 1KCRH 1DBKL 4G6ML 1C5BL 4AM0A 3B9EA 5C0EA 5SX4I 1A7QH 1Q9WA 1KOAA 2A9ML 4RQQB 1G9NH 2YPLD 3QBTB 5TGBA 2I60L 4HUVB 3OKMB 2Z92A 2VRAA 2I9TA 5DJ0A 1VADA 4PJXB 4AEHL 3ZTJH 3OGOE 5FUZH 2YXMA 2DJSA 5JXAH 3MV7E 4NM4H 4RAVB 3KHOA 5I15H 4Q0XH 1G6VK 2DQGH 4DJMA 3C2AH 1K4CA 3TBVB 4XTRD 5I71C 2QLVB 1ZHNB 4WNQB 2DS4A 3DRQB 1HILB 2E7MA 4NC2B 4YO0A 3WXWL 4M4PA 1HEZB 1HKLL 2BVUA 2JJVA 4GBXD 3NACH 4J3XA 4QXGH 1OAQL 3BP4B 3BUTA 5F3BB 5CBEA 2YN5A 4GBXC 1C12B 2HG5A 3C8DA 2W60B 1LDPL 1BOGA 1EH9A 1BF2A 2OQJB 4MAYC 4J6RH 4EEEA 4RGOL 4L5FH 1JGLH 4U6VH 1BMGA 2IAMA 1KCVH 5F96H 4WHCA 4JY5H 1IARB 4XNXL 5HDLA 2XYCA 1P7HL 5I16A 4S0TD 3BE1L 4JM2F 5CZKA 4G8GA 3BKCL 3TO4B 4NOBA 3THMH 3NOIA 3BP5A 1SM3H 1R5IB 3STLB 2R9HD 2R9HC 5FUCE 3K2UH 4K23H 3W11C 4KI5D 4WENB 5I75B 1A3QA 4WCYH 1S8DA 3T0EC 1JNNL 3GI9L 3L3HB 2WIIA 2XKNA 3EIFA 1UM5L 4YHOL 4M43H 2H32B 3ARTA 3FFCD 3MZTA 5SWZE 5IB1A 3K4ZA 4Z18A 1EAPB 1Q9KB 3O0RL 2V7HA 4WEUD 3MLXH 4NRZB 4LLUA 4GG6B 1AI1L 4R0LB 4JPIA 2QSQA 4IRSB 2WWKT 5FHBH 3DGGB 2BNRD 4X80L 4F58H 5IJKC 1WGOA 2J12B 2Z8VC 5H35B 2VITA 4NZRL 4JDTH 3T3PE 3JWDC 1ZVSA 4R3SA 5MEQB 4AG4L 3R06B 2OL3L 3BFOA 4UINL 4XHJD 4DGIL 4J8RA 4XPAH 2CJUL 2VL5A 4FN0A 5D93C 3VCLA 3P4LA 4PY7B 2BY0A 1P53A 3WNLA 3V7AE 2CK0H 2FB4L 4JKKA 5I71B 3KXFD 5ISZE 2G5RA 4BUGA 2DQJH 4V2CB 2VOTA 1EO8L 1CK0H 3SEPA 3QUZA 4MCZA 4N9GB 3TV3L 1NBQA 1LO3H 4S1RL 5FYKU 1WBZB 2B2XL 4GBXB 4OKVB 4F7CB 4MXQD 4RDQF 3W39B 4BSWA 5F1SA 3JWDH 1I7UA 5M7QA 3U0TA 1I1YA 1MCLA 1OAKL 1AO7E 4DCQB 2QKIA 7FABH 4TUJB 1WWWX 5DJ8A 1GIGL 2A83B 1UQSA 5IVXE 3RA7H 3RFZC 3GUTA 2X1OA 3KHQA 4JM4H 1YEFL 5CINH 2JJSC 4HIEA 1NGYB 3DWTA 4PRHA 3RWCB 1T1YA 1XF5B 5F6HI 5HGAB 1K5NA 3QQNA 4AENA 3EOTL 4HKBB 2GSGB 2NQCA 3HA0A 3QZWA 1E4JA 2FX8L 5L2KB 1YECL 1YEKH 4P5MA 3VXPA 3V95A 1CU4H 1G9MH 32C2B 4GW4A 5EUOA 5J6GB 4L3CB 1G7JA 5TE7H 5TJWK 3T0EB 3NN8A 2GEEA 1J1PL 3KWWA 2AEWA 4BQ9A 3VXOB 3W5NA 5IB3A 1WBXA 3KYNB 4LLQB 1WBYA 4MCYB 5I1HH 1EERB 1UT9A 5BJTA 1CR9L 2YD3A 3S36H 3TVMD 4QNPE 1QEWA 3KPMA 4XNYL 5HYSG 2H2SD 5BVJB 4IRZH 4KV5E 2H2SC 3MLVH 4OGYL 2HKFL 4LSUL 4XMKL 4XVTH 1A7NH 3EOYG 1ODAA 5BW7C 2X4RA 3UTZB 3HKFA 5DC4B 2WINA 4HQQL 1JZ6A 3CCHB 4IMKC 4LNRB 1SMAA 5TF0A 1QRNB 1XF3A 3QNZB 3JTSB 5D93B 5H94B 3QQ9D 2ICEA 4LRIC 1PBYA 3QQ9C 2PYFA 3MLRL 1GPOH 2EZ0C 2XXCB 4KY1H 3NZ8A 5ICXB 1W8NA 1DBJL 3KXFB 4UT6L 5EPMA 1V3JA 3FZUD 2F54D 1A6TA 5B38A 1K8IB 5IM7A 1AKJA 1KGCD 2BCKA 3I2CL 4UT7H 2ARJA 1DN2A 3SDAA 1FN4A 3VU2A 3SGJC 3EZJB 1Q94A 4OZHB 5FDYA 4NKDA 4GMSL 1QO3B 4WDIA 3KLHC 3Q6FB 3CVHB 3GMOB 1CGYA 3BP7A 3CSYB 5IKCA 1I9IL 5GS1C 2BNQA 4K55A 4MJ6B 4FQIH 4HGKC 4GAGH 2D7MA 3ZE0F 1S78C 5J9PA 3T65B 5T5FL 3FTGB 5I2IB 2H1PH 4FXGA 4GAJH 2EDOA 1X4ZA 1ZTXL 5GGVL 1FE8L 1W0YT 3SBWA 2OX5A 3S5LG 5C0FA 4JY4B 1TVDA 4ZNEA 4D9LL 2VLJE 2EE2A 1HH6A 4V1DE 3CFEA 5C0DB 5IGXH 5FYJE 1JNLL 3S4SG 3MRNB 3D48R 2EDJA 4P3DA 1IM3B 5HD8D 1ZLSH 4JREC 3VRLE 3BN3B 3VD4A 3V5HA 3SGEH 3U4EA 1FZJA 4NRXA 3RNQA 3TT3H 3O3AA 4K94H 3QEUB 5GJSH 4N0CD 4HG4K 2WUCH 3F12B 4N0CC 4I5BB 3MV9E 4LSTL 5CUSH 3EYOA 4ZO9A 3SDDD 5DWUH 1BD2A 5E6IC 1M7IB 4R7NA 1TTUA 2IH1B 5DD3H 5HHME 5E03A 2E9BA 5F1OB 3V4VL 5AEAA 5B3JE 2B4CH 3HPLA 3QH3B 1VPOL 2J2ZA 1CT8A 4D94A 3S35L 1HHGB 3FB5B 3B3IB 1QA9A 1SJHA 4WHYH 4AJ0A 5EU7E 3WDJA 1HSBB 4U6YB 2HFEA 3MMEA 2IH3B 4FQ2H 1RZIA 1UACL 4YEFA 1WZ1L 3HS0B 3ULUD 1MCPL 5HYEA 2DTSA 3OKKA 4MXVF 1LNUB 4NZUL 4PUBL 1AGBA 1U8HA 3ULUC 1OVZA 3TNMA 2VDKL 1NBZA 1KLGB 1R3JA 5I8OL 4NO5B 1ACYL 1FYTD 3OHXA 1AIFB 2BSTB 3DV6A 4HHAB 4OZFH 3UZEA 5DC0A 5FM5O 1E6JL 2DM7A 2UY6A 2VDLH 4JVWA 4P9ML 4JRYE 4KGLA 4G6JH 4XMPL 4XNQA 3L3DB 1EHXA 3PHSA 4XH2A 4PJHA 2CO6B 3L95A 1U3YA 4S1QL 5F6IC 3BWUC 1MFAL 1HH9B 4HIIB 3RL1B 4AEIL 4HLZG 2FSEB 4X4XB 4YHNB 5DO2D 2YZ1A 5I8CA 2G2RA 4WO4C 4TSAL 1PW3A 2AK1H 2W9DH 4OGXL 3BW9B 4ZUTB 4O4YL 2ADFH 5DEFA 3NIFF 1T5XB 1YN6A 2CKBA 2VZUA 1X5ZA 3O3DA 3AUVA 4CBPA 1LK3H 2ZOKB 1JGEB 3VGHA 2QV2A 1HNFA 3MRBB 3JVGA 3LS5L 3GSUA 5TDPB 1T5WB 4JREB 4Z95H 2VXSL 5AYUH 2G9HB 2AK4B 5ID1B 1MCNA 4O9HL 1I9RL 5EIVA 2MCPL 5IW6B 3VFOA 3S88H 3KPRA 3CUPB 3OX8A 1G6RL 3QIWA 4HFWB 4NWUL 4ZOBA 3VXUB 5HDBE 5KANI 4N0UA 1LE9A 4QT5A 2DQHL 5EO9A 2P5ED 4FTVD 4OFIA 4QTIL 5EWIH 4EXPX 3IU3B 4LEXL 3RI5F 3QSKB 3RWEB 5E6IB 3UCRA 4F2MA 1PKQA 3RZCA 2Q3AA 1TIUA 3SDDB 2VR5A 5IQ7L 3AC0A 5IWLC 4OCLC 4QRQA 3NFSH 1DFBL 1D5ZB 3B9KC 4KUZH 4R26H 3NCJL 5EC1A 3O3EB 4RDQG 4BFIA 4HIJA 3TFKD 1IGYA 4HWZA 5ACLA 1JK8B 1KN4L 3FQXA 1J7VR 3ULVF 4MJ4A 3MLUL 1JFQH 3BVNB 1MPAL 3E6HA 4JEGB 5KSUA 4QHMB 5L8LB 3DO7B 2NW2A 4D0CA 5HI5D 4WFEE 5I0DA 4YIQB 1T89A 4ALAH 5HI5C 2HJFA 3EBAA 2VAJA 4JKPH 2HRPH 1U0QA 4ZTOL 5GRJH 2AEPL 5IB5A 4P3WA 2V5TA 4PPTA 3Q1SH 5JR1L 1MFNA 3HI5H 1A2YA 4JPVL 3RWHA 5C07A 3MRKA 1FYTB 1TETL 4NGHL 4MA3B 2HWZH 5CMAA 5INCA 4KK8D 1ZWIA 2DI8A 4ZYKA 1U8QB 4GKNB 5F6IB 2GK2A 1IM9A 2OR8A 3P73B 4FMFA 3RKPA 3SO3C 2XRAH 4NHCL 5LKNA 5IW1A 1YY8B 3FN3A 2VIRB 4WO4B 2W9EL 2GI7A 2XZQH 1QFWM 2UYLA 5F1IB 4C83A 3LQZB 3RIFK 1A1MB 1YMHB 2BFVL 5FECA 1XMWA 2DBLH 3F6LA 2F53E 1RUAL 2FO4B 2UWEA 2VZ3A 5GRZA 1FORH 5IMKA 2BRRH 2QSTA 1B4JL 3G5ZA 3DUSB 4PBXA 3H3BC 2O5XL 5D5ME 4APQA 3QG7H 4NJAL 3FCTB 1N0XH 5KSBB 1U8OA 4PJHF 3D3VA 1UM6H 4HUUA 3MREB 1Q0XH 4LCWE 4MNQA 4DOHE 4X6DB 4ODVH 4YXLH 2GYSA 5GRVK 1RIUH 2QQNL 15C8L 1YEJL 1H0DA 2R0LL 4QEGA 2BVEA 2ATKB 2P5EB 4M7KL 1I9JH 1NMBL 1WIUA 4FTVB 1NGPL 4HKJB 3SY0B 5F7EL 3QJFB 2DIJA 2GFBB 4TULL 4YDIL 3K1KC 4J1UB 1F4YH 2OZ4A 2R29L 3D1MC 5LBSL 1KXQE 3B9KB 1T22B 1FL3B 5BRZE 2WNGA 4WHDA 1Y18B 1AD0B 2AW2A 2DI7A 1VKXB 4Y4FA 1OSZB 2OMBA 3WO3B 2CLZB 5CJ5A 3K4AA 5DUPL 3G5YB 4OLEA 2XWTB 3MO1B 4LKXA 3L3KA 5MERA 1QR4A 3ZYJA 3MXVL 4Y19D 3OPZL 4NC0B 2NY6C 4R96A 4L8SA 1KCUH 3FONA 4HS8H 3FQRB 4XC1H 5TH2B 2GKIA 2Z4QA 5DEZA 3E6FB 4O2EA 4GMTH 2GW5A 2OK0L 1NAMA 5E5MA 1A9BB 3RVTD 1INEH 1OP3K 3WIHA 1FL5A 4LARL 1KBGL 4OLVH 3LH2L 3IGAA 4PY8I 1RJYA 1KB5H 2PXYA 2PKDA 3SE9H 3UC0H 1UA6H 3T8XB 4IRJD 3UBXI 1QR1B 1RIVH 5CIPB 3UJIL 3T3ME 1NKRA 3AU1A 1G7IA 3KAAA 5FYJH 4IOIB 1N59B 2LE9A 1RHFA 3D39A 4ZFGL 2C3WA 4KK9D 4WWKC 5EU7C 4O5LH 4XP9L 4HPYL 4OM1L 4D9QD 4FXKB 4BK5A 4F7PA 3U30C 4OCWH 1G0YR 1YEEH 1GGYA 2KPNA 4YDLC 5CGYD 3QUML 3MJ9L 4H20L 1N8ZA 3OXSA 5D9SB 3UJJH 1OD9A 1A3RH 5CGYC 4PJ5A 4R2GC 1ES0A 2VH5H 4H8WL 4PRNB 3G5VB 1NUGA 2DM4A 4OLWL 3TPUB 4DWHA 2IFFH 1KFAH 3OL2A 3MLWH 5HHQB 2YSSB 5SWSD 4JQXC 1XGTA 3NIDF 5JOPD 4ZUSA 1KXTB 1IQWL 2JK5B 5HHOA 2CLVA 1CBVL 3SGKC 4K7PY 3LMJH 5C1MB 1I1FA 4D3CL 4XPTL 3MRMB 3EO1A 3OXRA 3GRWA 1ZS8B 3NZHH 5I1EH 3HMWL 1HE7A 4MD4A 3SDCA 4NNPH 2FATL 2MTPA 3G04A 4NNYB 4CVXB 5C0BE 5K9JH 3RJDA 3U4BH 4OFPA 2WBKA 4G8IB 3C9NA 1UXWB 4HT1H 4HUMB 4MA7L 3X12B 4E41E 4P2YA 1YPZB 1U92A 3MOAH 1I7ZB 1KPVB 3BZDA 3NAAH 5I8KH 3QIBA 3O11A 4XWOD 3T1FA 5GIRB 2YD5A 1BM3L 4RZCB 2VDPH 3OAYK 1DUZA 1KCRL 2PCPB 4X8JA 1EGJA 4LHUD 1MAMH 4PRPE 3L7EA 1CD9B 3K8LA 1CLCA 1F4XH 4Y19B 4HEPG 4XCCH 4KC3B 2EIZA 3VXMD 3OKLB 5IMLB 4X9IA 1U8LA 5FUZL 5I18H 4CNIB 3WIFB 5ESAB 1F2QA 4F7MA 5JXAL 4NM4L 2D0HA 1AP2B 2PW2B 5I15L 5DJXB 2ITCB 5C0IA 2DQGL 2X4SA 1J0YA 4MS8D 3SCMD 1VHPA 3BPCB 2GSIA 1GZPB 3S3JA 4WU5B 1GC1L 4H26A 1U8IB 1WK0A 3QRFM 5D6DC 3HZMB 4H0HB 3LEVH 3G9AB 3D69B 3WUWB 3NACL 1H9VA 3BKJH 3DVIA 4QXGL 2ZUQC 4XPGL 3WFBL 5JQ6H 3CVIH 3AREA 5EOQH 4IM8A 3BZ4A 3UTTD 4P2RE 1MFDH 4J12A 2H9GB 1IC4H 3B9AA 4L5FL 3BGMB 3MUHL 2IQ9H 3MV8B 1QOKA 4PYHA 5C0AA 3GFUA 4R2GB 1KCVL 2D03H 5F96L 3KGRA 2AV7B 5EBGA 4JY5L 3DX6B 4PLOB 3ZE0E 1FFOA 1G7HB 1C1EH 1P1ZB 2DKMA 2YPLE 3HN3A 4K3HA 4Y4HA 3DGCR 2XN9B 5SWSB 3R1GH 4YPGA 1IEAB 2YPKA 3THML 5TE4H 3VGEA 5DJAB 4WI2A 3LKNA 3CAFA 1C7TA 1OGTB 4XCYA 3MV11 3SDXB 3K2UL 1RU9H 4K23L 3F6IA 4EUPA 4O58H 4JLRA 4KU1A 5D72H 4EQ3A 2YD8A 3MRLB 3QB7C 3FO0H 4PRAA 4J7RA 3L3JB 4Z7NE 3GGWB 4LLWA 2YC1B 1IAKA 1KNOA 3MQIA 3U9UB 3EYVA 1RK1B 2VQ1A 4FS0A 4NFCA 2M8XA 3RVXC 4JM2C 5ANMA 2C3HA 3BIKB 3S34H 1VFMA 5FHBL 3G6DH 4IS6A 1CE6B 4XAWH 1S7SB 2B0SH 5E7BA 5IK3B 4NZDA 1G9EA 1MWAA 4DUVA 4LHUB 4ZPVB 1E27B 2HTKD 2XFXB 2X4QA 4M93C 2VABA 2L7UA 3SKJH 4YC2C 3RVUD 5DGRA 1AHWB 1JGDB 2H45A 1UH2A 5ACZB 3PWPA 3LKSA 4PJIE 2CDGB 4W6YB 5KOVC 4ACPA 3CFBA 3VGDA 5I1KL 1P4IH 5TFSH 3JV6A 3HZYB 4XP1H 4GSDH 3REVA 2APBA 1WCBB 2ZOLA 3SCMB 3TO2B 4HWBH 5EBMB 3VFWB 1FO0H 1BHGA 2ICES 1Z9SA 1K6QH 1WCQA 2R1XA 4KI5E 4KVNL 3SE4C 3TBYB 4HX1A 3MRGB 2EDHA 2X4UB 1QBML 5FO7B 4YHMH 1N64H 1RAMA 4P5TD 3FFCE 4NPYA 1QFPA 3JWDL 2E8ZA 4P5TC 3CLFH 4WW1B 3IAQA 3G08B 1YYLL 7FABL 2VLKD 1NFIB 1WT5C 2YXFA 3VXQA 4HKZA 4U6TA 5AAWA 1H8SA 4IOSD 5DK2A 4G9FA 3RA7L 1OW0C 5D7KD 2Y5EA 4HLZH 2BNRE 4FA8A 3OB8A 4JM4L 2F5BL 3I6GB 5CINL 4DFHA 1X5FA 2D7PA 4YDVA 3RL2B 1KJ2H 3BHBA 1HWHB 1GXEA 2GJZB 4MA8H 2RQ8A 3W9DA 2GUOB 4P57A 1YEKL 2EIDA 3T2PA 1NDMB 1CU4L 1G9ML 4OIIH 2JCCE 1GGIL 3LHPL 3MNWB 3L6FA 4KMQA 5CP7A 3HR5A 3D85A 5HHPB 1BEYL 5TE7L 3HC3H 5IT2L 3VFPA 4KVCL 1U8MB 1TXKA 1S9XB 3MUZ1 4LCYB 3MA9L 1T04A 1KLFA 4U6HB 3VI3E 2DQEH 3EYQC 1IZJA 4PJAE 1DN0A 3V5KA 43C9A 2E7LA 4TNWF 3UROR 5L7XH 4FFWD 1MQ8A 2NYYC 3WFHA 3LPWA 4IRZL 4KHTH 4FFWC 4M93B 5IR1B 3MLVL 3PGDA 2VQTA 4EVNA 5JPMB 4YC2B 2ARWA 4XVTL 5ESVA 4JFPB 3Q6GH 4U1LA 4HIHB 4TUOB 5LQBH 4LKCA 2IAMD 5DMGC 3LSOA 4X5XA 1ONQB 4JKMA 1QLEH 4ZTPL 3WLWC 1QSVA 1R24B 2X1PA 4UDUA 4ZUUB 1GPOL 4KY1L 4M1GH 4XBEH 4GH7B 1DEEB 4G8GD 5GXBB 1JYWA 2BVOB 1MLCB 3TBSA 4B7IA 4RWYH 4RGND 2FO1A 2Z8RA 2DICA 1ULVA 4P5TB 5DJYB 3CFCL 4M3KB 2VDMH 3EZ8A 2QADC 2Z0BA 5IEKA 1DUYB 5ITFA 4C54A 3CFKB 3BZFA 4Q9QH 1BQSA 2DWDB 5IIEB 5C0ND 2VLKB 5CD3A 1OM3H 1VFOA 5C0NC 12E8H 1OGAE 1ZGLA 1U8JA 5GS2H 4OFDA 1T20B 3I9GH 2R8SH 3UTSD 4HKXB 3OG4B 2AEQH 3DUUA 2OJZH 3MFFB 1UB6B 6CGTA 5JDSA 2FHCA 1S7XB 3IDIA 2H1PL 3DXAA 4GAJL 2Q20A 1NCCH 4M6NH 2B8OT 4AM0B 1FRGH 5C0EB 3C5SA 1Q9WB 5FDWA 1ZLWH 3DETC 3DHMA 1B4RA 5TGBB 2FGZA 4OBSA 3ILQC 2Z92B 3GNMH 1I1AA 1P69B 4OV6F 5DJ0B 2I9TB 2PYED 5DT1H 3H0TA 4HG4J 1DJSA 3DARA 2J6EL 4OAWA 4DKFH 3C2SA 4GOSA 1FAIH 2F54E 1KGCE 1BQHG 2D9CA 1K4CB 4WV1A 1NCAL 3QHFL 4K94L 1WEJH 3QUZD 2WQ8A 4YO0B 3HMXL 2IALA 2BDNH 5LAXA 3FB6A 3RWDA 5BMFL 2WUCL 4YXKH 2YMXL 5CUSL 1GHFL 4UB0H 4FFYL 5CBEB 5C0CE 3QNXA 2HG5B 5DD3L 1JWSA 5I1GL 1BOGB 1CTNA 5FA3A 2F8VA 3ZKQD 3WFEH 4PV8A 3BGFC 1DP0A 1AQDA 4UOJA 1KCSH 4M6AA 3R4DA 4ELME 4F57H 2IAMB 5JA8B 1XT5A 4NQXA 4PRHD 1K4DA 5I16B 4FQ2L 2DJ4A 2WM0A 3I3DA 4AY0A 4G8GB 1VGEH 5DTFA 3QRGH 3LV3A 1MLBA 3A67H 3BP5B 3BRDA 4RGNB 1KLUA 1B2WL 3MLPA 3B9VA 4UU9A 1U41A 3U2SA 3V0WH 3VRJA 2C9AA 2P45B 5KW9H 1S8DB 3QNYA 4G6JL 1F6LL 2WIIB 2XKNB 2VDNH 1R5WA 1T3FA 5J3HD 3H6JA 2AAVA 5IB1B 3BQUA 43CAA 4WFFD 3PG2A 1DANU 3MR9A 1MRDH 3ZE1E 4Q97A 2V7HB 5D1QD 4AMKH 1Q72H 4LLUB 3O2WH 2VJXA 3GDBA 2Y9RT 4JPIB 4PJCE 4RMRA 4CN4A 2AQ3A 2IG2H 2X4PA 3CLEH 4KJPD 3LKOA 2OL3A 5CILL 5GZND 2VQUA 3PF2A 4HC1A 4LVHC 5GZNC 4U1HA 4MVBD 4U3HA 2VITB 5GHWH 3T2NH 2OCFD 3IRPX 2O61A 4P4KA 1ZVSB 2ZJSL 1JGVH 3CD4A 4X99A 4R3SB 1HINL 1LK3L 2HFGL 2AJUL 4HIXL 4J8RB 5HVHB 2VL5B 3FO1A 1R6VA 1SBSH 3VCLB 5AYUL 1SY6H 2MCG1 3S88L 3HCVA 4BJLA 5TQ0H 3VGAC 4MYWB 5EWIL 1AKJD 3QUZB 4MCZB 2YN3A 1B0RA 3OKDA 2VO5A 4Y4KA 3SDAD 1DQLH 1L9NA 4LASH 3VDCA 4KFZC 3IJHA 1RIHH 2XNAA 4PRID 3SDAC 4BSWB 1I7UB 1WF5A 3U0TB 1I1YB 1QHPA 3M17A 2E7CA 2QKIB 4R26L 4KUZL 4C56A 3S3SA 4F3FA 1PQZA 3BGFB 2EDRA 3X3FL 3W0WD 5DJ8B 1TZHA 3NABH 4M62H 1UQSB 3GJFK 4W81A 3ZDZE 5FYLD 3VD9A 2Q3ZA 3A6BL 3Q48A 2LQRA 1JFQL 3GUTB 2NXYD 4YPJA 4HIEB 3W5MA 2I26N 3DVFA 1UJTA 4PRHB 1T1YB 1U3HD 1XH3A 4XNZC 2ZPKH 4ALAL 1K5NB 4AENB 2HJKA 1KPUA 5DHXB 1EVTC 1UJ3A 4HK3J 4JO4H 4Q58C 3QZWB 4I9WD 4RA3A 4P5MB 3LS4L 3VXPB 3HTLX 3SBWC 3Q1SL 4GW4B 5EUOB 4X6DE 5LGHH 3TWCH 5GS0D 3MLTA 4BSJA 1NMAL 4WGVB 1G7JB 4LLVA 3NN8B 5HYQA 2I9LA 1KT2A 4NQVA 2HWZL 5BV7H 4QGYA 4M6MH 4HSQA 1OLLA 1WAAA 3BN9C 3KWWB 3ULVD 4W4OA 5HI3D 3ULVC 4ELKA 5IB3B 3BRGC 3PP4L 1WBXB 5HI3C 2JJWA 3TBWA 1WBYB 3AS0A 4HUKB 3OKOA 5BJTB 4LQFH 5HGBA 1D6VH 2XZQL 5L2JA 1QEWB 3KPMB 3P9LA 1CXKA 3KPNA 1BD2D 4NQDE 5I73C 2VXUL 4LVHB 1EFXA 3UYRH 2DBLL 3DIFA 1N26A 1QD0A 3O4OB 2BRRL 4CAGA 2X4RB 1OSPH 5FM4A 1MCIA 2Y07L 2WINB 4EUPG 3GMPA 1XF3B 1N0XL 4DTGH 1UM6L 2ICEB 3BJLA 1Q0XL 3M8OH 2YPVL 4X6BA 1YMMA 4POUB 4ODVL 3RUGA 2GCYA 4YXLL 3BZEA 2PYFB 3NZ8B 5F7HA 5ABDE 3VGAB 1BQUA 3RAJH 1W8OA 4L3EE 2FL5A 1RIUL 4JFZH 4OZIE 3VFGH 4CMHC 4F7TA 5EPMB 1DBMH 3DJ9A 2Q76A 4UOW0 1A6TB 5B38B 5IM7B 1AKJB 2BCKB 2ARJB 3SDAB 3ROOA 3QUYA 1LP9A 1FN4B 1T66D 1F4YL 1Q94B 5GISH 4NKDB 4WDIB 5KBNC 1KJMA 3BP7B 5IKCB 1ND0A 1ZEAH 4OQTL 5DD1H 4TSCH 2BNQB 3WS6C 5DMKA 1GOGA 1LD9A 2F5AH 4QRPA 5DLML 1P5UA 4XNZB 4DAGH 2YRPA 4N1EA 1CYGA 4OT1H 5J9PB 3MCLH 3PP3K 4FXGB 2DKSA 3DI2B 1J86A 4YQXH 5HHNA 3ZDYF 4XNUH 4LIQE 1I8LA 2NY2D 1CDBA 4GMTL 2FNBA 1EFQA 3A6OA 2NY2C 5T1DH 1INEL 5C0FB 1OTTD 4WI6A 4FZEH 4QRRE 3H3KA 1RZFL 4LSSH 1KB5L 3QPQD 3UC0L 4FQXA 5I9QB 1HH6B 4M48H 3CFEB 1RIVL 3QPQC 1V05A 2YR3A 2YK1L 3JVGC 1QZ1A 4P3DB 3MROA 3V5HB 5DS8A 1BP3B 3U4EB 1FZJB 3KPRD 3QIWD 4G43A 2VISA 4NRXB 5FGCB 3RNQB 4LOUD 4O5LL 3O3AB 5F1KC 3GBMH 4EI6A 5CEZD 1YEEL 4OLUH 2VXVH 1WTGT 5I73B 3EYOB 3UJJL 1A3RL 1BD2B 2EDWA 4R7NB 3RZCC 2DQFA 1SHMA 1GGCH 4MQTB 3WEXA 3HPLB 1GOHA 2IFFL 4YGVA 4ZS6C 3MLWL 5IF0A 1CT8B 4TPRL 3HE7A 5JPNA 1WAAF 2VLRD 1JRHH 1A7RL 1QA9B 4B50A 3QQ3A 4TNVF 4Y7MA 1SJHB 4FP8H 2HFEB 3J8F7 3LMJL 3MMEB 4H1LH 5IUSA 5CZVL 1T89C 4CMHB 1RZIB 2VDQH 3LB6D 3NZHL 5I1EL 1XGQA 4DEPC 4Z5RA 5K9JL 2BOCA 3IB4A 3OKKB 1AGBB 2X44D 1U8HB 4GKSA 1BJ1H 3MBEC 4HT1L 3TNMB 1NBZB 1R3JB 3BIBX 1WUNT 3OHXB 3DV6B 3MOAL 1OWRM 3NAAL 5I8KL 5IFHL 2Y6SD 5KVFH 5F7KC 4LGRB 1LE5A 2VDPL 4D9QE 4XNQB 4GXUM 4WUKL 4TUKH 4XH2B 4Y8DC 4BYHA 4PJHB 1D5IL 4JZJC 3L95B 1IM9D 1CD8A 4YWGH 1MAML 2KZWA 3QDGA 1XGRA 2IF7A 3FAXA 3SKOA 4UZGA 2D7OA 2VUYA 1IKFH 3N9GH 2VAAA 2Y25A 1JI1A 2NR6D 4BELD 5I8CB 2G2RB 4XCCL 2ADJA 4NDMA 2NR6C 4QHNA 1IAOA 3QYCA 4U1IA 5I18L 5CEYA 3EFDH 2NY2B 2HVJA 1LP9F 5DEFB 4JG1H 3WNNA 5JOPE 1QFWL 2CKBB 1YN6B 2OR9H 4ZMAT 1FBIL 3O3DB 4N5UA 5IP4A 1U93A 3MUGA 4HD9A 2X89A 1UEYA 4APQD 1JNJA 3C5ZA 4I3GA 1MRFH 3GSUB 1KEML 4M7JH 4WJ5A 1ORQA 3EJZC 1QSEE 3OR7A 4LF3A 4OSUH 5CP3H 5JQ6L 4IIQA 3VFOB 3CVIL 1LO0H 3KPRB 3QIWB 3OX8B 4OLYH 4Z0BL 3KS0J 4N0UB 1LE9B 4QT5B 1NANH 5EO9B 5CHNA 2DMBA 4LGSB 2DLFH 2JELL 4LSRH 2KQNA 3IXTA 5J06A 2IQ9L 4F2MB 1PKQB 2DRUA 3RZCB 3BWAA 2D03L 2CRMA 2HN7A 4NCC2 1S7WA 5C6PB 1QFWI 3VE0A 4QRQB 3RWJA 5EC1B 3H9HA 3OB0K 4BFIB 4HIJB 1FPTL 4DKAA 1IGYB 4G8EA 4HWZB 3IVKA 4Y4FC 3O6LH 4NJ9H 3RX8A 3FQXB 5KSVA 3VXME 5IOPA 5ADOH 3E6HB 1JZ3A 5KSUB 4LBEA 2NW2B 4XPHH 4D0CB 1NC4A 2Q7YA 5F9OL 1DE4A 2P1YA 4CDHA 3O6KL 2HJFB 1V7NH 4O58L 4DEPB 5I74C 1YY9D 2LVCA 5IB5B 1QFHA 3QDAA 1YY9C 3P9WB 2FLBT 1A2YB 2PXYD 3RWHB 5C07B 1HOCA 3MRKB 4EKXA 1CZ8H 4RFEA 1MCEA 2YUVA 4NC1E 3RU8L 4JDZA 3UTTE 5CMAB 4EI5A 5DQDH 3FRPA 5INCB 1ZWIB 3S34L 3G6DL 4ZYKB 4J4PA 4XAWL 2B0SL 5A2FA 3D39D 4GQ9H 1U3ZA 1QYGH 4TVPD 1IM9B 3ZZ1A 4JR9H 3K81A 5IW1B 4ZQKA 1NC2D 4UT9L 5DDHA 2UYLB 4R8WH 1BX2A 1RULL 1Y6NR 4HWNA 4C83B 4PJ5D 5FECB 4HXBL 1BBJA 4PJ7E 5KVEH 4HLJA 3CZFA 2UWEB 1IKNA 1ZVYA 1OY3B 4KRPD 3RNKA 1P4IL 5TFSL 2YZ8A 3G5ZB 4GSDL 1HHIA 4GRWE 1CVRA 1FO0L 4APQB 1MJUH 4HDIA 1U8OB 3D3VB 1GL4B 4HUUB 5HHOD 3KYOA 4E42A 1TJGH 4MNQB 2ZKHH 5GGVY 1CQYA 2IADA 1N64L 1F42A 2GHWB 4X4ZA 1W0WA 4Q74A 4TOYH 4GRLD 1H0DB 4KKCD 2JJTA 3CLFL 3HHRB 4OD3H 3SDCC 4PB0H 4X7FC 5B4MC 1NEZA 4KKCC 4UQ3B 2XQYK 4W6WB 4I3SH 1F3DJ 2W59A 1CL7L 1I8MA 3D25A 3QIBC 7CGTA 4JFDE 4Y4FB 3BKML 1P6FA 2D3VA 2ESVE 1I75A 2X1WL 5ILTH 4MA8L 4U7MA 4BQCA 4XMLH 3KPOA 2AJYL 3H42H 3PQYA 5HJ3A 3CFIC 4NQUA 5GQBA 4ORGA 4LKXB 3L3KB 1J9CT 5MERB 1MNUH 3I6LD 1FDLH 3QCUL 4PJ8A 4NKIH 4OIIL 4R96B 1IGIH 4L8SB 3OJVC 1FG2A 3FONB 5I74B 3E3QC 2NXZD 3G6JA 3HC3L 4Z9KB 2Z4QB 3X17A 2NXZC 3C6SA 4O2EB 3G5XA 1BF8A 1NAMB 5E5MB 4LIQH 1ZKAA 1XIWA 2DMKA 1C5CH 3LVEA 4MX7A 4D0BA 1FL5B 2A0LC 5F6HJ 5KZCD 5IHUL 4OCYH 3IGAB 1RJYB 2PXYB 1LO2H 1CL7I 4Y5VA 4CJ1A 3V8CA 1BAFH 3AU1B 4FMKA 1G7IB 1M71A 2YD7A 1C8PA 5L7XL 3C6LC 5FYKH 3QUMA 4JFHE 3MJ9A 3ARED 1KELH 3D39B 3AREC 1MCDA 5DVMA 1ZSDA 2BJMH 2BP3A 2UY7A 4F7PB 2E3VA 3DX9A 3Q6GL 5ALCL 2F9BT 4HW6A 1JHKH 3IU4H 4NNXA 5C0AD 5LQBL 1N5AA 1N8ZB 2VXQH 3OXSB 4XP6L 5I1IL 1D9KD 4PJ5B 5F70A 3PGFH 3VMNA 2FH8A 1ES0B 1QLEL 5BS0A 3BPOC 3ZTNH 1A4JA 1CFTA 5E08H 4M1GL 4XBEL 1BPVA 6FABL 4JHAH 2O5ZH 1HHKA 4U0RC 4Y4HC 4MLIA 1XGTB 4AIXA 3BDBA 4ZUSB 2JIXA 3S7GA 3ZYZA 2FD6H 2CLVB 3EJYD 4RWYL 5HHOB 1I1FB 3EO1B 3OXRB 2VDML 2BVPA 4LPUA 4Y5YA 4H5SA 4MD4B 5GGQL 3SDCB 3G04B 4JRXE 5ADPH 3IF1A 3C8HA 4Q9QL 3HG1A 3FOLA 3V6OE 1ZHBA 3DUHA 3C9NB 1ORSA 3RGVA 4RNRA 1EZVX 1U92B 1QLRA 3I9GL 1R3IH 4R4ND 3QI9A 4ZSOA 1RVFH 1L6XA 4PGDA 3QIBB 2DM3A 3O11B 3T1FB 2AEQL 2GIYA 2OJZL 4H0IA 4KMLB 2V2TA 2V5SA 4GRMA 1DUZB 4BZ1L 3LQAC 3QDME 4JQVC 5MEPA 4X8JB 3IDNA 4M6NL 2ZCHL 3X13A 4YLQT 2HKHL 3O6FD 3FKUS 3L7EB 2FWOA 4JY6A 4KTDH 3CSPA 5KVDH 1FIGL 5IB2A 1ZGLM 3GMNA 2EIZB 3N50A 1U8LB 5DT1L 1QPXA 2NXZB 2CXGA 1MCOH 3PWPD 4BK4A 3K46A 4K8RH 4F7MB 5DMIH 5CKGA 4PLNC 1ZLUK 3NMEA 4DKFL 2MKLC 1INDL 4M61A 1C16A 3JUZA 1FAIL 1N6QH 1PFCA 4PJGA 5C0IB 4FABL 1EK3A 2X4SB 4GLRI 5C9JA 1JJUA 5KZCB 1U42A 4OTXH 3O4LE 3LQAH 2GSIB 5DQJA 1YUHA 4H26B 4PJBA 3FRUA 5M94B 3EO0A 1EBAA 2BDNL 5GGRA 1P9MA 4QOKA 4UB0L 2JJUA 2P8PA 1L4IA 2BSRA 3AREB 2HT4D 4EDWH 3BZ4B 3KJ6H 3UTSE 2VKWA 5MENE 1T03H 3IFLL 3G6JF 3H9SD 3HB3D 2D7TH 4XWGH 4G9FD 4ODHH 2Z9TA 4ZXBC 5C0AB 4F57L 3BPOB 1FFOB 3F7QA 1AR1D 4O02H 4JGUA 3LAFA 4Y4HB 4P3CH 5D7LE 4XCNA 3ZDYE 4MAYA 3EDDA 5IROA 3JWOH 1VGEL 3NTCH 4Y1AD 2PYEE 4YPGB 5AUMA 2YPKB 3A67L 5TDNB 4WGWB 3LKNB 4XVUD 5DSCA 3MRHA 4HK0A 4XCYB 5DD6A 3D85D 1PKOA 1H8NA 4EUPB 2C4XA 4JLRB 5KW9L 4KQ3H 1KPRA 2PNDA 1F6FB 4PRAB 2CR6A 1DSFH 1U2HA 4LLWB 1IAKB 1KNOB 1MRDL 4CUCA 3TH3T 4AMKL 3EYVB 2VQ1B 3O2WL 2FH6A 1GGUA 4I1NB 1NSNH 3C60A 5ANMB 5IMOA 4ODTL 2E7LC 3UPRA 2X70A 5F9JA 4IS6B 2IG2L 3QQ4A 5ERWA 5J57B 5SX5K 1MWAB 2NY3D 3VD7A 5HY9A 4JFEA 2X4QB 2VABB 2IQAA 4X6CF 2OXGA 5EU6E 3MV01 5GHWL 1NFDE 5T3ZL 3MA7A 1ZANH 2EYTA 3G9VA 1JGVL 4RMSA 35C8H 4M7ZC 3PWPB 1CFVL 3LKSB 2ZSVA 2JTDA 1Y6MR 3VXRA 5IJKA 5I19L 2FYYA 4MNGA 3CFBB 5CJXA 1TENA 3QR2A 3V52H 4RAHA 2N56A 4M7LL 1JPSL 2FBJH 3JV6B 2RBLA 3REVB 1UKQA 2ZOLB 5TQ0L 4DN3H 4GRWH 2DQDH 4NQCE 3VGGA 2R1XB 1RFDH 4HX1B 4P48A 4YFLI 3WXVL 1QRNA 1EMTL 3T2OA 2UVEA 2GJ6E 4GAFB 4P5KA 3TYGH 1RIHL 4NPYB 1A7PL 4R90H 4LP4A 3EOAA 1J87A 1X4YA 5C0GA 3VXQB 4HKZB 4KKBD 2NY5C 2VSDA 2IANA 5ITBH 4M62L 5DXWA 5DK2B 5HBBA 4G9FB 4KKBC 4ZG1A 1FZMA 2P8MA 4A6YH 3UTPD 2V17H 4YDVB 3BHBB 4PJBF 2ZPKL 5A43C 3RKDD 5KN5A 4MMZC 1PY4A 2C1PA 3IDXH 4JO4L 3Q6FA 3RKDC 4KAQL 3N1PC 3B4NA 3W9DB 4P57B 4RISL 3LRHA 2PTUA 1L0YA 1WWCA 4PR5A 5LGHL 4LSVL 3L6FB 1E4WL 4PGCA 2NY5H 5CP7B 3HR5B 1I1AC 3D85B 4DUWA 3WFCH 3NGBB 1S7TA 3VFPB 4J3UA 4OZGE 3HFMH 1AXTH 1LQSR 2DLEA 4YUEH 2LTQC 4NFDA 4BFBD 4GAYA 4KZDL 3QDJE 1T04B 1MI5A 4GFTB 3WO4C 3ZYOA 1KTDA 4UI2A 5LVEA 2V5YA 5D2NA 4PRIE 3QG6A 4WV1C 1DN0B 3V5KB 43C9B 3T04D 4LQFL 4ENED 1JZ7A 1D6VL 5DURD 1A6VH 1KC5H 1RUKH 3W0WE 5H2BA 3TH2T 3MRNA 4XAKD 3WFHB 3H9YA 3I75A 5HPOA 2NY3B 2DYPA 3PGDB 3TYFA 3ESVF 4EVNB 2QHRH 1UADC 1J05A 1LILA 4U1LB 1JPST 3ORJA 4MJIA 4MMXC 4HPOH 4M7ZB 1RUPH 4ODWA 2MNUA 4LKCB 4LU5H 1CF8H 3LSOB 4X5XB 1JN6A 1I1RA 4DTGL 5E8PA 2QTEA 2XXMB 4XI5D 1KV3A 4RMQA 4MLSA 1F4WL 4XPBH 4N8CH 4UDUB 3FOMA 2MPAH 2IH1A 1FZKA 1SEQL 2UUDH 5D7JA 5B8CA 5DVOA 1JYVA 5EO1B 2Q6WA 3VFGL 1DBML 5AZEH 4IDJH 3AS3A 1L9MA 4POZC 5EBWA 3TBSB 3TT1H 1J11A 2F8OA 2R0ZL 5GRUH 3ECBA 1OP5K 4PP1D 2C7UA 3NPZB 1QSFA 2P5WD 3VH8G 1HYRC 4LRIA 2X1QA 3ZMRA 1ZMYA 5F7YC 2FJGA 2HT3C 5DRXA 5IEKB 3D18A 5ITFB 3BZFB 3KPPA 3RPIA 5CD3B 1TVHA 3BQUD 4N5EC 4TSCL 1ZGLB 1U8JB 3BQUC 3FT3A 1NLDL 1BD2E 3MJ7A 2A73A 4N9OB 3DSNA 2P47B 2W92A 4MD5A 1CCZA 3BISA 3DUUB 4DAGL 4JJ5A 4Q6IC 4OT1L 5JDSB 3ZLQC 4L4JA 4WHTA 5KSAA 5GGRY 3IDIB 4BH8A 3MCLL 4ESKA 1RY7B 3DXAB 3WNPA 1FIEA 4YQXL 4XNUL 5C6TH 5GS1A 1MJJA 1WIOA 3C5SB 2EIEA 2J6EA 5FDWB 3ZKND 5T1DL 1S9KC 4HUXA 3MV7A 4FZEL 3BP6A 3ZKNC 3QXDB 1I1AB 1MCBA 4LSSL 4P4KC 5LCVH 4IMLA 1BFVH 3H0TB 3ARDC 2N7BA 4P2QE 4OAWB 4KJQD 4JPWH 3GSNH 3WO4B 1ZHLA 1JZ2A 4WV1B 4TQEH 4JHWH 2W0LA 1UYWH 4YFDB 5LAXB 2IALB 5DFTA 3FB6B 3RWDB 3F62A 3ZL4H 5DURB 3NH7L 2BK8A 4OLUL 5F89A 1WSST 2VXVL 4OCRH 4Y4KC 2CKBL 5TDPA 4K71C 4RMUA 4PY8J 1UWXH 3QNXB 3N0PB 3OG6B 1I4FA 2NY0D 3MNZA 1JWSB 4C56D 1BVLA 3MOBL 4Q2ZA 5E9DE 1GGCL 4XX1G 1R3LA 4JFFE 4LAQH 5FA3B 4MQXC 4PV8B 3V4PH 1AQDB 3ZE2E 5E2WH 1IC1A 3QHZH 1JRHL 2CUHA 3EHBC 1J8HE 1ZOXA 5HGHA 1EDQA 4NQXB 1QPPA 5DUML 4P23A 4PIRF 4RBPK 1K4DB 1HN1A 5EN2A 4KWUA 4ZS7H 3MRFA 4OZFA 1KXVC 5DTFB 1UJ3C 5D96C 3LV3B 1MLBB 3OAZK 1YQVH 1J0KA 1EHNA 1KLUB 4JGMA 4UU9B 3U2SB 5ALBH 3AY4A 5SWZA 3VRJB 1BIIA 2V2XA 3ESUF 1YNTA 3QNYB 4L29A 1T1WA 3PDDA 1R5WB 1T3FB 4TUKL 2AS5M 1YEGL 3FFDA 3BQUB 43CAB 2OBGA 3MR9B 4YWGL 5HGGS 4LEOA 4OV5A 3BYYA 4JZOA 3AXLA 2DLIA 3N9GL 2HH0H 5ENWA 2X2YA 5C09E 4JCLA 2X4PB 3MYZA 1XEDA 3LKOB 3QWOA 2OL3B 1EFXD 4LLMA 5F8RC 4ZO6A 2VLRE 3UYPA 4MDIA 5DRZA 4U1HB 2OR9L 3IXAA 2O61B 4P4KB 3V6FA 3UEZA 4X99B 4B41A 1CICC 4LVEA 1UM4H 2I5YH 5ISZA 3U6RA 1MRFL 3TC9A 3FO1B 1DVFC 4M7JL 4X6FA 4B0MM 1YMMD 3V6BR 1FCGA 4F9LC 2CSPA 4Y2DA 3AAZA 5J1SC 3WBDA 5D71H 3HCVB 4OLYL 3LD8B 4Z7WF 1B0RB 3OKDB 1MVUA 1AO7A 3PV6A 1LEKA 1UXSA 4Y4KB 5CKAA 3QUYD 4CU8A 1J0JA 2XNAB 2HA1A 4L4VE 5IVXA 1IC5H 3M17B 3HAEG 3DURA 4C56B 4F3FB 1PQZB 1A6UH 1TZHB 1GCFA 4LPWA 2UVFA 3N1QC 1RZKC 5JIHA 5KAQF 5ADOL 1I9EA 1EEYA 2Y36H 5J11C 3OF6A 4C59B 4OJFH 1MHEA 4XPHL 4DUXA 1MCWW 3WIIH 2UWEE 1A8JH 4HAGA 1XH3B 4QLRA 5L88L 2HJKB 1KPUB 1JI2A 1UJ3B 1DR9A 1NLBH 2YWYA 1IVLA 1BWMA 3L3IA 2A9NL 5J0BA 4GG8A 2AKRA 2OZ4L 1QVOA 3MLTB 4FQXD 1JHLH 1CZ8L 4LLVB 1RZKH 5E2UH 5HYQB 5KJRL 2I9LB 1KT2B 4FQXC 4NQVB 1CDYA 4XX1E 3QULA 4ELKB 2FJFA 1TITA 4GQ9L 4K3EH 1QYGL 4WWID 4WY7H 3TBWB 4KUCD 4F80A 2FEDD 4QXUH 4JR9L 2XG5A 5TF1H 3OKOB 3RTQA 5HGBB 5K33A 2NPLX 5L2JB 4PLJD 1IFHH 3P9LB 4FOMA 4R8WL 3KPNB 3WJLA 2MJWA 3SOBH 3BD5A 4PLJC 3GO1L 5K59F 1EFXB 3R8BB 4LPXA 1MAJA 3DIFB 5CEXA 4Z8FL 1WFUA 5T3XE 1AY1H 4PGJA 2Q8BL 1CXIA 2Z8WC 3B6SA 5CS7A 5CJOL 3HE7D 5DF0A 3D0VA 1MY5A 1MQKH 1MJUL 3GMPB 4X7CC 2WUBH 1XF4A 3WKMH 1U6AH 3MBXL 5GGTH 1F8TH 4X6BB 1YMMB 3BZEB 2EYSA 2GCYB 2W65A 3N1GC 3RUGB 4EN3C 2RIKA 2FL5B 3CFJA 4F7TB 1HXYA 3ARBA 5GS0H 4PB0L 2Q76B 4PJDF 3T3PF 4KKLD 3QEQE 3PXHA 3C5JA 3ROOB 3MYJA 3QUYB 4I3SL 1LP9B 2DQTH 3IETA 4JRWA 5JW4N 1KSRA 4I0KA 5JHDE 3HNVH 4QYOA 4X4YA 1T0PB 4CU7A 5GZOD 2R69H 3ZKXB 1KJMB 1OTSD 1ND0B 2AJXL 1YEIH 5ILTL 1JZ5A 4XMLL 4Z77A 2DL9A 3H42L 5DMKB 5J11B 1P7QB 4G8IA 3QDGD 4X6CE 4XP5H 1S5HA 4MD0A 5D1ZC 4NRYA 1LD9B 1FDLL 4QRPB 4UNTA 4NKIL 4ZO7A 1IGIL 4B5EA 3RDTA 3QCVL 1T2XA 1KB5A 1IEBA 2CIIA 3F58L 1PX3A 3LRSA 5HHNB 2R4SH 2VLJA 1VESA 4V1DA 4LSPH 5HHOE 3VXTA 2A1WH 5EZOH 4U6XA 5KVGL 1ACZA 2X89D 3N1MC 4OCYL 4OD1H 1KIPA 4FQXB 4JZNA 4WFHD 2AABH 4NBXB 2XQBH 4YBQD 1BAFL 2NX5E 3C5ZC 1EGJL 3RHWF 4YBQC 3MROB 5FO9A 5FYKL 1Y6KR 4MDJA 5DS8B 5F88A 3QXAA 4BKLA 3QXTA 1KELL 4G43B 2VISB 3MV9A 4IIQC 3AB0B 4QO1A 3FQUA 4EI6B 3HC4H 3IU4L 5D1XD 2WBWB 1HI6A 3CK0H 3PGFL 4J3TA 5KS9E 1Z3GL 3VG0H 2DQFB 1UKSA 4HV8A 4WWKA 3WSQH 3DO3A 3WEXB 5E08L 2R4RH 4YGVB 5HXMA 4L4TD 2O5ZL 5IF0B 2P44B 3MRCA 3HE7B 1J1OH 5JPNB 2NTFB 3QQ3B 3U48A 1JZ8A 4DK3A 4RWHA 4KQ4H 3O9WA 2K7PA 4LLDA 4I2XA 2AERT 5E5UB 4KV5F 4OCMC 2IPKA 2ZG2A 3H2WA 1XGQB 3H7LA 4Z5RB 5HYSA 2BOCB 5D8JH 4GKSB 4JRYA 3ZSSA 3FN0H 4P9HH 4BA8A 1AE6L 1R3IL 3F7YA 3RRQA 5E99H 5HSFA 3NA4A 4F37F 1W72H 4EI5D 4KK5C 1LE5B 3UXFA 4J4PD 4EI5C 1VGKA 2XA3A 2CLRA 3GKWH 3V5DA 1E6OH 4N90D 2FX7L 4J4PC 2AVGA 2FX9H 3QDGB 1XGRB 3SKOB 1F00I 5KVDL 4PV9A 4XXDA 2VAAB 5E8EA 2NZ9C 2ADJB 5H37G 4EOWH 4NDMB 3O2DH 1M6OA 4QHNB 1IAOB 1QG3A 1MCOL 4U1IB 1Q8MA 2OTUA 3R0NA 5CEYB 2HVJB 4N0YH 4BFGA 4OIAA 3NIGE 1N6QL 3ARFA 5DFVD 5MP6H 1CGVA 1Q1JH 3MRQA 1IKNC 1U93B 4KXZH 5DFVC 3MUGB 5IESL 2EKSA 5JXED 2A2QT 3WD5L 3LQAL 1WWBX 3BKYL 1N2RA 3C5ZB 4H25A 2PO6C 1MWAL 3I6KA 4WJ5B 1ORQB 1NDGA 2Q86A 1JMZA 2R2EA 3TA3D 3OR7B 4LF3B 4DGYH 4IIQB 3TIDA 4I3RH 3STBA 4LMQI 5CHNB 1T03L 5EIIA 2A38A 3IXTB 5D6CA 5D6DA 2GK0A 2IGFH 3SKMA 3S5LA 3BWAB 1KJVA 4YDKH 2HN7B 1S7WB 5HHXH 3VE0B 4ZFOL 3RWJB 4HMEA 3VRLF 2FZ3A 3H9HB 5E95B 4RMWA 4XVJH 3DPBA 4G8EB 1T2JA 4OF0A 4P3CL 3IVKB 4QY8A 3VXSD 5FA4A 3S4SA 2DJUA 2B1HH 1NFIA 5IHZA 3JUYA 5KSVB 5IOPB 4LPVA 5JLZA 1FVCA 2B20A 4LBEB 4PJ8D 5F9WC 5KAQG 4KROD 1NC4B 4PJ8C 2Q7YB 1DE4B 4OM0H 2X4NA 5B3JF 3ES6A 4FFZH 3P30H 4KQ3L 3IJSA 4Z0XA 1EJOL 1XIWD 5J6HA 5HDQH 1U3JA 2NLJA 4YHZH 1XIWC 3WJJA 2IPUK 4NO3A 4JCMA 1N7MH 1HOCB 5GGSA 5EU3A 4RFEB 4ODUA 4Y5VC 2BY3A 4JDZB 4CMMA 4Z7UE 3LOWA 4AQOA 4EI5B 4EJ1C 2NCMA 5CSGA 3H9SE 2C4FT 4X7SL 5TDOA 1FFRA 3BI9X 3UO1L 1KJ3H 4NBZB 2C3XA 5J4MA 4NHUA 4LVNB 4UBDD 5J8OA 1J12A 1A0QL 3LEYH 2CDFA 2GY7B 3NCCB 2GJJA 4JB9H 4ZQKB 5DDHB 2F53A 2APWA 3ZDXF 1A1NA 4JM2A 1BX2B 2FDBP 2Z93A 4HWBA 35C8L 5C7XH 1FO0A 5HYJA 1H3VA 5CSZA 1BBJB 4Y1AE 1BZ7A 5ESQB 4K7FA 5BS0D 5D5MA 1CDIA 1SEBA 3CZFB 3RNKB 2DMCA 2NNAA 5T3XH 4LCWA 3QAZC 1ADQH 2YUZA 3BESR 1HHIB 2XPGA 4DN3L 3GIZH 4HDIB 3DHJA 1A64A 5DR5L 3LRGA 3DX7A 3F8UB 3KYOB 4E42B 2IADB 2BVYA 3TYGL 3CZJA 4OB5H 5T33H 1W0WB 3M07A 4KMTH 3ZHDA 1D5BA 3HPJA 5EORL 4QRUA 4Y5YC 3IDGA 1NEZB 5BRZA 3TO4D 1JP5A 3SE4A 3BIAX 3RGVD 4ZUWA 4TSBL 3IAPA 1R0AL 3RGVC 3QI9D 3GIVA 5E6YA 1OTUD 2NW3A 4A6YL 3C08H 2V17L 2FEEL 1I8MB 1NJ9A 3D25B 1U2CA 4N0RA 1G9NC 4Z7VE 3NPSC 5EZIH 5HDBF 3KPOB 3PDGA 2HMID 3PQYB 4K2UL 5HJ3B 1QSZA 1LK2A 4ORGB 5L6YH 2HMIC 3MCG1 4WI3A 3FN9A 4PJ8B 2P24A 3QUXA 3ARPA 1FG2B 3BAEH 2NY5L 3BEWA 3G6JB 3WFCL 3C6SB 4OBRA 4D9RE 1VA9A 3G5XB 3RVVC 4WI4A 3HFML 1AXTL 1A7BA 2CK2A 1TNNA 3GI8H 1XIWB 4MX7B 4D0BB 2WWMC 3PWUA 2F58H 1SJVA 1IT9H 1IRAY 4Y5XA 4Y5VB 2FEEI 4Z7WE 1I8IA 1BLNA 4OLZL 4XCEA 5DJ2A 4XPFH 4H88L 4TYUA 2DQUH 4JFXA 1M71B 1KC5L 1P9MC 3HAEH 3QUMB 5DD0H 3T1WA 3ZT5A 4NFBA 1GGBH 1RUMH 1ZSDB 2QHRL 1AXIB 3DX9B 2GITA 3NVQA 4K3DH 3TP4A 4HPOL 4NNXB 4YNYA 4P59H 3OKYA 1N5AB 1TVBA 5D7IE 2ATPA 4G42A 4PTTA 3IT8D 5BS0B 5K9OA 1RPQA 4S1SL 1A4JB 1CFTB 3OV6A 4N8CL 3QAZB 3F7PC 1UCBH 4K9EH 1OAXH 5DK3A 4MAYD 1HHKB 3H3PL 5MI0C 2GQHA 4ONGH 5IROC 3IKKA 4MAUH 5AZEL 1CGSH 3VFRA 2JIXB 3LIZH 4BZ2H 3NA9H 5C0BA 1KTKE 5E2VH 3FHQA 2J88L 5IBUG 2BVPB 2KKQA 2P46B 4H5SB 4Y5YB 4E41A 1FH5L 2WV3A 1EEZA 3IF1B 3HG1B 3FOLB 3KG5A 3D9AH 2ENSA 1ZHBB 3QJHA 5L2KD 1ORSB 1XGPA 4I0PA 1CGWA 3RGVB 5D5MF 4RNRB 3BT2H 2V5RA 2NMSA 4I77H 1QLRB 3QI9B 4ZSOB 4XAKE 2JB5L 3ARRA 3IFPA 4PGDB 4XB7A 3W11D 5KTEL 3SGDH 3C60D 1TMCB 2V2TB 3ARGA 3FJTA 4PRPA 3T0ED 1YYMH 4GRMB 3C60C 4U1SA 2DIAA 2E9JA 3E8UH 5MEPB 5K59E 3KNBA 3IDNB 4BH7A 4O2FA 4JFED 5C6TL 3X13B 4KHXH 4AIOA 1FNSL 4PRDA 4PS4H 2FWOB 5DJCA 1NBVH 4JY6B 3RIAF 1CS6A 1TJIH 5L8JB 5IB2B 4KPHH 5EOTA 2HP4A 2DOCA 5JZ7C 3GMNB 5FFLA 1K2DA 1HIMH 3FQTA 1F58H 3RI5K 3VXRD 4HMDA 1DLFH 4M61B 1C16B 1HNGA 4JPWL 4PJGB 2CMRL 1YDPA 1KG0A 5AWNH 5C9JB 3SQBA 5CJXC 2P5WE 1KB9J 1F5WA 5DQJB 1YUHB 4K3JL 4PJDE 4PJBB 2F8XC 1DQDL 3CMOH 3FRUB 4G6KH 3EO0B 3BUYA 1QRND 5JNYA 5GGRB 4O00A 4P2RA 4QOKB 1K85A 4HC1L 1AXSA 1NAKH 2P8PB 1AGCA 2BSRB 3BSZL 1IAIH 3I85A 1QKZH 4UTAH 3TF7C 1JHTA 2HVKA 3SPVA 1AFVH 5HI4D 2IAND 3EUUA 2VWEC 4AL8L 5HI4C 2YPLA 5DHVH 5GRXG 1P84K 4JKWA 3T3MF 5FKAA 4G9DA 1FLRH 3CSBA 3P0GB 3MJGX 1G9MC 4FQ1H 5MI0B 4XCNB 4MAYB 4GXVH 4CJ0A 3VFSA 1DQQA 4LDEB 5AUMB 4X7TA 1YQVL 3WN5C 1MREL 3W82A 4MA1C 1SBBA 5DSCB 5CD5C 1UENA 3MRHB 4HK0B 4CGTA 5DD6B 1B88A 5ALBL 2ICWI 1I3UA 1KPRB 3O6ML 2D0GA 5C08E 4NUGH 3BX7C 5INDA 1IJ9A 5J12C 3VDAA 4KGJA 4DW2H 4AK1A 4M3JA 5C2BH 1NPUA 5D2NC 2VDOH 3C60B 2XOTA 3FT2A 5IMOB 3UPRB 2X70B 4HCRH 5F9JB 3QQ4B 5ERWB 5DJDA 4PJFE 4MJ5A 1QBLH 2DYPD 5HY9B 2Y06H 3GM8A 4JFEB 5A2LH 2Z8SA 2IQAB 4PGEA 1Q9OA 4PJIA 1SY6A 1MJ8L 3MX0A 5FGSA 3MA7B 4MJID 2EYTB 1WV7T 4UIMA 4HBCH 5L9DH 1I8KA 3PGCA 4DZBA 4JO2L 4P2OC 2ZSVB 3HRPA 3VXRB 1SYSA 3QP3A 4PLKC 2FYYB 4MNGB 3OAYH 1DBBH 2LU4A 4FNLH 3DSFH 5EG6C 1RZJC 5D7JC 3FFCA 5B8CC 1RUQH 1IE5A 4GUPA 2QQLH 2RGSA 1PEWA 5IHBA 2ORBH 1KIRA 1A7OH 4P5KB 2OTWA 2EZ0D 2A6DA 1IC5L 4WUUE 5EBLA 3EOAB 5B3NA 2D7QA 4X83A 2BNRA 2XTJE 1VFBA 5F7LB 5T1KA 5C0GB 1A6UL 1QFUH 3CDCA 4FG6C 2ZUTA 2IANB 4WI9A 1S3KH 4P46A 4NQEE 1FAKT 4U4BA 2IPTL 1FZMB 1LMKA 1C7SA 1BVZA 2P8MB 4NP4H 4XBGA 4DQOH 2H6PA 4OJFL 5H37H 1LVEA 4L8BA 5F44A 1RZJH 2EXYC 1WISA 4F15C 3LKRA 4G80A 5ECJE 3WE6A 3KLHD 4U7SA 5KN5B 5E1AA 1T2QL 2JCCA 2VTFA 2C1PB 5KSAC 1V8HA 1WZLA 3LN9A 3N85H 1NLBL 3CPLA 4PJEE 3WN5B 4MA1B 3WFZA 1DQMH 1NCDL 4MWFA 4PR5B 5JHLL 5SX4H 3FT4A 3L3GA 2BERA 1S78D 4PGCB 1MEXL 5IV2A 1RZKL 1QACA 5E2UL 1S7TB 3MGOA 3IFOA 3PWNA 5E00A 3QEHA 3TN0C 2P43B 4K94C 4PJAA 3U79A 5F71A 5J12B 4HFUH 2MQ3A 4GAYB 4K3EL 1MI5B 3VWKA 1IGFH 3FQWA 1KTDB 4U1NA 4WY7L 1RJLA 5D2NB 3QG6B 4QXUL 1FLTX 5TF1L 5JW4R 5B39G 1CLYL 3UYOD 2B4CC 2BNUA 1IFHL 3QIUA 5H2BB 5TQ2H 3SOBL 5HDOA 3I75B 2AK4D 3IDMA 2O93L 3JV4A 2OTPA 2DYPB 3TYFB 1NGZA 4G6MH 1F90H 4U1KA 5GPRA 4Z7NF 3WDIA 5BOZG 3VXUD 1AY1L 1J05B 1OL0A 2A9MH 4MJIB 4IBLT 3WUZA 3TCXA 4ODWB 1RD6A 1MQKL 2DQCL 1JN6B 4AEHH 5E6ID 5E8PB 2XV6B 5AG8A 3ET9F 1TQBC 4P23C 3FOMB 2VN7A 1A3LL 3P4OA 1FZKB 1VACA 2WBJC 5D7JB 5B8CB 2Q6WB 4KKAC 4ZOAA 5FUCC 1G1CA 3DV4A 5EBWB 1HK6A 3ARUA 5CLWA 3ECBB 1WICA 2C7UB 2LVEA 3SJVE 1QSFB 2CO7B 1Q0YH 2D4DA 2DQTL 3TVMA 2ZUSA 5SWZD 4Z7OF 4PJIF 1HKLH 2FJGB 1OGAA 5DRXB 3AY4C 3D18B 2YUXA 1OAQH 2YA2A 4L9LA 3KPPB 4KKNA 4EIGB 1GZQA 3RPIB 1N6VA 1TVHB 1YEIL 2D31A 4KI5F 4XP5L 3FT3B 2BXZA 1DTUA 2A73B 3MJ7B 3NCMA 4MD5B 1UCTA 4LP5A 1YN7A 3P11L 4JJ5B 3ZDXE 1JTTA 4WHTB 1WC7A 3VFMA 1VFAA 4XNXH 5KSAB 4BH8B 1WITA 5GS1B 4LDLB 3WS6A 2X7LA 1MJJB 2XZCL 4LSPL 1FYHB 1S5IH 2A1WL 5EZOL 5BZWA 4HUXB 4I18A 4MB4A 3MV7B 3UPCA 2VN4A 3BXNA 2HT2C 3BP6B 2F54A 3HUJE 1ZT1A 2EDTA 4WO4D 4IMLB 3U9PL 5ISZD 2AABL 1MAKA 1AGEA 4XHQA 2O26U 4N0FA 5IVZA 4Y2DD 1ZHLB 1AD9A 2H3NA 1UM5H 4Y2DC 4YHOH 1OCWL 4X4ME 1NCBL 1DL7H 2A6IA 5C0CA 2JCCF 3PUCA 1F3DH 3O0RH 1AO7D 4U1JA 3AFLA 5F89B 1WJ3A 1AI1H 2EDBA 2Z35A 5GGUA 3BYTA 3CH1A 3RQ3A 1NCWL 3G6AA 2QHLA 2FCBA 1P4LA 3CK0L 4HF5L 1I4FB 3MNZB 4ELMA 1BVLB 1CDCA 4JJHA 4Q2ZB 1G0DA 3WSQL 1R3LB 1X44A 4H1LA 4ISVA 5GRYA 3VI3F 1J1OL 4NZRH 4PJAF 5BOPA 4OZHF 3OF6D 4CVZA 5DEGA 5HGHB 3KPTA 3ALPA 4AG4H 1KULA 1ETZA 4KQ4L 1TQBB 4P23B 1PGRB 4QGTA 1EX0A 3B9KD 4JN1L 3LEXA 5EN2B 3TLRA 4P2CG 3MRFB 4OZFB 1CXEA 2X09A 5E8NA 4NQSA 2FB4H 4WFHE 4OLXL 4LFHD 1PG7L 1EO8H 4S2SA 3SE3A 3FN0L 2CDEA 2MKWA 5BZDA 5SWZB 3L3OA 1QNZL 5E99L 5M95B 2WW8A 4NWTH 1BIIB 2BXYA 2V2XB 1YNTB 4L29B 4WI8A 1T1WB 2YEZA 1OAKH 2MFNA 2P48B 3FFDB 4FQJH 4PFEA 1E6OL 4PJCA 2YS4A 3MBEA 1GIGH 1REIA 2N4IA 5LXGH 2W1NA 3V79C 4LEOB 1MIML 4OV5B 4JZOB 3RTQD 1T4KA 3AXLB 2YKLL 4KZEL 3LPGA 3K1DA 1YEFH 3RTQC 3BMWA 5ENWB 5EZJA 4EOWL 4L4TE 3QWOB 3WJLC 4JZJA 4FQLH 4LLMB 3GEWB 1U58A 3EOTH 4MDIB 5DRZB 5JW3L 1TCMA 3IXAB 3S3PA 1GAFL 5E8OA 5I1DA 3V6FB 4JO1H 5CP3A 1S7UA 3VDBA 5BQ7A 1X6NA 4HZLA 2ED8A 5ISZB 3U6RB 1BOYA 1UWEL 2PTTA 3F7RA 4X6FB 5E7FA 4XNMA 4OUOA 3MJ6A 4KRMB 4KTYA 4Y2DB 3U0WL 3AAZB 1J1PH 3Q2CA 1OAYH 3CX5K 4YHLL 3ARBD 2HAZA 4ODSH 5DVKA 2J8UE 3ARBC 4JFOA 1LEKB 1MVUB 1AO7B 3PV6B 3O3BA 3U46A 1UXSB 3F5WB 2M2DA 2IGFL 1CR9H 1JYNA 1P7KA 2XZAH 5DI8A 4NKMA 4N90E 5IVXB 3P4MA 5J56B 4YDKL 5HHXL 3DURB 4CN6A 3BDXA 4RFOH 2EEAA 4OGYH 4XVJL 3WHE1 1A6PA 2HKFH 4XMKH 2B1HL 4UQ3A 2KUTA 3OBAA 2WSKA 1EEYB 1BQHA 1MHEB 2AJVL 1FNEA 2ED7A 3K80A 4IJ3C 3RP1A 4DGVL 5I1JL 5IMMA 3X14A 3I02A 5EFIA 4XCFH 1KIUA 2VLLA 4HBQA 4OM0L 2KZ1B 2VC2L 4OCNC 3RDTC 1JBJA 2VLJD 3BEVA 3H7BA 4FFZL 1SJEA 1KEGL 1XCTA 5ELIA 1GOFA 4XB8A 3L3IB 4GG8B 4UT6H 2AKRB 4YHZL 4JQIL 4U33A 4ELMF 4QRSA 1QVOB 1XCQA 2NY6D 5CJBA 5D2LE 4XZUA 1P2CA 4OFKA 1DQTA 5F7MC 3QULB 1MY7A 4WEBH 2FJFB 1TZGL 3QPXH 2X41A 3MV9D 1Z2KA 1S9WA 2I27N 4NQDA 1LWRA 3QCTL 5HHMD 4J3OC 4PJ9C 3RTQB 5K9QG 4E0RA 1WLHA 1F3RB 1F4HA 5C7XL 3VGBA 3VXSE 1ZT7A 1XAUA 4UQ2A 2YA0A 5CEXB 1PLGL 4WWKD 2HLFC 5DMJB 3SO3B 2YHGA 1BQLH 5T3XL 3B6SB 1FE8H 1MOEA 2R23A 2AXJA 3ZE1F 4RFNC 1LO4H 3D0VB 2FHFA 5I1CL 1FNAA 3B2VL 2XQYG 3C87A 3GIZL 3Q5TA 4YX2L 5SV4A 1XF4B 4F33A 2ENYA 3MV8D 5J1AA 4L3EA 4OZIA 2EEBA 4R2GD 4PJCF 1J1XH 5CGMA 1FGVL 2EYSB 2W65B 3O9WC 3QWRA 2JB6A 1TLKA 3RX5A 4M1CC 2FIKA 4KMTL 5FM8A 2AJZA 4OI8A 3CFJB 1HXYB 3INUL 3ARBB 3QEGL 1AC6A 2XN9D 4PJXE 1GRWA 4JRYD 5BCAA 2DWEA 2XY2A 3C5JB 4NZTH 3UTOA 3MYJB 3IETB 1EO5A 2FGWH 5TE6L 4LSTH 1IL1A 1F6AA 3C08L 2DLHA 4QYOB 4X4YB 2K3TA 1OPGH 2GTWA 4E5XA 4NCC1 2H8PA 1BJ8A 3V4VH 5EZIL 2X40A 4MHHG 4Z77B 4QCIA 4HULB 3UJTL 1VPOH 1S5HB 4MD0B 1TQCC 1ZLVK 4NRYB 4ERSL 4Z7QE 2G5BA 3L5XL 3T0BA 1TZIA 3QFDA 2BZDA 1MRCH 4F8TA 2D4FA 3RDTB 4NN5C 2HJLA 1AH1A 1KB5B 1IEBB 2CIIB 1E4XL 4QRRA 3LRSB 3S8WA 2VLJB 1OD7A 5F8QC 1UACH 4I48A 3ARFD 1IILE 3GI8L 4V1DB 1BVKA 1RSFA 1KYOK 3VXTB 1WZ1H 3ZDZF 4U6XB 3ARFC 1A7QL 1JVKA 1A9EA 1MCPH 2F58L 1KENH 3GJFH 1G9NL 2NY6B 1KIPB 3EYUH 3EDEA 4JZNB 2VDKH 4C4KO 3AS1A 5I8OH 3GSRA 4WFGD 3BH8A 2DQUL 1HXMA 2C1OA 1E6JH 2A74A 5FO9B 4MDJB 3NCFB 5F88B 1A5FH 3QXAB 4BKLB 1FG9C 5KSBF 2ZCLH 1GGBL 4NYLA 3MV9B 1TPXC 1VERA 4Q0XL 1BZQK 2PUQT 3C2AL 4S1QH 4X6DF 3FQUB 5HHMB 5I1AA 1A21A 4K3DL 1JGUH 3DTXA 4KDWA 4XP4H 2YD1A 1BZ9A 4P59L 1E4XI 3TIEA 2CRZA 1HI6B 3C6LA 1WQVT 5CWSA 1KIQA 4HV8B 4WWKB 4RFNB 1UCBL 5ID0A 4WFED 3UZVB 1PSKH 3U30B 3MRCB 4GG6E 1EA9C 4JFYA 2YBRA 1QFOA 3WS3A 4J6RL 2I07A 4N8PA 4YDLB 4MAUL 1BFSA 1CGSL 3C09C 1JGLL 3LIZL 2OSLA 4U6VL 3O9WB 4LLDB 4I2XB 3X11A 4IRJA 5J1TC 2IPKB 5I17A 1D5XA 3FO2A 1I9RH 5HYSB 2YD2A 5A2KH 1G6RH 4NWUH 3D9AL 3O8XC 4CL7A 1E0OB 4JRYB 1OP9A 1SM3L 2ZP0T 4I77L 3WJJC 5TDNA 1HQ4A 4LEXH 3F7YB 4AIZA 2QR0A 2P4AB 1RK0A 2MOVA 5IQ7H 1YYML 4Z76A 5JO5A 1RQ5A 3C8KA 4WCYL 1M05A 2IMNA 1VGKB 1DFBH 2CLRB 4OZIF 3NCJH 3V5DB 5GRVL 3FO9A 2OJEA 4M43L 1EAJA 4KHXL 3WNKA 1KN4H 4PS4L 4A2MA 1H15A 1NBVL 1FHGA