2A79B

Mammalian shaker kv1.2 potassium channel- beta subunit complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
390
structure length
259
Chain Sequence
b'CERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGTDPFFIVETLCIIWFSFEFLVRFFAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel beta-2 subunit
publication title Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 79
structure length 259
sequence length 390
ec nomenclature
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00520 Ion_trans Ion transport protein
B PF02214 BTB_2 BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2a79B03
1.10.287.930 Mainly Alpha Orthogonal Bundle Helix Hairpins Mammalian shaker kv1.2 potassium channel- beta subunit complex 2a79B02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 2a79B01
1OCCC 1JVMA 2EINC 3STLC 3BEHA 3R65A 4GX1A 3OGCC 5IY5C 4PA7A 3OR6C 4QE7A 4ZBMA 3EFFK 2WLIB 2ATKC 4QE9A 3STZC 2OVPA 2PPIA 4PDVA 2DYRC 3SPJA 3ASOC 4CRHA 5DADA 4R50A 4F4LA 2P1NA 2Z8HA 1G4YB 4XDLA 4GX2A 4B9KB 5CBGA 4P2ZA 1BL8A 5CBHA 3OGLA 4MVSA 2P1QA 3HPLC 5CBFA 3C6PA 5A6RA 4HXIA 5EUPA 2X6CA 4MSWC 3SYOA 4KFMA 4QNHB 1K4CC 5KUKA 3K0GA 4WFHA 2WLLA 3F7VC 5EBLC 5J9PC 4P30A 5E1AC 1V55C 2Q69A 1M57C 4I9WA 2H8PC 3AG4C 3LDCA 4LCUC 5BXBA 3L2OA 2WLNA 4UYIA 1OCZC 3HU6A 3KVTA 4P9PA 3ZTDB 4CP3A 2X6BA 2Y69C 2BOBC 3FKCA 3AG3C 2JZ3C 4AJYC 2HJFC 4MVRA 3SPIA 3WG7C 3TCUA 3HVEB 4CXIA 2P1PA 4JTDB 2YEVA 4X8AA 1NEXA 3BIMA 4J8ZA 4HZ3A 1ZWIC 5DAFA 1S5HC 2Q68A 3FB8C 3PJSK 3SYCA 3ZKJB 2C9WC 2DWEC 4G28B 4PA4A 4GX5A 3E83A 4PA9A 4CBCA 3X2QC 1VCBB 4WQOC 5H7HA 2A0LA 5BXHA 3OR7C 5EBMC 3E8GA 3I3NA 3B84A 4PA3A 4RO2A 3FB5C 2NLJC 3T2MA 3RW0A 4BKSB 4EOZA 3E8BA 1DSXA 3LUTB 2IH1C 3IFXA 4G27B 1HV2A 4W9JB 3OUSA 3OGKA 2AHYA 2VPKA 3HQIA 2NN2A 3T1CA 3M5BA 3SPHA 4H37A 4PA6A 3K08A 1FQVB 4P9OA 1QDWA 3C6OA 2QTOA 3F7YC 5B3SC 3M4TA 1P7BA 4W9CB 3ZRSA 3FB6C 4WFEA 3HTMA 1QLEC 3T4ZA 4HYOA 3ABLC 4W9HB 2IHCA 2R9RB 2HG5C 5JH5B 4R7CA 5BZBA 2EILC 4BKTB 4JTCB 1NN7A 3K04A 4B9KE 3ZRFB 4RUEA 2JK5C 5LLIB 2OCCC 1EOFA 4RAIA 2ASSA 4R8CA 5EBWC 4MS2A 4U77A 3OHUA 3OUFA 2WLMA 2K1EA 5BO4C 3E8FA 3ZTCB 1EXBE 3ZJZA 2DYSC 2OVQA 5BXDA 1FS1B 4AWJB 3IGAC 3E86A 4MW3A 2OVRA 2WLIA 2EIKC 2ITDC 4W9DB 1T1DA 2EIJC 3RVYA 1R3LC 4MTOA 1LM8C 3ZNGB 2ASTA 3ZUNB 3E4UA 4J9YB 3OGMA 3SPCA 4W9KB 4CXJA 4H33A 1LNQA 3T4DA 3FB7C 4W9HH 1ORQC 3LDDA 2W0FC 3SYAA 2BOCC 3UM7A 1BUOA 2ZXWC 2A79B 2EIMC 3E89A 3ASNC 2P7TC 4LP8A 2Q81A 4GX0A 4BGCA 4JTAB 4BW5A 4MVZA 5KUMA 1FS2B 1QDVA 2QKSA 3GB7C 4N9F5 1R28A 2WLLB 3K03A 5HYWB 5EC2C 4MVMA 3DCGB 3SYQA 3AG1C 2E31B 3HVEA 4R6ZA 4JGHC 4MVUA 4XDJA 2FNJC 4PDMA 4MTGA 4RUFA 3RVZA 2P1MA 2HVKC 1R3KC 4AP2A 2IH3C 3LDEA 2Q67A 1R2BA 1OCRC 4MVOA 5EK0A 2DWDC 4WFGA 2ITCC 2YY9A 3GA1A 1LQBB 2Q6AA 4ZOUA 4TWKA 4MTFA 4W9IB 3K06A 3VOUA 2I2RA 2E32B 2HFEC 2WLJA 3OHVA 3TETA 2X6AA 3AG2C 4B95B 1M56C 5FTAA 2P1OA 4J9ZB 2IZVC 1R3IC 2KB1A 1OCOC 4MW8A 4WFFA 3M8VA 3RBZA 5B1BC 3DRZA 2A9HA 4OXSA 4W9FB 3V7DA 5B1AC 4U2NA 4UIJA 3JYCA 1CS3A 3LNMB 3ZRCB 1EOEA 3K0DA 1J95A 1R3JC 2NZ0B 3SPGA 4XDKA 4X88A 4APFA 1EODA 4X89A 4UUJC 1K4DC 1A68A 4I6JC 2ZD9A 2VKPA 3C6NA 4EKWA 1LDKD 4U2MA 3MKSA 2WLHA 1XL4A 3WSOB 1KKDA 2IF5A 2AHZA 3E8HA 4DXWA 5H7GA 3SYPA 3M52A 5IBKA 5A15A 3ABMC 4PDLA 3UKMA 4W9GB 2MA9C 5HZGC 3KG2A 4W9LB 2WLKA 3LBZA 1V54C 1XL6A 1P22B 3F5WC 5EC1C 2HVJC 3SJQC 4PDRA 4MVQA 4LBEC 1S1GA 4W9EB 1R29A 4CXTA 3ABKC
chains in the Genus database with same CATH superfamily
4TUYA 2EINC 1KECA 1WN7A 1XHXA 1QR9A 3A2FA 1MZEA 4UFZA 2RJZA 1FFXA 3EFFK 1SQVH 2YS8A 2Y0PA 4X1KA 2OVPA 2PPIA 4PDVA 2L6LA 3CJHA 2YIDA 4UB8Z 5JH7A 1AVMA 1NTZH 3SJCC 3HKEB 1K34A 5DECA 2P1NA 4YJ3A 5J2UB 1MG1A 3QO8A 1G4YB 4J7KA 4UCOA 3JCZA 4UCSA 5IWAO 1W0JG 3ASOB 5CBGA 4X20A 3S3XA 2JS5A 3Q4HA 5CBHA 1MNGA 2ZDIA 3A0RA 2P1QA 1I08A 4PJ0Z 5CA0B 1PV0A 2Q8VA 3N2KB 2K9PA 2NR5A 5LXTA 1I5XA 3JASA 5A6RA 1HNWB 2X6CA 3L74H 1S76D 2UXCB 4EB6B 4MSWC 3ZMTA 1Q81W 4JI0B 2RCVA 3JD2A 1B6QA 5ITZA 3OTOO 4FFBB 4B7EA 1JA8A 4X65B 1Q6UA 2AZ2A 1M57C 5IJ9B 2UXDO 1FXKC 3AG4C 3CXHF 3LDCA 4UYIA 1HR0O 1OCZC 4UCTA 3HU6A 4E4EA 4NTYA 1N32B 3ZTDB 4CP3A 4LFCB 5LYJB 1DF5A 1V55B 2PUSA 2GTSA 2Q7GA 2WPDG 3FKCA 2JZ3C 3WB1A 2JEUA 3CCEV 1SZTA 3HVEB 2OT5A 4U3JA 2CTRA 3AK2A 3FKSG 2YEVA 1XNRO 1NR7A 4DR6O 3APQA 2M6YA 1S5HC 2F93B 3FB8C 3ETDA 3PJSK 4WBNB 2DWEC 4RWUA 2OIGA 2XAJA 4G28B 2DE0X 2F4VO 3X2QC 4LNUB 1VCBB 4WQOC 1XI1A 2P67A 1F4MA 1KBHA 3B8NA 3C3SA 4BAYA 2YSUB 5EBMC 4UXNA 4DV2B 1HNXB 1JCHA 4X1IA 3L9DA 3AEIA 1NU1H 4DR3B 3K9AA 4I4TB 1L0LH 3J80N 5J2TB 1VQOV 2NLJC 2LQTA 3T2MA 1KYOF 1MMMA 3P32A 3RYHA 4Z1VA 1HWYA 1DSXA 3LUTB 2IH1C 4FLUA 2QWNB 4X66O 2DW4A 2AZ0A 4KP4A 2ARHA 3FAVB 4WFBV 5IE9A 2UUAO 2VS0A 3M5BA 3IC9A 5C93A 1IURA 3G71V 4UVCA 3JATA 3K58A 3HKCA 4AHCA 2B1IA 4P9OA 3C6OA 1YHQV 1F4NA 4FFKA 1E1RG 5B3SC 1JJOA 1NJIW 1THZA 1VQ9V 3N27A 4LF5B 3KCYA 1WPBA 3HR0A 2JJ1G 5KMGB 2CK3G 2ZE7A 1QLEC 4JASA 4NTWA 4HYOA 1I94O 1HNWO 3ABLC 2UXCO 3KCXA 4IGGA 4R7CA 4DR5O 3OMIB 4X62B 4TV9A 3BA8A 2JDIG 2HKOA 3RWRD 2P4KA 1LUVA 1WLEA 2ZINA 2A3QA 1VQMV 1QVFU 3K04A 4DV4B 1DF4A 1S5JA 4KXRA 5BY1A 2Z3YA 2GBOA 4X65O 1EOFA 4R8CA 1PL0A 1KU9A 2DMXA 3M8AA 1WJZA 1HP8A 3QTCA 1K92A 4O4IA 1N32O 2OCCB 5CA3A 3ZTCB 1BE3H 1XBLA 1Z2GA 1B06A 3H01A 3ZJZA 1EZVH 4DW0A 2QGNA 1VQKV 1IBKB 2PYLA 3JALB 3L73H 1TUBA 2IU3A 1SQXH 2EIKC 2ITDC 2EIJC 4JI4B 4OPHA 3ZRWB 3CC4V 4O4HB 1F23A 1LM8C 2ZT9B 4JGSA 2ASTA 2XNDG 2Z0AA 3SPCA 1XMOB 1NH2D 1HNXO 1VQNV 3T4DA 3T1HB 2ZDIC 2G38A 4W9HH 4Q20A 1COWG 1R6TA 3BHPA 1I5YA 2BOCC 5GTIZ 2ZM6B 1Y67A 2CAZC 3DSQA 3E89A 3ASNC 2P7TC 4LP8A 1EN4A 1Y76B 2JRIA 4BGCA 4HNAB 4JV5B 4JTAB 2QJ1A 3QO5A 3BABA 2EIMB 2QKSA 4DUZO 3DTUB 2JVDA 4QIWF 3K03A 4X9QA 3RYCB 5EIBC 2CH7A 5EC2C 4O2AA 3CCUV 4O2BA 2ZE5A 4YY3O 1Q43A 1RP3B 3AG1C 4JGHC 2P06A 3OT7A 3LNNA 5B1NA 4QPKA 5LP6C 4DW1A 4CC6A 4MTGA 4NTXA 2XT9A 4ICGA 3D36A 4LFBB 2RN9A 4UB6Z 4DV4O 1N36B 1JR9A 2ETNA 4I0XB 1HW7A 4WFGA 2YY9A 3M7MX 1U96A 2AXTZ 4TWKA 5LGTA 4FLZA 4AQYO 3DC5A 4DR2O 4FM2A 2I2RA 4YJ2A 1P49A 2DN9A 4B7KA 4LFAO 1ZAUA 1YTFB 5IYZA 3TETA 1D2DA 3C90A 5FTAA 3IAYA 4J9ZB 1OCOC 1S5LZ 1ZX3A 1VP7A 3UO2A 3DRZA 2HLDG 2HP8A 4OXSA 1FJGB 1XMQB 3ZRCB 4LWSA 5IT9N 5B1BB 1R3JC 2GUZA 3CRAA 3T1HO 1FXKB 1EN5A 4JI5O 1TAEA 1EODA 1H8EG 1XHZA 1A68A 4I6JC 1V9PA 3C6NA 3JAMN 5HFLA 2ZM6O 1N0NA 1XL4A 3WSOB 2PYJA 1XILA 2BCCH 2XAHA 4JV5O 1GH6A 3SYPA 1URFA 5A9GA 3CMAV 1F51A 3HKDB 5IBKA 3T1YB 4O4LB 4NKGB 4WCEV 2MA9C 2CDYA 2YI8A 3TXSA 4PI2A 1WA8A 2IJJA 4JYBA 5LBQA 1SQPH 1V54C 1B3QA 4DV3O 5BR8B 4U7OA 3A0BZ 1F7YA 2WSSG 2VWJA 4H13B 1OCCC 3STLC 1Y74B 3OGCC 1QQCA 3QVNA 3JD0A 3OR6C 4QE7A 4ZBMA 2WLIB 5K1XA 2ATKC 4QE9A 4JAVA 1SERA 2HHHB 5JCOA 3STZC 2DYRC 3RYIA 5IY5B 4LF7O 4GZRB 3SPJA 3WB2A 3OGIB 1FPOA 1FS0G 4F4LA 5JWPA 1GN4A 2Y4TA 2R9IA 4GX2A 4DR4O 1FXVA 3CD6V 1VQ4V 1LUWA 2BSKA 4BIZA 2YXHA 3F5TA 4DRXA 4LC1A 1RM1C 4I55B 5IWAB 3BA9A 1NBMG 1MA1A 4I50B 2E3CA 4O4JB 1Q6IA 4HXIA 3BVOA 5JVDA 4KFMA 3ABLB 1K4CC 5KUKA 3K0GA 1FKAO 2B5UA 1L1FA 4WFHA 1FJGO 1XMQO 3F7VC 2LGQA 3LSSA 3W7WA 4CC5A 1GN3A 2IBZH 2QSAA 3OTOB 2QWQB 3BCCH 4LCUC 4DUYO 3OEEG 2ADQB 5D5QA 2QDOA 3CPWU 4DV6B 4P9PA 2QE7G 1PM9A 2X6BA 1AR1B 2V4DA 3LSQA 2KQXA 4F6RA 4JI3B 3O65A 3ZCCA 3SPIA 1SQGA 3D36C 1S77D 4FLTA 2GV9A 5IYBO 1S72V 1NEXA 4J8ZA 5GONA 4HZ3A 1ZWIC 2GSMB 2RNBA 3ZKJB 3SYCA 1DK1A 2EIJB 5JH7B 4PA4A 2FB5A 4CBCA 4TV8A 1ENVA 3K9SA 2F4VB 5BR8O 1EN6A 1H2SB 4GLXA 3E8GA 3I3NA 1AROP 5D5PA 3B84A 3K5OA 2QWOB 4RO2A 3OMNB 2H94A 3JASB 3RW0A 2D3OW 5C8YA 2UU9B 1TUEB 2QM4A 1K5SA 1PNLA 3E8BA 5A2QN 1HV2A 5LHIA 3ASNB 3L75H 2HHHO 1BSMA 4OPAA 3OUSA 3VQWA 2FYUH 3CCLV 2QTSA 3HQIA 1VQ8V 2NN2A 4X66B 1NVPB 3OTFA 3N2GA 3FYEB 2E5LB 4EFBA 1CP9A 2E76B 3K08A 3OM3B 3MAQA 2UUAB 3CC2V 2OTJV 4JF3A 4Z1MG 3CCJV 2V7QG 3M4TA 3LSUA 4MTXA 4HBNA 1P7BA 3ZRSA 2BTQB 3FB6C 4NYKA 4ZOLA 3AK3A 3L71H 2R9RB 3JD1A 3UO3A 3DRXA 4U3JB 3E2EA 2LJ2A 2EILC 2DJVA 2YEVB 1I94B 4YIPA 3G6EV 1NN7A 4DR5B 3K5LA 1YDXA 4UV9A 2R70A 4RUEA 1K7DA 3BPZA 4IIJB 1FYJA 2ASSA 3P3PA 5EBWC 4JYAB 3IC7A 4U77A 4DV6O 1VF7A 2HJDA 2Y4UA 1H38A 1KP3A 3E8FA 4X1IB 5TISZ 3VQVA 2RMKB 1R6NA 2DYSC 4JI3O 4AWJB 3CXCU 3H1IH 5KHKA 3IGAC 4UCVA 1BT8A 1IXBA 1VIBA 3E86A 4AI8A 3RYHB 1KUQA 5JCOC 1RSOA 4W9DB 3EVKA 1QLNA 5KLVH 3HKEA 1L0NH 5LP6A 4DR1B 4MTOA 3ZNGB 5J2UA 3JAWB 3G80A 4CH6A 4XBFA 2RQ6A 2Y48A 2XOKG 4H33A 4K8ZA 3M99B 1WB8A 2QWPB 2JEXA 3FB7C 1XNQB 3RYFA 5CA0A 3H1JH 1R6KA 2RDCA 1NTKH 3LDDA 2GHYA 4BW9A 3K79A 1QBZA 4LH7A 2XTAA 3SYAA 5JJJB 3UM7A 2UU9O 4KUMA 4PI0A 4GX0A 2C2AA 4FFBA 4KL1A 4MVZA 2ZXWB 4LF9B 4FVMA 1QDVA 2NNUA 5IJ9A 3GB7C 1JFFB 2Q7HA 5L3FA 2PI5A 3CYOA 1R28A 5IJ0A 2WLLB 4TSFG 2E5LO 1JX9A 4LH6A 3B4SA 1B04A 4K0KB 2QA4V 1I7FA 4MVMA 4DUZB 3DCGB 5FLXN 1SETA 2JGDB 2ZR2A 4J7ZA 1YXBA 1KMIZ 3AK1A 4JI6O 3P30A 4ZI7B 3HVEA 2IU0A 1K9MW 4YY3B 2YICA 1BGYH 5JJNB 2LP7A 1JQ0A 3RVZA 4WBNA 4AP2A 4ZGCA 3ZMVA 3D8CA 3K5MA 1I0HA 5DM6V 3RT3C 3BAAA 4U3FH 4RQEA 5EZYB 3MHHC 1Q90D 2ITCC 2Q0OC 1AP5A 1GMGA 3GA1A 1LQBB 4JYAO 4J41A 4ZOUA 1JOYA 4W9IB 2XAQA 4BIOA 1OCRB 2W6IG 3GWOA 1YTFD 3ZS8C 2XASA 2HFEC 1W2BU 1K5QA 4AQYB 4DR2B 1NS1A 1N33B 2X0LA 3AG2C 1D5AA 2B1GA 4LFAB 2BE3A 2DOSA 3FYIB 3RGBA 3ZIAG 4CS4A 2QKCA 1R3IC 3P3NA 2B9ZA 3BRCA 1H2GA 3M8VA 3PN1A 5KX5B 1J5EB 1MZFA 3DGEA 3FD9A 2Q5ZA 2W6JG 1K8AW 1M56B 4OX9B 4J7JA 3ETQA 4DR1O 4WF9V 4W9FB 5IYCO 4K35A 3ZX6A 1FAFA 3UQ8A 4U2NA 1VF6A 1GN2A 1CS3A 3LNMB 4LF4B 5K1PA 1ZLZA 3QO7A 4O2AB 4WFAV 5B1AB 2QEXV 4ZHQB 2MW2B 4APFA 1XNQO 4D7SA 4QJFB 3ZMZA 3CP1A 5KMGA 3CSXA 3L70H 1XEQA 2VKPA 2R9AA 4JI5B 4EKWA 1LDKD 1JMKC 4FZ0A 4LR3A 4JZ2A 3W7TA 2KG7B 4PELA 3E8HA 4ABMA 2QR4A 3ZN0A 2CTPA 3M52A 1U97A 3W7XA 2Q73A 4LF9O 1TA8A 3UKMA 3MDSA 3CB2A 3J7AU 1R1BA 3KG2A 1XDCA 3D3IA 4K0KO 2WLKA 3LBZA 3ABMB 2R72A 1H2NA 2N05A 1MABG 4IHJB 4YJ2B 1NQTA 2ZNJA 3F5WC 5FPOA 4MVQA 1S1GA 1SKVA 4DV3B 1R29A 3MD0A 4CXTA 2XAGA 3VQXA 3UT5A 1SQQH 5L3GA 2IJKA 4J42A 1KP2A 3BEHA 3R65A 2ZIMA 4GX1A 3B8MA 1G6UA 3R66A 3A0HZ 3ABKB 4YHHO 4PD4F 2EINB 3SGIA 3ZRVA 5L3CA 3ZHQA 4X1YB 3K57A 3ASOC 4C7UA 4CRHA 1TGOA 4LF8O 5B66Z 4FJCC 4LWSB 5L3EA 2CTWA 4LF7B 1Y6XA 3I56V 4XDLA 2P4VA 4NR1A 4B9KB 1BMFG 3WFVA 5KHGA 1ZTEA 2YXLA 4N21A 1BL8A 5LHGA 3OGLA 4MVSA 1XREA 4DR4B 3E35A 1N33O 1H8HG 3E22A 1Y76A 4IL6Z 3C6PA 3JAKA 5LOVA 1N0JA 3CMEV 4ASUG 1P84F 3SYOA 1J5EO 3ABUA 3KKYA 4OX9O 3CC7V 2EILB 1WB7A 2VQEB 1H2LA 4UV8A 5KHJA 3MHSC 4LF4O 5E1AC 2PI4A 2NN4A 3SJAC 1V55C 3OE7G 1WA8B 1KC8W 2CGOA 5E79Z 3CRMA 3KVTA 2YIBD 1T5EA 1M90W 2GTAA 4DUYB 1M57B 3AG4B 1MSDA 2F95B 2WWWA 1OCZB 3AG3C 4AJYC 4NXMB 4NXNB 3WG7C 5L3BA 4OGQB 1ZL8B 1DGSA 1GKFA 4CXIA 2P1PA 4Z2WA 3KZIZ 4JI7O 5DAFA 2C9WC 3ZBHA 1QVGU 5LA6B 4GX5A 2XUMA 2YI9A 5B1OA 5H7HA 5H6QA 1YI2V 5IYDO 3FX7A 2PF4E 1VQ6V 2X7RB 1AJQA 4ZIBA 5BXHA 4JI8B 1RPRA 2BSKB 3JSLA 1HNZB 3CE2A 1AJNA 1QU7A 3X2QB 5H2FZ 5CB4B 2P90A 3K59A 3DXRA 3W7SA 2P5OA 5JQGA 1AP6A 4BKSB 4U7NA 1YJWV 2UXXA 2QM7A 1BCCH 2F43G 3IFXA 4G27B 4I5SA 3TK1A 1VQPV 4CS3A 2Q9LA 1K73W 1GAXA 1X4TA 3L72H 1VF6C 3ZHSA 1NVPD 1TVKB 3OGKA 4TT3G 2HR3A 1Q86W 5KHHA 1K33A 1Y4MA 2IJIA 3SPHA 2MK3A 2ZQMA 4DV1B 1M9NA 2QTOA 3TXQA 5BMVB 4FM0A 4JZGA 3ZHVA 4I7ZB 2ZCEA 4DK1A 3HTMA 4Q6GA 2N74A 3JARB 2OYQA 1VEWA 1GK9A 2HG5C 5JH5B 5B3SB 3HKDA 5BZBA 2AGAA 4BKTB 2Z5UA 1YF2A 4JTCB 4O4LA 5GONB 1QLEB 2Y0IA 5FNVA 2VQEO 3ZRFB 1SA0A 2EJRA 2FTKA 1YZBA 2JK5C 4J11A 5LLIB 2OCCC 3ZMUA 3HKBB 3CHXA 1E1QG 1VF5B 3OHUA 2OTLV 2WLMA 5LL6Y 2K1EA 1OHHG 1N34O 5CMUA 3B40A 1AILA 1PL4A 1SQFA 1Y74A 1BQZA 4CS2A 4NXMO 4NXNO 2ZE6A 3GVMA 3IJ4A 4MW3A 5C8YB 2OVRA 2WLIA 4TUYB 1SS3A 5LGUA 2FL4A 1T1DA 4L8JA 2OCHA 1FFXB 3E4UA 4J9YB 1N4CA 2EIKB 3OGMA 4IYHA 4X1KB 3JSNA 4KHPB 3CJHB 4W9KB 2CE4A 3QG5A 2OIEA 4CXJA 1LNQA 2F1MA 3RFRA 4JI8O 3CEIA 4YJ3B 3VBBA 3U0ZA 1HNZO 2UXBO 2DQ3A 5DN6G 4O4JA 4PV1B 5CA1A 2EBOA 2H3OA 1VQ7V 4FLYA 4X20B 5KA6A 2W0FC 1SRYA 3OD4A 3Q4HB 1NKDA 1BUOA 1ZSPA 2EIMC 2PGGA 5LXTB 1US6A 4I9QA 1PKXA 5AG2A 2QWRB 1IBMO 2LW7A 2PY5A 3OFNG 4JI2B 1YIJV 5ITZB 2Q0AA 1VQLV 5HYWB 5LHHA 1PNKA 4DV1O 5LMNB 4DR7O 4JI1B 2XHBA 4UCRA 3SYQA 1KKCA 3BY6A 2DQ0A 3JD3A 1Q82W 4XDJA 1RFYA 1GTOA 1OZ0A 5DEDA 4JI6B 4PDMA 2FNJC 4DYLA 3AG1B 2HVKC 4BR6A 2IH3C 1RSOB 3RN4A 2Q67A 4F6EA 5IDJA 4E2LA 5LP6B 1R2BA 4MVOA 3OMAB 4FMTA 2FMLA 2DWDC 4B3RB 2E75B 1H2KA 4B3SB 2Q6AA 4DK0A 1O9GA 3K06A 3VOUA 1YITV 4CZZA 5EYPA 1M93A 1S3JA 3RYFB 3OHVA 1JPXA 2X6AA 3HB3B 4NVPA 4D6TH 1GM9A 1SESA 2F66C 3W7UA 2IZVC 5H6RA 2KB1A 4WFFA 1HDJA 3NXSA 5B1BC 2EZPA 1AB3A 1W59A 3CRRA 3V7DA 2VWKA 3OEHG 4UIJA 4PHZA 4EFEA 1OCOB 3JYCA 4DV0O 3APOA 4YXWG 4KHPO 1AJPA 5IJ0B 1EOEA 4YY8A 1IBLO 2NZ0B 1XQ8A 1AI6A 2UXNA 4X88A 2WA4A 2W0XA 3JATB 2BTQA 4X89A 3HKCB 5LGNA 2EZOA 2ILMA 1M5IA 1GM8A 4TOIA 1Q5OA 3CCMV 1WP7A 3N2KA 1VQ5V 2ZIOA 1Z5VA 1KKDA 2JGUA 2P6JA 3AG3B 4EB6A 2AW9A 2EULA 3WG7B 1GRJA 3THOA 4LF6O 5FPRA 5A15A 4IIJA 4TV9B 4PDLA 5B5EZ 4JI2O 1KQSU 3B09A 2UUBO 1OJHA 3ICXA 1NTMH 5LMNO 4JI1O 2LGWA 1YCIA 4IYIA 1JJ2U 3J81N 5KAIZ 3ZHUA 5LYJA 4CH3A 2HVJC 4O4IB 4DV7B 4LBEC 1G1XB 1V54B 2GDSA 4FLWA 1JVMA 3OW2U 3ZRXA 5IY5C 1K97A 4PA7A 4QGPA 3SJBC 2JS3A 4ZKIA 4YIOA 1OCCB 3GWKC 3CWBH 3JAWA 1TUBB 4FLVA 3U11A 1LR1A 3CCQV 2ZKOA 3NR7A 1W0KG 4YHHB 4FM1A 4B3RO 3H1KH 5DADA 4B3SO 4R50A 4FLXA 2Z8HA 4LNUA 1UFIA 2EX3A 1IZ3A 1AR5A 1NZ6A 2DYRB 4LF8B 4N23A 1PD3A 4P2ZA 4I4TA 3EHBB 1AR4A 2YIAA 3ABTA 3HPLC 4J80A 3ZHTA 5J2TA 2LFSA 5CBFA 4MT8A 2FKXA 5EUPA 1SF9A 4JI0O 1IX9A 5H5NA 1RM1B 4QNHB 1X59A 4J10A 2A7WA 1JFFA 1SZXA 5BXZA 1MSWD 2WLLA 3FAVA 2IJHA 1YJNV 4D7TA 2EJ7A 5EBLC 5J9PC 4FIPC 4P30A 4CH5A 4JAAA 2JGDA 1EM1A 2Q69A 4I9WA 2H8PC 4LFCO 5BXBA 3SDLA 1M4UA 1D5NA 3L2OA 2WLNA 2WA3A 3H9VA 3WU2Z 2CH7B 4ZI7A 3QF7A 2Y69C 5KAFZ 1IVSA 1ROPA 3O9OA 4O2BB 3K5NA 5GTHZ 4JYYA 2BOBC 1KB9F 1GN6A 3UT5B 2HJFC 4MVRA 3TCUA 1YEWA 3TJTA 4GT1A 4JTDB 3G67A 4X8AA 2PZSA 3BIMA 5EZYA 3S3WA 2ZE8A 2Q68A 1WAZA 5H9CA 4B3MB 4CH4A 4FK5C 4JI7B 2A06H 3E83A 4PA9A 2XAFA 4DV2O 2CUGA 3UCSC 1Q3EA 1PNMA 4DR3O 4IT5A 1VMGA 2A0LA 2E74B 3OR7C 1DTOA 2PTMA 4DV7O 1IXMA 2ADPA 4GKJB 3FFQA 4PA3A 4JPRA 3E22B 3ETGA 3FB5C 4X64B 3JAKB 5LOVB 5IYZB 4DV5B 5KX5A 1P4RA 1GO3F 1A32A 3JALA 2LW1A 4EOZA 2O57A 1KD1W 4W9JB 3ZRWA 4B3TB 2UUCB 2KKWA 4O4HA 2QKAA 2AHYA 2VPKA 3CCVV 3T1CA 1E79G 5KHIA 4UVAA 4GCZA 3BFRA 2HEPA 2N04A 1XOUA 4ZHQA 1Q6HA 3ZMSA 4K3AA 4H37A 4PA6A 3ABKC 3CRQA 1L8DA 1FQVB 4LF5O 1QDWA 2GUZB 2VQFB 3I55V 3DRYA 3F7YC 5KA5A 1IDSA 4W9CB 2CTQA 2KG7A 1AI5A 4WFEA 4X62O 3T4ZA 1CEZA 4W9HB 4UCUA 2IHCA 4UVBA 1RPOA 1DLBA 1H2MA 2YXYA 4HNAA 2LO1A 3WB0A 4B9KE 4H0LB 1BS3A 1EZJA 3QNEA 1YSCA 5CN0A 3TGUH 1P7GA 4BIUA 4QPJA 4RAIA 3RYCA 4IHJA 4MS2A 1EFRG 3OUFA 4A5UB 4GYCB 5BO4C 3SR2C 1YJ9V 4RQFA 1EXBE 1K3EA 1YVWA 1NT2B 3OAAG 3ML0A 1IBKO 3K3WA 4TQDA 5LMUB 4GKKB 3DXRB 2OVQA 5BXDA 1FS1B 1N34B 2YDEA 5JQGB 2P22C 4JI4O 1UJWB 3ZN1A 5L3DA 2DYSB 1Q7YW 4X1YA 1NR1A 1XUQA 4G2KA 3RVYA 4DO2A 4B3MO 1R3LC 3CCRV 4I0XA 3ETEA 3ZUNB 1XMOO 1AI7A 3RYIB 3D3QA 2V1DA 5HFMA 2BTOA 1AI4A 1NH2B 3AG7A 3G4SV 1EBOA 5JJEB 1ORQC 4GKJO 4JAUA 1BHAA 4DRXB 2UXBB 4X64O 4DV5O 2ZXWC 2A79B 2Q7EA 2Q81A 3A8TA 2VRZA 3ZHRA 5JVDB 4BW5A 4B3TO 5FNVB 2WAMA 2UUCO 5KUMA 3I5DA 2ODMA 1FS2B 4K8XA 1SA0B 4TQFA 4N9F5 4L87A 1IBMB 3H1HH 1PPJH 2KSDA 3H1LH 3CX5F 1NI8A 1QCEA 1BHBA 1FXKA 2VQFO 1WPXA 4NB5A 4B08A 5EIBD 3JD4A 4DR7B 1MOFA 2E31B 4GUNA 1CXZB 1ZL8A 4R6ZA 2F23A 1VARA 4MVUA 2YC0A 4LFBO 4F6RB 1N36O 1BQ0A 4RUFA 1OV9A 2P1MA 1R3KC 2M7WA 5LA6A 3LDEA 2LFRA 1FXHA 3B77A 3CS5A 5F2VO 1OCRC 5EK0A 1G8MA 1R73A 1WP8A 1SC5B 2ZNIA 4MTFA 1N8RW 2D2CB 1FFTB 4TV8B 5CB4A 5FL7G 3G6BA 4BWAA 2E32B 2WLJA 1M1KW 5LMUO 5CA1B 4GKKO 2Q4PA 1UPGA 4B95B 1M56C 4H44B 2P1OA 1QNMA 2ZR3A 4MW8A 1TVKA 3AG2B 3RBZA 1Z5WA 2CGNA 3B2EE 2A9HA 5B1AC 2IM9A 2QM8A 1QR8A 3K0DA 1J95A 3VQYA 1Q8IA 2UXDB 1BZKA 3ZEDA 4W4KA 3SPGA 5BMVA 4DV0B 4FZ1A 3N2GB 1HR0B 1CPYA 1IBLB 3C3TA 4UUJC 1K4DC 2ZD9A 3JARA 4AILC 4I55A 1SQBH 2Y69B 4I50A 1PP9H 4U2MA 1Y66A 5GW7A 3MKSA 2WLHA 2IW5A 2IF5A 2AHZA 4ZOLB 3T1YO 1FD9A 4DXWA 3EXAA 5H7GA 1XNRB 4DR6B 1S0VA 3HKBA 3CRCA 3ABMC 2OWOA 4W9GB 1QHTA 4LF6B 1WNSA 3CCSV 4EEQA 5HZGC 2L35A 4W9LB 4HAMA 3DC6A 4JYCA 3JCUZ 4W4LA 1XL6A 4FPPA 2UUBB 2JJ2G 1GM7A 5EYPB 2JIZG 2YUAA 1P22B 2YIBA 5EC1C 3SJQC 4PDRA 3U10A 1O9HA 4W9EB 1ZUQA 4XDKA
chains in the Genus database with same CATH topology
1OCCC 1JVMA 5L3GA 2EINC 1KECA 2IJKA 1KP2A 3BEHA 3STLC 3R65A 3OW2U 1QR9A 4GX1A 3ZRXA 3OGCC 5IY5C 1K97A 4PA7A 3B8MA 3JD0A 3OR6C 4QE7A 4ZBMA 3ABKB 3EFFK 2WLIB 4ZKIA 1OCCB 2ATKC 2EINB 4JAVA 4QE9A 3ZRVA 1SERA 5L3CA 3STZC 3CCQV 2OVPA 4PDVA 2PPIA 2DYRC 5IY5B 1W0KG 3SPJA 3ASOC 4CRHA 5DADA 4FJCC 1K34A 4R50A 5L3EA 1FS0G 4F4LA 2P1NA 2Z8HA 1MG1A 2R9IA 3QO8A 1G4YB 3I56V 4XDLA 4GX2A 2DYRB 4B9KB 3JCZA 4N23A 1BMFG 1PD3A 1FXVA 1W0JG 3ASOB 3WFVA 5CBGA 1VQ4V 3CD6V 4BIZA 4P2ZA 4LC1A 4N21A 1BL8A 5CBHA 5LHGA 1RM1C 4MVSA 3OGLA 2ZDIA 3A0RA 3E35A 1NBMG 1H8HG 3EHBB 3ABTA 2P1QA 3HPLC 2LFSA 5CBFA 3C6PA 5A6RA 4MT8A 4HXIA 1I5XA 5EUPA 2X6CA 1S76D 4MSWC 3CMEV 4ASUG 4KFMA 3SYOA 1RM1B 3ABLB 4QNHB 1K4CC 3ZMTA 5KUKA 1Q81W 3K0GA 3ABUA 3JD2A 2B5UA 3CC7V 1B6QA 2EILB 4WFHA 1L1FA 1MSWD 2WLLA 4UV8A 2IJHA 3F7VC 1YJNV 3LSSA 3W7WA 3MHSC 5EBLC 5J9PC 4FIPC 4P30A 5E1AC 2PI4A 1V55C 2Q69A 1M57C 3OE7G 4I9WA 1FXKC 2H8PC 3AG4C 3LDCA 4LCUC 1KC8W 3L2OA 3OEEG 5BXBA 2WLNA 4UYIA 1OCZC 3CPWU 3HU6A 3KVTA 4P9PA 3ZTDB 4CP3A 2QE7G 1M90W 2X6BA 1AR1B 1DF5A 1V55B 2Y69C 1M57B 1ROPA 3AG4B 3LSQA 2BOBC 2WPDG 2WWWA 1OCZB 3FKCA 3AG3C 2JZ3C 4AJYC 2HJFC 2JEUA 4MVRA 3ZCCA 3SPIA 3WG7C 5L3BA 3TCUA 3CCEV 1S77D 1SZTA 3HVEB 1GKFA 4CXIA 2OT5A 4GT1A 5IYBO 4JTDB 2P1PA 3FKSG 1S72V 2YEVA 4X8AA 1NEXA 1NR7A 3BIMA 4J8ZA 4HZ3A 1ZWIC 2GSMB 5DAFA 1S5HC 2Q68A 3FB8C 3PJSK 3ETDA 3SYCA 3ZKJB 2C9WC 2DWEC 2EIJB 5H9CA 1QVGU 4FK5C 2XAJA 4G28B 4GX5A 4PA4A 3E83A 4PA9A 2XAFA 5B1OA 4CBCA 3X2QC 1VCBB 4WQOC 5H7HA 5H6QA 1YI2V 1PNMA 2P67A 5IYDO 1ENVA 1F4MA 3B8NA 1VQ6V 2A0LA 1AJQA 2X7RB 5BXHA 3OR7C 4BAYA 1DTOA 2YSUB 5EBMC 4UXNA 1RPRA 1JCHA 3E8GA 3I3NA 3AEIA 1AJNA 1AROP 3K9AA 3X2QB 1IXMA 3B84A 2P90A 4PA3A 3W7SA 1VQOV 4JPRA 4RO2A 3ETGA 2NLJC 3FB5C 2H94A 3OMNB 3T2MA 3RW0A 2D3OW 1P4RA 3P32A 4BKSB 4U7NA 1GO3F 1TUEB 1YJWV 4EOZA 1K5SA 1PNLA 1HWYA 2UXXA 3E8BA 2QM7A 3LUTB 1DSXA 2F43G 2IH1C 3IFXA 4G27B 4I5SA 3TK1A 1VQPV 1KD1W 1HV2A 5LHIA 2DW4A 3ASNB 4W9JB 1K73W 3ZRWA 4KP4A 3OUSA 4WFBV 3CCLV 1NVPD 3OGKA 2AHYA 4TT3G 2HR3A 1Q86W 3CCVV 1VQ8V 2VPKA 2NN2A 3T1CA 3HQIA 1E79G 4UVAA 1NVPB 4GCZA 3M5BA 5C93A 3G71V 4UVCA 1K33A 1Y4MA 2IJIA 3FYEB 3ZMSA 3SPHA 2MK3A 1CP9A 4H37A 4PA6A 2ZQMA 3K08A 3OM3B 3CC2V 1FQVB 2B1IA 1M9NA 4P9OA 2OTJV 1QDWA 3C6OA 2QTOA 3I55V 1YHQV 4JF3A 1F4NA 4Z1MG 3CCJV 3F7YC 1E1RG 5B3SC 2V7QG 5KA5A 3DRYA 1NJIW 3M4TA 4MTXA 1THZA 1P7BA 1VQ9V 3ZRSA 4W9CB 3FB6C 2JJ1G 1AI5A 4WFEA 3HTMA 2CK3G 1QLEC 4JASA 3T4ZA 4HYOA 3ABLC 1CEZA 4W9HB 2IHCA 1GK9A 2R9RB 4UVBA 2HG5C 5JH5B 5B3SB 1RPOA 4R7CA 3JD1A 5BZBA 3DRXA 3OMIB 3E2EA 1DLBA 2EILC 2YEVB 4BKTB 2Z5UA 2JDIG 2HKOA 4JTCB 3G6EV 1QLEB 1WLEA 1QVFU 1VQMV 1NN7A 3K04A 4B9KE 4UV9A 3ZRFB 1DF4A 4RUEA 2EJRA 2FTKA 2Z3YA 1K7DA 2JK5C 5LLIB 1EZJA 2OCCC 3QNEA 1YSCA 5CN0A 3ZMUA 1EOFA 4BIUA 4QPJA 4RAIA 1E1QG 2ASSA 4R8CA 1PL0A 5EBWC 4MS2A 3IC7A 4U77A 3OHUA 1EFRG 3OUFA 2OTLV 2WLMA 1K92A 1H38A 2K1EA 5BO4C 1OHHG 2OCCB 5CA3A 1KP3A 1YJ9V 3E8FA 5CMUA 4RQFA 1EXBE 3ZTCB 1K3EA 3OAAG 3H01A 3ML0A 3ZJZA 3K3WA 1R6NA 2DYSC 2OVQA 5BXDA 1FS1B 4AWJB 3CXCU 3IGAC 1VQKV 3E86A 4MW3A 2OVRA 2WLIA 1UJWB 3ZN1A 5L3DA 2DYSB 1Q7YW 2IU3A 2EIKC 2ITDC 5LGUA 1NR1A 4W9DB 1T1DA 2EIJC 4G2KA 3ZRWB 1QLNA 3RVYA 4DO2A 3CC4V 1R3LC 3CCRV 4MTOA 1F23A 1LM8C 3ZNGB 4JGSA 3ETEA 2ASTA 3ZUNB 3E4UA 2XNDG 4J9YB 3OGMA 2EIKB 4XBFA 3SPCA 4W9KB 1AI7A 2Y48A 2XOKG 4CXJA 4H33A 2V1DA 1LNQA 1NH2D 5HFMA 3M99B 1VQNV 3VBBA 1AI4A 3T4DA 2DQ3A 2JEXA 1NH2B 2ZDIC 3FB7C 5DN6G 3G4SV 4W9HH 1EBOA 1COWG 4Q20A 1ORQC 1R6KA 4JAUA 3LDDA 2EBOA 2GHYA 3K79A 1VQ7V 5KA6A 1BHAA 1QBZA 2W0FC 3SYAA 1I5YA 1SRYA 2BOCC 1NKDA 3UM7A 1BUOA 2ZXWC 4KUMA 2A79B 2EIMC 3E89A 3ASNC 2P7TC 4LP8A 2Q81A 4GX0A 1PKXA 2C2AA 4BGCA 4JTAB 4BW5A 2WAMA 4MVZA 5KUMA 3QO5A 1FS2B 2ZXWB 1QDVA 2NNUA 2EIMB 2QKSA 3GB7C 4N9F5 5L3FA 3OFNG 1YIJV 2PI5A 3CYOA 1R28A 3DTUB 2WLLB 4L87A 4TSFG 4QIWF 3K03A 1VQLV 1JX9A 5HYWB 5EC2C 5LHHA 1PNKA 4MVMA 3CCUV 2QA4V 3DCGB 1QCEA 1SETA 1BHBA 1FXKA 1WPXA 2ZR2A 3JD4A 3SYQA 1MOFA 3BY6A 3AG1C 3P30A 2E31B 2DQ0A 3HVEA 4R6ZA 2IU0A 3JD3A 1Q82W 4JGHC 4MVUA 1K9MW 4XDJA 5B1NA 4QPKA 1GTOA 1OZ0A 2FNJC 4PDMA 4MTGA 4RUFA 2LP7A 1JQ0A 3RVZA 3AG1B 2HVKC 1R3KC 2P1MA 4AP2A 2IH3C 2M7WA 3D36A 4ZGCA 3ZMVA 3LDEA 2Q67A 2LFRA 1FXHA 3B77A 5IDJA 5DM6V 4E2LA 1R2BA 1OCRC 4RQEA 4MVOA 3MHHC 5EK0A 3OMAB 4FMTA 1G8MA 2ITCC 2DWDC 4WFGA 1R73A 2YY9A 1GMGA 3GA1A 1LQBB 2Q6AA 4ZOUA 1JOYA 4TWKA 4MTFA 4W9IB 2XAQA 3K06A 5LGTA 1OCRB 3VOUA 2W6IG 1N8RW 1YITV 1FFTB 4CZZA 2I2RA 5FL7G 3GWOA 1S3JA 2E32B 1YTFD 2XASA 2HFEC 2WLJA 1M1KW 1W2BU 1YTFB 3OHVA 1K5QA 3TETA 1JPXA 2X6AA 3HB3B 2X0LA 3AG2C 2B1GA 1GM9A 4B95B 1M56C 1SESA 3FYIB 5FTAA 2P1OA 4J9ZB 3W7UA 3ZIAG 2IZVC 5H6RA 1R3IC 2KB1A 2ZR3A 1OCOC 4MW8A 1H2GA 4WFFA 3M8VA 3NXSA 3DGEA 3AG2B 3RBZA 2W6JG 5B1BC 1K8AW 1M56B 2EZPA 3DRZA 2HLDG 2A9HA 4OXSA 4WF9V 4W9FB 3V7DA 5B1AC 5IYCO 3OEHG 4U2NA 2QM8A 4UIJA 1QR8A 1OCOB 3JYCA 1CS3A 4YXWG 3LNMB 3ZRCB 1AJPA 1EOEA 3K0DA 1J95A 4YY8A 5B1BB 1R3JC 2NZ0B 3QO7A 3SPGA 4WFAV 1AI6A 2UXNA 4XDKA 5B1AB 2QEXV 4X88A 1FXKB 4APFA 1CPYA 1EODA 4X89A 4QJFB 3ZMZA 1H8EG 4UUJC 1K4DC 3CP1A 5LGNA 1A68A 2EZOA 4I6JC 2ZD9A 2VKPA 3C6NA 1GM8A 2Y69B 4EKWA 3CCMV 5HFLA 1LDKD 4U2MA 1Y66A 5GW7A 1VQ5V 3MKSA 3W7TA 2WLHA 1XL4A 3WSOB 1KKDA 2P6JA 3AG3B 4PELA 2IW5A 2IF5A 2AHZA 3E8HA 3WG7B 3ZN0A 2XAHA 4DXWA 5H7GA 3SYPA 3M52A 3CMAV 1F51A 5IBKA 5A15A 3W7XA 1S0VA 3ABMC 4PDLA 3UKMA 4W9GB 4WCEV 2MA9C 3CCSV 5HZGC 1KQSU 3KG2A 4W9LB 3D3IA 4HAMA 2WLKA 4JYCA 3LBZA 2IJJA 4JYBA 5LBQA 3ABMB 1V54C 1XL6A 4FPPA 1JJ2U 2JJ2G 1GM7A 1MABG 2JIZG 1NQTA 4U7OA 1P22B 3F5WC 5EC1C 2HVJC 3SJQC 4PDRA 4MVQA 4LBEC 1S1GA 2WSSG 1V54B 1R29A 3MD0A 4W9EB 4CXTA 2XAGA 3ABKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC C;  1JVM A;  2EIN C;  3STL C;  3BEH A;  3R65 A;  4GX1 A;  3OGC C;  5IY5 C;  4PA7 A;  3OR6 C;  4QE7 A;  4ZBM A;  3EFF K;  2WLI B;  2ATK C;  4QE9 A;  3STZ C;  2OVP A;  2PPI A;  4PDV A;  2DYR C;  3SPJ A;  3ASO C;  4CRH A;  5DAD A;  4R50 A;  4F4L A;  2P1N A;  2Z8H A;  1G4Y B;  4XDL A;  4GX2 A;  4B9K B;  5CBG A;  4P2Z A;  1BL8 A;  5CBH A;  3OGL A;  4MVS A;  2P1Q A;  3HPL C;  5CBF A;  3C6P A;  5A6R A;  4HXI A;  5EUP A;  2X6C A;  4MSW C;  3SYO A;  4KFM A;  4QNH B;  1K4C C;  5KUK A;  3K0G A;  4WFH A;  2WLL A;  3F7V C;  5EBL C;  5J9P C;  4P30 A;  5E1A C;  1V55 C;  2Q69 A;  1M57 C;  4I9W A;  2H8P C;  3AG4 C;  3LDC A;  4LCU C;  5BXB A;  3L2O A;  2WLN A;  4UYI A;  1OCZ C;  3HU6 A;  3KVT A;  4P9P A;  3ZTD B;  4CP3 A;  2X6B A;  2Y69 C;  2BOB C;  3FKC A;  3AG3 C;  2JZ3 C;  4AJY C;  2HJF C;  4MVR A;  3SPI A;  3WG7 C;  3TCU A;  3HVE B;  4CXI A;  2P1P A;  4JTD B;  2YEV A;  4X8A A;  1NEX A;  3BIM A;  4J8Z A;  4HZ3 A;  1ZWI C;  5DAF A;  1S5H C;  2Q68 A;  3FB8 C;  3PJS K;  3SYC A;  3ZKJ B;  2C9W C;  2DWE C;  4G28 B;  4PA4 A;  4GX5 A;  3E83 A;  4PA9 A;  4CBC A;  3X2Q C;  1VCB B;  4WQO C;  5H7H A;  2A0L A;  5BXH A;  3OR7 C;  5EBM C;  3E8G A;  3I3N A;  3B84 A;  4PA3 A;  4RO2 A;  3FB5 C;  2NLJ C;  3T2M A;  3RW0 A;  4BKS B;  4EOZ A;  3E8B A;  1DSX A;  3LUT B;  2IH1 C;  3IFX A;  4G27 B;  1HV2 A;  4W9J B;  3OUS A;  3OGK A;  2AHY A;  2VPK A;  3HQI A;  2NN2 A;  3T1C A;  3M5B A;  3SPH A;  4H37 A;  4PA6 A;  3K08 A;  1FQV B;  4P9O A;  1QDW A;  3C6O A;  2QTO A;  3F7Y C;  5B3S C;  3M4T A;  1P7B A;  4W9C B;  3ZRS A;  3FB6 C;  4WFE A;  3HTM A;  1QLE C;  3T4Z A;  4HYO A;  3ABL C;  4W9H B;  2IHC A;  2R9R B;  2HG5 C;  5JH5 B;  4R7C A;  5BZB A;  2EIL C;  4BKT B;  4JTC B;  1NN7 A;  3K04 A;  4B9K E;  3ZRF B;  4RUE A;  2JK5 C;  5LLI B;  2OCC C;  1EOF A;  4RAI A;  2ASS A;  4R8C A;  5EBW C;  4MS2 A;  4U77 A;  3OHU A;  3OUF A;  2WLM A;  2K1E A;  5BO4 C;  3E8F A;  3ZTC B;  1EXB E;  3ZJZ A;  2DYS C;  2OVQ A;  5BXD A;  1FS1 B;  4AWJ B;  3IGA C;  3E86 A;  4MW3 A;  2OVR A;  2WLI A;  2EIK C;  2ITD C;  4W9D B;  1T1D A;  2EIJ C;  3RVY A;  1R3L C;  4MTO A;  1LM8 C;  3ZNG B;  2AST A;  3ZUN B;  3E4U A;  4J9Y B;  3OGM A;  3SPC A;  4W9K B;  4CXJ A;  4H33 A;  1LNQ A;  3T4D A;  3FB7 C;  4W9H H;  1ORQ C;  3LDD A;  2W0F C;  3SYA A;  2BOC C;  3UM7 A;  1BUO A;  2ZXW C;  2A79 B;  2EIM C;  3E89 A;  3ASN C;  2P7T C;  4LP8 A;  2Q81 A;  4GX0 A;  4BGC A;  4JTA B;  4BW5 A;  4MVZ A;  5KUM A;  1FS2 B;  1QDV A;  2QKS A;  3GB7 C;  4N9F 5;  1R28 A;  2WLL B;  3K03 A;  5HYW B;  5EC2 C;  4MVM A;  3DCG B;  3SYQ A;  3AG1 C;  2E31 B;  3HVE A;  4R6Z A;  4JGH C;  4MVU A;  4XDJ A;  2FNJ C;  4PDM A;  4MTG A;  4RUF A;  3RVZ A;  2P1M A;  2HVK C;  1R3K C;  4AP2 A;  2IH3 C;  3LDE A;  2Q67 A;  1R2B A;  1OCR C;  4MVO A;  5EK0 A;  2DWD C;  4WFG A;  2ITC C;  2YY9 A;  3GA1 A;  1LQB B;  2Q6A A;  4ZOU A;  4TWK A;  4MTF A;  4W9I B;  3K06 A;  3VOU A;  2I2R A;  2E32 B;  2HFE C;  2WLJ A;  3OHV A;  3TET A;  2X6A A;  3AG2 C;  4B95 B;  1M56 C;  5FTA A;  2P1O A;  4J9Z B;  2IZV C;  1R3I C;  2KB1 A;  1OCO C;  4MW8 A;  4WFF A;  3M8V A;  3RBZ A;  5B1B C;  3DRZ A;  2A9H A;  4OXS A;  4W9F B;  3V7D A;  5B1A C;  4U2N A;  4UIJ A;  3JYC A;  1CS3 A;  3LNM B;  3ZRC B;  1EOE A;  3K0D A;  1J95 A;  1R3J C;  2NZ0 B;  3SPG A;  4XDK A;  4X88 A;  4APF A;  1EOD A;  4X89 A;  4UUJ C;  1K4D C;  1A68 A;  4I6J C;  2ZD9 A;  2VKP A;  3C6N A;  4EKW A;  1LDK D;  4U2M A;  3MKS A;  2WLH A;  1XL4 A;  3WSO B;  1KKD A;  2IF5 A;  2AHZ A;  3E8H A;  4DXW A;  5H7G A;  3SYP A;  3M52 A;  5IBK A;  5A15 A;  3ABM C;  4PDL A;  3UKM A;  4W9G B;  2MA9 C;  5HZG C;  3KG2 A;  4W9L B;  2WLK A;  3LBZ A;  1V54 C;  1XL6 A;  1P22 B;  3F5W C;  5EC1 C;  2HVJ C;  3SJQ C;  4PDR A;  4MVQ A;  4LBE C;  1S1G A;  4W9E B;  1R29 A;  4CXT A;  3ABK C; 
#chains in the Genus database with same CATH topology
 4TUY A;  2EIN C;  1KEC A;  1WN7 A;  1XHX A;  1QR9 A;  3A2F A;  1MZE A;  4UFZ A;  2RJZ A;  1FFX A;  3EFF K;  1SQV H;  2YS8 A;  2Y0P A;  4X1K A;  2OVP A;  2PPI A;  4PDV A;  2L6L A;  3CJH A;  2YID A;  4UB8 Z;  5JH7 A;  1AVM A;  1NTZ H;  3SJC C;  3HKE B;  1K34 A;  5DEC A;  2P1N A;  4YJ3 A;  5J2U B;  1MG1 A;  3QO8 A;  1G4Y B;  4J7K A;  4UCO A;  3JCZ A;  4UCS A;  5IWA O;  1W0J G;  3ASO B;  5CBG A;  4X20 A;  3S3X A;  2JS5 A;  3Q4H A;  5CBH A;  1MNG A;  2ZDI A;  3A0R A;  2P1Q A;  1I08 A;  4PJ0 Z;  5CA0 B;  1PV0 A;  2Q8V A;  3N2K B;  2K9P A;  2NR5 A;  5LXT A;  1I5X A;  3JAS A;  5A6R A;  1HNW B;  2X6C A;  3L74 H;  1S76 D;  2UXC B;  4EB6 B;  4MSW C;  3ZMT A;  1Q81 W;  4JI0 B;  2RCV A;  3JD2 A;  1B6Q A;  5ITZ A;  3OTO O;  4FFB B;  4B7E A;  1JA8 A;  4X65 B;  1Q6U A;  2AZ2 A;  1M57 C;  5IJ9 B;  2UXD O;  1FXK C;  3AG4 C;  3CXH F;  3LDC A;  4UYI A;  1HR0 O;  1OCZ C;  4UCT A;  3HU6 A;  4E4E A;  4NTY A;  1N32 B;  3ZTD B;  4CP3 A;  4LFC B;  5LYJ B;  1DF5 A;  1V55 B;  2PUS A;  2GTS A;  2Q7G A;  2WPD G;  3FKC A;  2JZ3 C;  3WB1 A;  2JEU A;  3CCE V;  1SZT A;  3HVE B;  2OT5 A;  4U3J A;  2CTR A;  3AK2 A;  3FKS G;  2YEV A;  1XNR O;  1NR7 A;  4DR6 O;  3APQ A;  2M6Y A;  1S5H C;  2F93 B;  3FB8 C;  3ETD A;  3PJS K;  4WBN B;  2DWE C;  4RWU A;  2OIG A;  2XAJ A;  4G28 B;  2DE0 X;  2F4V O;  3X2Q C;  4LNU B;  1VCB B;  4WQO C;  1XI1 A;  2P67 A;  1F4M A;  1KBH A;  3B8N A;  3C3S A;  4BAY A;  2YSU B;  5EBM C;  4UXN A;  4DV2 B;  1HNX B;  1JCH A;  4X1I A;  3L9D A;  3AEI A;  1NU1 H;  4DR3 B;  3K9A A;  4I4T B;  1L0L H;  3J80 N;  5J2T B;  1VQO V;  2NLJ C;  2LQT A;  3T2M A;  1KYO F;  1MMM A;  3P32 A;  3RYH A;  4Z1V A;  1HWY A;  1DSX A;  3LUT B;  2IH1 C;  4FLU A;  2QWN B;  4X66 O;  2DW4 A;  2AZ0 A;  4KP4 A;  2ARH A;  3FAV B;  4WFB V;  5IE9 A;  2UUA O;  2VS0 A;  3M5B A;  3IC9 A;  5C93 A;  1IUR A;  3G71 V;  4UVC A;  3JAT A;  3K58 A;  3HKC A;  4AHC A;  2B1I A;  4P9O A;  3C6O A;  1YHQ V;  1F4N A;  4FFK A;  1E1R G;  5B3S C;  1JJO A;  1NJI W;  1THZ A;  1VQ9 V;  3N27 A;  4LF5 B;  3KCY A;  1WPB A;  3HR0 A;  2JJ1 G;  5KMG B;  2CK3 G;  2ZE7 A;  1QLE C;  4JAS A;  4NTW A;  4HYO A;  1I94 O;  1HNW O;  3ABL C;  2UXC O;  3KCX A;  4IGG A;  4R7C A;  4DR5 O;  3OMI B;  4X62 B;  4TV9 A;  3BA8 A;  2JDI G;  2HKO A;  3RWR D;  2P4K A;  1LUV A;  1WLE A;  2ZIN A;  2A3Q A;  1VQM V;  1QVF U;  3K04 A;  4DV4 B;  1DF4 A;  1S5J A;  4KXR A;  5BY1 A;  2Z3Y A;  2GBO A;  4X65 O;  1EOF A;  4R8C A;  1PL0 A;  1KU9 A;  2DMX A;  3M8A A;  1WJZ A;  1HP8 A;  3QTC A;  1K92 A;  4O4I A;  1N32 O;  2OCC B;  5CA3 A;  3ZTC B;  1BE3 H;  1XBL A;  1Z2G A;  1B06 A;  3H01 A;  3ZJZ A;  1EZV H;  4DW0 A;  2QGN A;  1VQK V;  1IBK B;  2PYL A;  3JAL B;  3L73 H;  1TUB A;  2IU3 A;  1SQX H;  2EIK C;  2ITD C;  2EIJ C;  4JI4 B;  4OPH A;  3ZRW B;  3CC4 V;  4O4H B;  1F23 A;  1LM8 C;  2ZT9 B;  4JGS A;  2AST A;  2XND G;  2Z0A A;  3SPC A;  1XMO B;  1NH2 D;  1HNX O;  1VQN V;  3T4D A;  3T1H B;  2ZDI C;  2G38 A;  4W9H H;  4Q20 A;  1COW G;  1R6T A;  3BHP A;  1I5Y A;  2BOC C;  5GTI Z;  2ZM6 B;  1Y67 A;  2CAZ C;  3DSQ A;  3E89 A;  3ASN C;  2P7T C;  4LP8 A;  1EN4 A;  1Y76 B;  2JRI A;  4BGC A;  4HNA B;  4JV5 B;  4JTA B;  2QJ1 A;  3QO5 A;  3BAB A;  2EIM B;  2QKS A;  4DUZ O;  3DTU B;  2JVD A;  4QIW F;  3K03 A;  4X9Q A;  3RYC B;  5EIB C;  2CH7 A;  5EC2 C;  4O2A A;  3CCU V;  4O2B A;  2ZE5 A;  4YY3 O;  1Q43 A;  1RP3 B;  3AG1 C;  4JGH C;  2P06 A;  3OT7 A;  3LNN A;  5B1N A;  4QPK A;  5LP6 C;  4DW1 A;  4CC6 A;  4MTG A;  4NTX A;  2XT9 A;  4ICG A;  3D36 A;  4LFB B;  2RN9 A;  4UB6 Z;  4DV4 O;  1N36 B;  1JR9 A;  2ETN A;  4I0X B;  1HW7 A;  4WFG A;  2YY9 A;  3M7M X;  1U96 A;  2AXT Z;  4TWK A;  5LGT A;  4FLZ A;  4AQY O;  3DC5 A;  4DR2 O;  4FM2 A;  2I2R A;  4YJ2 A;  1P49 A;  2DN9 A;  4B7K A;  4LFA O;  1ZAU A;  1YTF B;  5IYZ A;  3TET A;  1D2D A;  3C90 A;  5FTA A;  3IAY A;  4J9Z B;  1OCO C;  1S5L Z;  1ZX3 A;  1VP7 A;  3UO2 A;  3DRZ A;  2HLD G;  2HP8 A;  4OXS A;  1FJG B;  1XMQ B;  3ZRC B;  4LWS A;  5IT9 N;  5B1B B;  1R3J C;  2GUZ A;  3CRA A;  3T1H O;  1FXK B;  1EN5 A;  4JI5 O;  1TAE A;  1EOD A;  1H8E G;  1XHZ A;  1A68 A;  4I6J C;  1V9P A;  3C6N A;  3JAM N;  5HFL A;  2ZM6 O;  1N0N A;  1XL4 A;  3WSO B;  2PYJ A;  1XIL A;  2BCC H;  2XAH A;  4JV5 O;  1GH6 A;  3SYP A;  1URF A;  5A9G A;  3CMA V;  1F51 A;  3HKD B;  5IBK A;  3T1Y B;  4O4L B;  4NKG B;  4WCE V;  2MA9 C;  2CDY A;  2YI8 A;  3TXS A;  4PI2 A;  1WA8 A;  2IJJ A;  4JYB A;  5LBQ A;  1SQP H;  1V54 C;  1B3Q A;  4DV3 O;  5BR8 B;  4U7O A;  3A0B Z;  1F7Y A;  2WSS G;  2VWJ A;  4H13 B;  1OCC C;  3STL C;  1Y74 B;  3OGC C;  1QQC A;  3QVN A;  3JD0 A;  3OR6 C;  4QE7 A;  4ZBM A;  2WLI B;  5K1X A;  2ATK C;  4QE9 A;  4JAV A;  1SER A;  2HHH B;  5JCO A;  3STZ C;  2DYR C;  3RYI A;  5IY5 B;  4LF7 O;  4GZR B;  3SPJ A;  3WB2 A;  3OGI B;  1FPO A;  1FS0 G;  4F4L A;  5JWP A;  1GN4 A;  2Y4T A;  2R9I A;  4GX2 A;  4DR4 O;  1FXV A;  3CD6 V;  1VQ4 V;  1LUW A;  2BSK A;  4BIZ A;  2YXH A;  3F5T A;  4DRX A;  4LC1 A;  1RM1 C;  4I55 B;  5IWA B;  3BA9 A;  1NBM G;  1MA1 A;  4I50 B;  2E3C A;  4O4J B;  1Q6I A;  4HXI A;  3BVO A;  5JVD A;  4KFM A;  3ABL B;  1K4C C;  5KUK A;  3K0G A;  1FKA O;  2B5U A;  1L1F A;  4WFH A;  1FJG O;  1XMQ O;  3F7V C;  2LGQ A;  3LSS A;  3W7W A;  4CC5 A;  1GN3 A;  2IBZ H;  2QSA A;  3OTO B;  2QWQ B;  3BCC H;  4LCU C;  4DUY O;  3OEE G;  2ADQ B;  5D5Q A;  2QDO A;  3CPW U;  4DV6 B;  4P9P A;  2QE7 G;  1PM9 A;  2X6B A;  1AR1 B;  2V4D A;  3LSQ A;  2KQX A;  4F6R A;  4JI3 B;  3O65 A;  3ZCC A;  3SPI A;  1SQG A;  3D36 C;  1S77 D;  4FLT A;  2GV9 A;  5IYB O;  1S72 V;  1NEX A;  4J8Z A;  5GON A;  4HZ3 A;  1ZWI C;  2GSM B;  2RNB A;  3ZKJ B;  3SYC A;  1DK1 A;  2EIJ B;  5JH7 B;  4PA4 A;  2FB5 A;  4CBC A;  4TV8 A;  1ENV A;  3K9S A;  2F4V B;  5BR8 O;  1EN6 A;  1H2S B;  4GLX A;  3E8G A;  3I3N A;  1ARO P;  5D5P A;  3B84 A;  3K5O A;  2QWO B;  4RO2 A;  3OMN B;  2H94 A;  3JAS B;  3RW0 A;  2D3O W;  5C8Y A;  2UU9 B;  1TUE B;  2QM4 A;  1K5S A;  1PNL A;  3E8B A;  5A2Q N;  1HV2 A;  5LHI A;  3ASN B;  3L75 H;  2HHH O;  1BSM A;  4OPA A;  3OUS A;  3VQW A;  2FYU H;  3CCL V;  2QTS A;  3HQI A;  1VQ8 V;  2NN2 A;  4X66 B;  1NVP B;  3OTF A;  3N2G A;  3FYE B;  2E5L B;  4EFB A;  1CP9 A;  2E76 B;  3K08 A;  3OM3 B;  3MAQ A;  2UUA B;  3CC2 V;  2OTJ V;  4JF3 A;  4Z1M G;  3CCJ V;  2V7Q G;  3M4T A;  3LSU A;  4MTX A;  4HBN A;  1P7B A;  3ZRS A;  2BTQ B;  3FB6 C;  4NYK A;  4ZOL A;  3AK3 A;  3L71 H;  2R9R B;  3JD1 A;  3UO3 A;  3DRX A;  4U3J B;  3E2E A;  2LJ2 A;  2EIL C;  2DJV A;  2YEV B;  1I94 B;  4YIP A;  3G6E V;  1NN7 A;  4DR5 B;  3K5L A;  1YDX A;  4UV9 A;  2R70 A;  4RUE A;  1K7D A;  3BPZ A;  4IIJ B;  1FYJ A;  2ASS A;  3P3P A;  5EBW C;  4JYA B;  3IC7 A;  4U77 A;  4DV6 O;  1VF7 A;  2HJD A;  2Y4U A;  1H38 A;  1KP3 A;  3E8F A;  4X1I B;  5TIS Z;  3VQV A;  2RMK B;  1R6N A;  2DYS C;  4JI3 O;  4AWJ B;  3CXC U;  3H1I H;  5KHK A;  3IGA C;  4UCV A;  1BT8 A;  1IXB A;  1VIB A;  3E86 A;  4AI8 A;  3RYH B;  1KUQ A;  5JCO C;  1RSO A;  4W9D B;  3EVK A;  1QLN A;  5KLV H;  3HKE A;  1L0N H;  5LP6 A;  4DR1 B;  4MTO A;  3ZNG B;  5J2U A;  3JAW B;  3G80 A;  4CH6 A;  4XBF A;  2RQ6 A;  2Y48 A;  2XOK G;  4H33 A;  4K8Z A;  3M99 B;  1WB8 A;  2QWP B;  2JEX A;  3FB7 C;  1XNQ B;  3RYF A;  5CA0 A;  3H1J H;  1R6K A;  2RDC A;  1NTK H;  3LDD A;  2GHY A;  4BW9 A;  3K79 A;  1QBZ A;  4LH7 A;  2XTA A;  3SYA A;  5JJJ B;  3UM7 A;  2UU9 O;  4KUM A;  4PI0 A;  4GX0 A;  2C2A A;  4FFB A;  4KL1 A;  4MVZ A;  2ZXW B;  4LF9 B;  4FVM A;  1QDV A;  2NNU A;  5IJ9 A;  3GB7 C;  1JFF B;  2Q7H A;  5L3F A;  2PI5 A;  3CYO A;  1R28 A;  5IJ0 A;  2WLL B;  4TSF G;  2E5L O;  1JX9 A;  4LH6 A;  3B4S A;  1B04 A;  4K0K B;  2QA4 V;  1I7F A;  4MVM A;  4DUZ B;  3DCG B;  5FLX N;  1SET A;  2JGD B;  2ZR2 A;  4J7Z A;  1YXB A;  1KMI Z;  3AK1 A;  4JI6 O;  3P30 A;  4ZI7 B;  3HVE A;  2IU0 A;  1K9M W;  4YY3 B;  2YIC A;  1BGY H;  5JJN B;  2LP7 A;  1JQ0 A;  3RVZ A;  4WBN A;  4AP2 A;  4ZGC A;  3ZMV A;  3D8C A;  3K5M A;  1I0H A;  5DM6 V;  3RT3 C;  3BAA A;  4U3F H;  4RQE A;  5EZY B;  3MHH C;  1Q90 D;  2ITC C;  2Q0O C;  1AP5 A;  1GMG A;  3GA1 A;  1LQB B;  4JYA O;  4J41 A;  4ZOU A;  1JOY A;  4W9I B;  2XAQ A;  4BIO A;  1OCR B;  2W6I G;  3GWO A;  1YTF D;  3ZS8 C;  2XAS A;  2HFE C;  1W2B U;  1K5Q A;  4AQY B;  4DR2 B;  1NS1 A;  1N33 B;  2X0L A;  3AG2 C;  1D5A A;  2B1G A;  4LFA B;  2BE3 A;  2DOS A;  3FYI B;  3RGB A;  3ZIA G;  4CS4 A;  2QKC A;  1R3I C;  3P3N A;  2B9Z A;  3BRC A;  1H2G A;  3M8V A;  3PN1 A;  5KX5 B;  1J5E B;  1MZF A;  3DGE A;  3FD9 A;  2Q5Z A;  2W6J G;  1K8A W;  1M56 B;  4OX9 B;  4J7J A;  3ETQ A;  4DR1 O;  4WF9 V;  4W9F B;  5IYC O;  4K35 A;  3ZX6 A;  1FAF A;  3UQ8 A;  4U2N A;  1VF6 A;  1GN2 A;  1CS3 A;  3LNM B;  4LF4 B;  5K1P A;  1ZLZ A;  3QO7 A;  4O2A B;  4WFA V;  5B1A B;  2QEX V;  4ZHQ B;  2MW2 B;  4APF A;  1XNQ O;  4D7S A;  4QJF B;  3ZMZ A;  3CP1 A;  5KMG A;  3CSX A;  3L70 H;  1XEQ A;  2VKP A;  2R9A A;  4JI5 B;  4EKW A;  1LDK D;  1JMK C;  4FZ0 A;  4LR3 A;  4JZ2 A;  3W7T A;  2KG7 B;  4PEL A;  3E8H A;  4ABM A;  2QR4 A;  3ZN0 A;  2CTP A;  3M52 A;  1U97 A;  3W7X A;  2Q73 A;  4LF9 O;  1TA8 A;  3UKM A;  3MDS A;  3CB2 A;  3J7A U;  1R1B A;  3KG2 A;  1XDC A;  3D3I A;  4K0K O;  2WLK A;  3LBZ A;  3ABM B;  2R72 A;  1H2N A;  2N05 A;  1MAB G;  4IHJ B;  4YJ2 B;  1NQT A;  2ZNJ A;  3F5W C;  5FPO A;  4MVQ A;  1S1G A;  1SKV A;  4DV3 B;  1R29 A;  3MD0 A;  4CXT A;  2XAG A;  3VQX A;  3UT5 A;  1SQQ H;  5L3G A;  2IJK A;  4J42 A;  1KP2 A;  3BEH A;  3R65 A;  2ZIM A;  4GX1 A;  3B8M A;  1G6U A;  3R66 A;  3A0H Z;  3ABK B;  4YHH O;  4PD4 F;  2EIN B;  3SGI A;  3ZRV A;  5L3C A;  3ZHQ A;  4X1Y B;  3K57 A;  3ASO C;  4C7U A;  4CRH A;  1TGO A;  4LF8 O;  5B66 Z;  4FJC C;  4LWS B;  5L3E A;  2CTW A;  4LF7 B;  1Y6X A;  3I56 V;  4XDL A;  2P4V A;  4NR1 A;  4B9K B;  1BMF G;  3WFV A;  5KHG A;  1ZTE A;  2YXL A;  4N21 A;  1BL8 A;  5LHG A;  3OGL A;  4MVS A;  1XRE A;  4DR4 B;  3E35 A;  1N33 O;  1H8H G;  3E22 A;  1Y76 A;  4IL6 Z;  3C6P A;  3JAK A;  5LOV A;  1N0J A;  3CME V;  4ASU G;  1P84 F;  3SYO A;  1J5E O;  3ABU A;  3KKY A;  4OX9 O;  3CC7 V;  2EIL B;  1WB7 A;  2VQE B;  1H2L A;  4UV8 A;  5KHJ A;  3MHS C;  4LF4 O;  5E1A C;  2PI4 A;  2NN4 A;  3SJA C;  1V55 C;  3OE7 G;  1WA8 B;  1KC8 W;  2CGO A;  5E79 Z;  3CRM A;  3KVT A;  2YIB D;  1T5E A;  1M90 W;  2GTA A;  4DUY B;  1M57 B;  3AG4 B;  1MSD A;  2F95 B;  2WWW A;  1OCZ B;  3AG3 C;  4AJY C;  4NXM B;  4NXN B;  3WG7 C;  5L3B A;  4OGQ B;  1ZL8 B;  1DGS A;  1GKF A;  4CXI A;  2P1P A;  4Z2W A;  3KZI Z;  4JI7 O;  5DAF A;  2C9W C;  3ZBH A;  1QVG U;  5LA6 B;  4GX5 A;  2XUM A;  2YI9 A;  5B1O A;  5H7H A;  5H6Q A;  1YI2 V;  5IYD O;  3FX7 A;  2PF4 E;  1VQ6 V;  2X7R B;  1AJQ A;  4ZIB A;  5BXH A;  4JI8 B;  1RPR A;  2BSK B;  3JSL A;  1HNZ B;  3CE2 A;  1AJN A;  1QU7 A;  3X2Q B;  5H2F Z;  5CB4 B;  2P90 A;  3K59 A;  3DXR A;  3W7S A;  2P5O A;  5JQG A;  1AP6 A;  4BKS B;  4U7N A;  1YJW V;  2UXX A;  2QM7 A;  1BCC H;  2F43 G;  3IFX A;  4G27 B;  4I5S A;  3TK1 A;  1VQP V;  4CS3 A;  2Q9L A;  1K73 W;  1GAX A;  1X4T A;  3L72 H;  1VF6 C;  3ZHS A;  1NVP D;  1TVK B;  3OGK A;  4TT3 G;  2HR3 A;  1Q86 W;  5KHH A;  1K33 A;  1Y4M A;  2IJI A;  3SPH A;  2MK3 A;  2ZQM A;  4DV1 B;  1M9N A;  2QTO A;  3TXQ A;  5BMV B;  4FM0 A;  4JZG A;  3ZHV A;  4I7Z B;  2ZCE A;  4DK1 A;  3HTM A;  4Q6G A;  2N74 A;  3JAR B;  2OYQ A;  1VEW A;  1GK9 A;  2HG5 C;  5JH5 B;  5B3S B;  3HKD A;  5BZB A;  2AGA A;  4BKT B;  2Z5U A;  1YF2 A;  4JTC B;  4O4L A;  5GON B;  1QLE B;  2Y0I A;  5FNV A;  2VQE O;  3ZRF B;  1SA0 A;  2EJR A;  2FTK A;  1YZB A;  2JK5 C;  4J11 A;  5LLI B;  2OCC C;  3ZMU A;  3HKB B;  3CHX A;  1E1Q G;  1VF5 B;  3OHU A;  2OTL V;  2WLM A;  5LL6 Y;  2K1E A;  1OHH G;  1N34 O;  5CMU A;  3B40 A;  1AIL A;  1PL4 A;  1SQF A;  1Y74 A;  1BQZ A;  4CS2 A;  4NXM O;  4NXN O;  2ZE6 A;  3GVM A;  3IJ4 A;  4MW3 A;  5C8Y B;  2OVR A;  2WLI A;  4TUY B;  1SS3 A;  5LGU A;  2FL4 A;  1T1D A;  4L8J A;  2OCH A;  1FFX B;  3E4U A;  4J9Y B;  1N4C A;  2EIK B;  3OGM A;  4IYH A;  4X1K B;  3JSN A;  4KHP B;  3CJH B;  4W9K B;  2CE4 A;  3QG5 A;  2OIE A;  4CXJ A;  1LNQ A;  2F1M A;  3RFR A;  4JI8 O;  3CEI A;  4YJ3 B;  3VBB A;  3U0Z A;  1HNZ O;  2UXB O;  2DQ3 A;  5DN6 G;  4O4J A;  4PV1 B;  5CA1 A;  2EBO A;  2H3O A;  1VQ7 V;  4FLY A;  4X20 B;  5KA6 A;  2W0F C;  1SRY A;  3OD4 A;  3Q4H B;  1NKD A;  1BUO A;  1ZSP A;  2EIM C;  2PGG A;  5LXT B;  1US6 A;  4I9Q A;  1PKX A;  5AG2 A;  2QWR B;  1IBM O;  2LW7 A;  2PY5 A;  3OFN G;  4JI2 B;  1YIJ V;  5ITZ B;  2Q0A A;  1VQL V;  5HYW B;  5LHH A;  1PNK A;  4DV1 O;  5LMN B;  4DR7 O;  4JI1 B;  2XHB A;  4UCR A;  3SYQ A;  1KKC A;  3BY6 A;  2DQ0 A;  3JD3 A;  1Q82 W;  4XDJ A;  1RFY A;  1GTO A;  1OZ0 A;  5DED A;  4JI6 B;  4PDM A;  2FNJ C;  4DYL A;  3AG1 B;  2HVK C;  4BR6 A;  2IH3 C;  1RSO B;  3RN4 A;  2Q67 A;  4F6E A;  5IDJ A;  4E2L A;  5LP6 B;  1R2B A;  4MVO A;  3OMA B;  4FMT A;  2FML A;  2DWD C;  4B3R B;  2E75 B;  1H2K A;  4B3S B;  2Q6A A;  4DK0 A;  1O9G A;  3K06 A;  3VOU A;  1YIT V;  4CZZ A;  5EYP A;  1M93 A;  1S3J A;  3RYF B;  3OHV A;  1JPX A;  2X6A A;  3HB3 B;  4NVP A;  4D6T H;  1GM9 A;  1SES A;  2F66 C;  3W7U A;  2IZV C;  5H6R A;  2KB1 A;  4WFF A;  1HDJ A;  3NXS A;  5B1B C;  2EZP A;  1AB3 A;  1W59 A;  3CRR A;  3V7D A;  2VWK A;  3OEH G;  4UIJ A;  4PHZ A;  4EFE A;  1OCO B;  3JYC A;  4DV0 O;  3APO A;  4YXW G;  4KHP O;  1AJP A;  5IJ0 B;  1EOE A;  4YY8 A;  1IBL O;  2NZ0 B;  1XQ8 A;  1AI6 A;  2UXN A;  4X88 A;  2WA4 A;  2W0X A;  3JAT B;  2BTQ A;  4X89 A;  3HKC B;  5LGN A;  2EZO A;  2ILM A;  1M5I A;  1GM8 A;  4TOI A;  1Q5O A;  3CCM V;  1WP7 A;  3N2K A;  1VQ5 V;  2ZIO A;  1Z5V A;  1KKD A;  2JGU A;  2P6J A;  3AG3 B;  4EB6 A;  2AW9 A;  2EUL A;  3WG7 B;  1GRJ A;  3THO A;  4LF6 O;  5FPR A;  5A15 A;  4IIJ A;  4TV9 B;  4PDL A;  5B5E Z;  4JI2 O;  1KQS U;  3B09 A;  2UUB O;  1OJH A;  3ICX A;  1NTM H;  5LMN O;  4JI1 O;  2LGW A;  1YCI A;  4IYI A;  1JJ2 U;  3J81 N;  5KAI Z;  3ZHU A;  5LYJ A;  4CH3 A;  2HVJ C;  4O4I B;  4DV7 B;  4LBE C;  1G1X B;  1V54 B;  2GDS A;  4FLW A;  1JVM A;  3OW2 U;  3ZRX A;  5IY5 C;  1K97 A;  4PA7 A;  4QGP A;  3SJB C;  2JS3 A;  4ZKI A;  4YIO A;  1OCC B;  3GWK C;  3CWB H;  3JAW A;  1TUB B;  4FLV A;  3U11 A;  1LR1 A;  3CCQ V;  2ZKO A;  3NR7 A;  1W0K G;  4YHH B;  4FM1 A;  4B3R O;  3H1K H;  5DAD A;  4B3S O;  4R50 A;  4FLX A;  2Z8H A;  4LNU A;  1UFI A;  2EX3 A;  1IZ3 A;  1AR5 A;  1NZ6 A;  2DYR B;  4LF8 B;  4N23 A;  1PD3 A;  4P2Z A;  4I4T A;  3EHB B;  1AR4 A;  2YIA A;  3ABT A;  3HPL C;  4J80 A;  3ZHT A;  5J2T A;  2LFS A;  5CBF A;  4MT8 A;  2FKX A;  5EUP A;  1SF9 A;  4JI0 O;  1IX9 A;  5H5N A;  1RM1 B;  4QNH B;  1X59 A;  4J10 A;  2A7W A;  1JFF A;  1SZX A;  5BXZ A;  1MSW D;  2WLL A;  3FAV A;  2IJH A;  1YJN V;  4D7T A;  2EJ7 A;  5EBL C;  5J9P C;  4FIP C;  4P30 A;  4CH5 A;  4JAA A;  2JGD A;  1EM1 A;  2Q69 A;  4I9W A;  2H8P C;  4LFC O;  5BXB A;  3SDL A;  1M4U A;  1D5N A;  3L2O A;  2WLN A;  2WA3 A;  3H9V A;  3WU2 Z;  2CH7 B;  4ZI7 A;  3QF7 A;  2Y69 C;  5KAF Z;  1IVS A;  1ROP A;  3O9O A;  4O2B B;  3K5N A;  5GTH Z;  4JYY A;  2BOB C;  1KB9 F;  1GN6 A;  3UT5 B;  2HJF C;  4MVR A;  3TCU A;  1YEW A;  3TJT A;  4GT1 A;  4JTD B;  3G67 A;  4X8A A;  2PZS A;  3BIM A;  5EZY A;  3S3W A;  2ZE8 A;  2Q68 A;  1WAZ A;  5H9C A;  4B3M B;  4CH4 A;  4FK5 C;  4JI7 B;  2A06 H;  3E83 A;  4PA9 A;  2XAF A;  4DV2 O;  2CUG A;  3UCS C;  1Q3E A;  1PNM A;  4DR3 O;  4IT5 A;  1VMG A;  2A0L A;  2E74 B;  3OR7 C;  1DTO A;  2PTM A;  4DV7 O;  1IXM A;  2ADP A;  4GKJ B;  3FFQ A;  4PA3 A;  4JPR A;  3E22 B;  3ETG A;  3FB5 C;  4X64 B;  3JAK B;  5LOV B;  5IYZ B;  4DV5 B;  5KX5 A;  1P4R A;  1GO3 F;  1A32 A;  3JAL A;  2LW1 A;  4EOZ A;  2O57 A;  1KD1 W;  4W9J B;  3ZRW A;  4B3T B;  2UUC B;  2KKW A;  4O4H A;  2QKA A;  2AHY A;  2VPK A;  3CCV V;  3T1C A;  1E79 G;  5KHI A;  4UVA A;  4GCZ A;  3BFR A;  2HEP A;  2N04 A;  1XOU A;  4ZHQ A;  1Q6H A;  3ZMS A;  4K3A A;  4H37 A;  4PA6 A;  3ABK C;  3CRQ A;  1L8D A;  1FQV B;  4LF5 O;  1QDW A;  2GUZ B;  2VQF B;  3I55 V;  3DRY A;  3F7Y C;  5KA5 A;  1IDS A;  4W9C B;  2CTQ A;  2KG7 A;  1AI5 A;  4WFE A;  4X62 O;  3T4Z A;  1CEZ A;  4W9H B;  4UCU A;  2IHC A;  4UVB A;  1RPO A;  1DLB A;  1H2M A;  2YXY A;  4HNA A;  2LO1 A;  3WB0 A;  4B9K E;  4H0L B;  1BS3 A;  1EZJ A;  3QNE A;  1YSC A;  5CN0 A;  3TGU H;  1P7G A;  4BIU A;  4QPJ A;  4RAI A;  3RYC A;  4IHJ A;  4MS2 A;  1EFR G;  3OUF A;  4A5U B;  4GYC B;  5BO4 C;  3SR2 C;  1YJ9 V;  4RQF A;  1EXB E;  1K3E A;  1YVW A;  1NT2 B;  3OAA G;  3ML0 A;  1IBK O;  3K3W A;  4TQD A;  5LMU B;  4GKK B;  3DXR B;  2OVQ A;  5BXD A;  1FS1 B;  1N34 B;  2YDE A;  5JQG B;  2P22 C;  4JI4 O;  1UJW B;  3ZN1 A;  5L3D A;  2DYS B;  1Q7Y W;  4X1Y A;  1NR1 A;  1XUQ A;  4G2K A;  3RVY A;  4DO2 A;  4B3M O;  1R3L C;  3CCR V;  4I0X A;  3ETE A;  3ZUN B;  1XMO O;  1AI7 A;  3RYI B;  3D3Q A;  2V1D A;  5HFM A;  2BTO A;  1AI4 A;  1NH2 B;  3AG7 A;  3G4S V;  1EBO A;  5JJE B;  1ORQ C;  4GKJ O;  4JAU A;  1BHA A;  4DRX B;  2UXB B;  4X64 O;  4DV5 O;  2ZXW C;  2A79 B;  2Q7E A;  2Q81 A;  3A8T A;  2VRZ A;  3ZHR A;  5JVD B;  4BW5 A;  4B3T O;  5FNV B;  2WAM A;  2UUC O;  5KUM A;  3I5D A;  2ODM A;  1FS2 B;  4K8X A;  1SA0 B;  4TQF A;  4N9F 5;  4L87 A;  1IBM B;  3H1H H;  1PPJ H;  2KSD A;  3H1L H;  3CX5 F;  1NI8 A;  1QCE A;  1BHB A;  1FXK A;  2VQF O;  1WPX A;  4NB5 A;  4B08 A;  5EIB D;  3JD4 A;  4DR7 B;  1MOF A;  2E31 B;  4GUN A;  1CXZ B;  1ZL8 A;  4R6Z A;  2F23 A;  1VAR A;  4MVU A;  2YC0 A;  4LFB O;  4F6R B;  1N36 O;  1BQ0 A;  4RUF A;  1OV9 A;  2P1M A;  1R3K C;  2M7W A;  5LA6 A;  3LDE A;  2LFR A;  1FXH A;  3B77 A;  3CS5 A;  5F2V O;  1OCR C;  5EK0 A;  1G8M A;  1R73 A;  1WP8 A;  1SC5 B;  2ZNI A;  4MTF A;  1N8R W;  2D2C B;  1FFT B;  4TV8 B;  5CB4 A;  5FL7 G;  3G6B A;  4BWA A;  2E32 B;  2WLJ A;  1M1K W;  5LMU O;  5CA1 B;  4GKK O;  2Q4P A;  1UPG A;  4B95 B;  1M56 C;  4H44 B;  2P1O A;  1QNM A;  2ZR3 A;  4MW8 A;  1TVK A;  3AG2 B;  3RBZ A;  1Z5W A;  2CGN A;  3B2E E;  2A9H A;  5B1A C;  2IM9 A;  2QM8 A;  1QR8 A;  3K0D A;  1J95 A;  3VQY A;  1Q8I A;  2UXD B;  1BZK A;  3ZED A;  4W4K A;  3SPG A;  5BMV A;  4DV0 B;  4FZ1 A;  3N2G B;  1HR0 B;  1CPY A;  1IBL B;  3C3T A;  4UUJ C;  1K4D C;  2ZD9 A;  3JAR A;  4AIL C;  4I55 A;  1SQB H;  2Y69 B;  4I50 A;  1PP9 H;  4U2M A;  1Y66 A;  5GW7 A;  3MKS A;  2WLH A;  2IW5 A;  2IF5 A;  2AHZ A;  4ZOL B;  3T1Y O;  1FD9 A;  4DXW A;  3EXA A;  5H7G A;  1XNR B;  4DR6 B;  1S0V A;  3HKB A;  3CRC A;  3ABM C;  2OWO A;  4W9G B;  1QHT A;  4LF6 B;  1WNS A;  3CCS V;  4EEQ A;  5HZG C;  2L35 A;  4W9L B;  4HAM A;  3DC6 A;  4JYC A;  3JCU Z;  4W4L A;  1XL6 A;  4FPP A;  2UUB B;  2JJ2 G;  1GM7 A;  5EYP B;  2JIZ G;  2YUA A;  1P22 B;  2YIB A;  5EC1 C;  3SJQ C;  4PDR A;  3U10 A;  1O9H A;  4W9E B;  1ZUQ A;  4XDK A; 
#chains in the Genus database with same CATH homology
 1OCC C;  1JVM A;  5L3G A;  2EIN C;  1KEC A;  2IJK A;  1KP2 A;  3BEH A;  3STL C;  3R65 A;  3OW2 U;  1QR9 A;  4GX1 A;  3ZRX A;  3OGC C;  5IY5 C;  1K97 A;  4PA7 A;  3B8M A;  3JD0 A;  3OR6 C;  4QE7 A;  4ZBM A;  3ABK B;  3EFF K;  2WLI B;  4ZKI A;  1OCC B;  2ATK C;  2EIN B;  4JAV A;  4QE9 A;  3ZRV A;  1SER A;  5L3C A;  3STZ C;  3CCQ V;  2OVP A;  4PDV A;  2PPI A;  2DYR C;  5IY5 B;  1W0K G;  3SPJ A;  3ASO C;  4CRH A;  5DAD A;  4FJC C;  1K34 A;  4R50 A;  5L3E A;  1FS0 G;  4F4L A;  2P1N A;  2Z8H A;  1MG1 A;  2R9I A;  3QO8 A;  1G4Y B;  3I56 V;  4XDL A;  4GX2 A;  2DYR B;  4B9K B;  3JCZ A;  4N23 A;  1BMF G;  1PD3 A;  1FXV A;  1W0J G;  3ASO B;  3WFV A;  5CBG A;  1VQ4 V;  3CD6 V;  4BIZ A;  4P2Z A;  4LC1 A;  4N21 A;  1BL8 A;  5CBH A;  5LHG A;  1RM1 C;  4MVS A;  3OGL A;  2ZDI A;  3A0R A;  3E35 A;  1NBM G;  1H8H G;  3EHB B;  3ABT A;  2P1Q A;  3HPL C;  2LFS A;  5CBF A;  3C6P A;  5A6R A;  4MT8 A;  4HXI A;  1I5X A;  5EUP A;  2X6C A;  1S76 D;  4MSW C;  3CME V;  4ASU G;  4KFM A;  3SYO A;  1RM1 B;  3ABL B;  4QNH B;  1K4C C;  3ZMT A;  5KUK A;  1Q81 W;  3K0G A;  3ABU A;  3JD2 A;  2B5U A;  3CC7 V;  1B6Q A;  2EIL B;  4WFH A;  1L1F A;  1MSW D;  2WLL A;  4UV8 A;  2IJH A;  3F7V C;  1YJN V;  3LSS A;  3W7W A;  3MHS C;  5EBL C;  5J9P C;  4FIP C;  4P30 A;  5E1A C;  2PI4 A;  1V55 C;  2Q69 A;  1M57 C;  3OE7 G;  4I9W A;  1FXK C;  2H8P C;  3AG4 C;  3LDC A;  4LCU C;  1KC8 W;  3L2O A;  3OEE G;  5BXB A;  2WLN A;  4UYI A;  1OCZ C;  3CPW U;  3HU6 A;  3KVT A;  4P9P A;  3ZTD B;  4CP3 A;  2QE7 G;  1M90 W;  2X6B A;  1AR1 B;  1DF5 A;  1V55 B;  2Y69 C;  1M57 B;  1ROP A;  3AG4 B;  3LSQ A;  2BOB C;  2WPD G;  2WWW A;  1OCZ B;  3FKC A;  3AG3 C;  2JZ3 C;  4AJY C;  2HJF C;  2JEU A;  4MVR A;  3ZCC A;  3SPI A;  3WG7 C;  5L3B A;  3TCU A;  3CCE V;  1S77 D;  1SZT A;  3HVE B;  1GKF A;  4CXI A;  2OT5 A;  4GT1 A;  5IYB O;  4JTD B;  2P1P A;  3FKS G;  1S72 V;  2YEV A;  4X8A A;  1NEX A;  1NR7 A;  3BIM A;  4J8Z A;  4HZ3 A;  1ZWI C;  2GSM B;  5DAF A;  1S5H C;  2Q68 A;  3FB8 C;  3PJS K;  3ETD A;  3SYC A;  3ZKJ B;  2C9W C;  2DWE C;  2EIJ B;  5H9C A;  1QVG U;  4FK5 C;  2XAJ A;  4G28 B;  4GX5 A;  4PA4 A;  3E83 A;  4PA9 A;  2XAF A;  5B1O A;  4CBC A;  3X2Q C;  1VCB B;  4WQO C;  5H7H A;  5H6Q A;  1YI2 V;  1PNM A;  2P67 A;  5IYD O;  1ENV A;  1F4M A;  3B8N A;  1VQ6 V;  2A0L A;  1AJQ A;  2X7R B;  5BXH A;  3OR7 C;  4BAY A;  1DTO A;  2YSU B;  5EBM C;  4UXN A;  1RPR A;  1JCH A;  3E8G A;  3I3N A;  3AEI A;  1AJN A;  1ARO P;  3K9A A;  3X2Q B;  1IXM A;  3B84 A;  2P90 A;  4PA3 A;  3W7S A;  1VQO V;  4JPR A;  4RO2 A;  3ETG A;  2NLJ C;  3FB5 C;  2H94 A;  3OMN B;  3T2M A;  3RW0 A;  2D3O W;  1P4R A;  3P32 A;  4BKS B;  4U7N A;  1GO3 F;  1TUE B;  1YJW V;  4EOZ A;  1K5S A;  1PNL A;  1HWY A;  2UXX A;  3E8B A;  2QM7 A;  3LUT B;  1DSX A;  2F43 G;  2IH1 C;  3IFX A;  4G27 B;  4I5S A;  3TK1 A;  1VQP V;  1KD1 W;  1HV2 A;  5LHI A;  2DW4 A;  3ASN B;  4W9J B;  1K73 W;  3ZRW A;  4KP4 A;  3OUS A;  4WFB V;  3CCL V;  1NVP D;  3OGK A;  2AHY A;  4TT3 G;  2HR3 A;  1Q86 W;  3CCV V;  1VQ8 V;  2VPK A;  2NN2 A;  3T1C A;  3HQI A;  1E79 G;  4UVA A;  1NVP B;  4GCZ A;  3M5B A;  5C93 A;  3G71 V;  4UVC A;  1K33 A;  1Y4M A;  2IJI A;  3FYE B;  3ZMS A;  3SPH A;  2MK3 A;  1CP9 A;  4H37 A;  4PA6 A;  2ZQM A;  3K08 A;  3OM3 B;  3CC2 V;  1FQV B;  2B1I A;  1M9N A;  4P9O A;  2OTJ V;  1QDW A;  3C6O A;  2QTO A;  3I55 V;  1YHQ V;  4JF3 A;  1F4N A;  4Z1M G;  3CCJ V;  3F7Y C;  1E1R G;  5B3S C;  2V7Q G;  5KA5 A;  3DRY A;  1NJI W;  3M4T A;  4MTX A;  1THZ A;  1P7B A;  1VQ9 V;  3ZRS A;  4W9C B;  3FB6 C;  2JJ1 G;  1AI5 A;  4WFE A;  3HTM A;  2CK3 G;  1QLE C;  4JAS A;  3T4Z A;  4HYO A;  3ABL C;  1CEZ A;  4W9H B;  2IHC A;  1GK9 A;  2R9R B;  4UVB A;  2HG5 C;  5JH5 B;  5B3S B;  1RPO A;  4R7C A;  3JD1 A;  5BZB A;  3DRX A;  3OMI B;  3E2E A;  1DLB A;  2EIL C;  2YEV B;  4BKT B;  2Z5U A;  2JDI G;  2HKO A;  4JTC B;  3G6E V;  1QLE B;  1WLE A;  1QVF U;  1VQM V;  1NN7 A;  3K04 A;  4B9K E;  4UV9 A;  3ZRF B;  1DF4 A;  4RUE A;  2EJR A;  2FTK A;  2Z3Y A;  1K7D A;  2JK5 C;  5LLI B;  1EZJ A;  2OCC C;  3QNE A;  1YSC A;  5CN0 A;  3ZMU A;  1EOF A;  4BIU A;  4QPJ A;  4RAI A;  1E1Q G;  2ASS A;  4R8C A;  1PL0 A;  5EBW C;  4MS2 A;  3IC7 A;  4U77 A;  3OHU A;  1EFR G;  3OUF A;  2OTL V;  2WLM A;  1K92 A;  1H38 A;  2K1E A;  5BO4 C;  1OHH G;  2OCC B;  5CA3 A;  1KP3 A;  1YJ9 V;  3E8F A;  5CMU A;  4RQF A;  1EXB E;  3ZTC B;  1K3E A;  3OAA G;  3H01 A;  3ML0 A;  3ZJZ A;  3K3W A;  1R6N A;  2DYS C;  2OVQ A;  5BXD A;  1FS1 B;  4AWJ B;  3CXC U;  3IGA C;  1VQK V;  3E86 A;  4MW3 A;  2OVR A;  2WLI A;  1UJW B;  3ZN1 A;  5L3D A;  2DYS B;  1Q7Y W;  2IU3 A;  2EIK C;  2ITD C;  5LGU A;  1NR1 A;  4W9D B;  1T1D A;  2EIJ C;  4G2K A;  3ZRW B;  1QLN A;  3RVY A;  4DO2 A;  3CC4 V;  1R3L C;  3CCR V;  4MTO A;  1F23 A;  1LM8 C;  3ZNG B;  4JGS A;  3ETE A;  2AST A;  3ZUN B;  3E4U A;  2XND G;  4J9Y B;  3OGM A;  2EIK B;  4XBF A;  3SPC A;  4W9K B;  1AI7 A;  2Y48 A;  2XOK G;  4CXJ A;  4H33 A;  2V1D A;  1LNQ A;  1NH2 D;  5HFM A;  3M99 B;  1VQN V;  3VBB A;  1AI4 A;  3T4D A;  2DQ3 A;  2JEX A;  1NH2 B;  2ZDI C;  3FB7 C;  5DN6 G;  3G4S V;  4W9H H;  1EBO A;  1COW G;  4Q20 A;  1ORQ C;  1R6K A;  4JAU A;  3LDD A;  2EBO A;  2GHY A;  3K79 A;  1VQ7 V;  5KA6 A;  1BHA A;  1QBZ A;  2W0F C;  3SYA A;  1I5Y A;  1SRY A;  2BOC C;  1NKD A;  3UM7 A;  1BUO A;  2ZXW C;  4KUM A;  2A79 B;  2EIM C;  3E89 A;  3ASN C;  2P7T C;  4LP8 A;  2Q81 A;  4GX0 A;  1PKX A;  2C2A A;  4BGC A;  4JTA B;  4BW5 A;  2WAM A;  4MVZ A;  5KUM A;  3QO5 A;  1FS2 B;  2ZXW B;  1QDV A;  2NNU A;  2EIM B;  2QKS A;  3GB7 C;  4N9F 5;  5L3F A;  3OFN G;  1YIJ V;  2PI5 A;  3CYO A;  1R28 A;  3DTU B;  2WLL B;  4L87 A;  4TSF G;  4QIW F;  3K03 A;  1VQL V;  1JX9 A;  5HYW B;  5EC2 C;  5LHH A;  1PNK A;  4MVM A;  3CCU V;  2QA4 V;  3DCG B;  1QCE A;  1SET A;  1BHB A;  1FXK A;  1WPX A;  2ZR2 A;  3JD4 A;  3SYQ A;  1MOF A;  3BY6 A;  3AG1 C;  3P30 A;  2E31 B;  2DQ0 A;  3HVE A;  4R6Z A;  2IU0 A;  3JD3 A;  1Q82 W;  4JGH C;  4MVU A;  1K9M W;  4XDJ A;  5B1N A;  4QPK A;  1GTO A;  1OZ0 A;  2FNJ C;  4PDM A;  4MTG A;  4RUF A;  2LP7 A;  1JQ0 A;  3RVZ A;  3AG1 B;  2HVK C;  1R3K C;  2P1M A;  4AP2 A;  2IH3 C;  2M7W A;  3D36 A;  4ZGC A;  3ZMV A;  3LDE A;  2Q67 A;  2LFR A;  1FXH A;  3B77 A;  5IDJ A;  5DM6 V;  4E2L A;  1R2B A;  1OCR C;  4RQE A;  4MVO A;  3MHH C;  5EK0 A;  3OMA B;  4FMT A;  1G8M A;  2ITC C;  2DWD C;  4WFG A;  1R73 A;  2YY9 A;  1GMG A;  3GA1 A;  1LQB B;  2Q6A A;  4ZOU A;  1JOY A;  4TWK A;  4MTF A;  4W9I B;  2XAQ A;  3K06 A;  5LGT A;  1OCR B;  3VOU A;  2W6I G;  1N8R W;  1YIT V;  1FFT B;  4CZZ A;  2I2R A;  5FL7 G;  3GWO A;  1S3J A;  2E32 B;  1YTF D;  2XAS A;  2HFE C;  2WLJ A;  1M1K W;  1W2B U;  1YTF B;  3OHV A;  1K5Q A;  3TET A;  1JPX A;  2X6A A;  3HB3 B;  2X0L A;  3AG2 C;  2B1G A;  1GM9 A;  4B95 B;  1M56 C;  1SES A;  3FYI B;  5FTA A;  2P1O A;  4J9Z B;  3W7U A;  3ZIA G;  2IZV C;  5H6R A;  1R3I C;  2KB1 A;  2ZR3 A;  1OCO C;  4MW8 A;  1H2G A;  4WFF A;  3M8V A;  3NXS A;  3DGE A;  3AG2 B;  3RBZ A;  2W6J G;  5B1B C;  1K8A W;  1M56 B;  2EZP A;  3DRZ A;  2HLD G;  2A9H A;  4OXS A;  4WF9 V;  4W9F B;  3V7D A;  5B1A C;  5IYC O;  3OEH G;  4U2N A;  2QM8 A;  4UIJ A;  1QR8 A;  1OCO B;  3JYC A;  1CS3 A;  4YXW G;  3LNM B;  3ZRC B;  1AJP A;  1EOE A;  3K0D A;  1J95 A;  4YY8 A;  5B1B B;  1R3J C;  2NZ0 B;  3QO7 A;  3SPG A;  4WFA V;  1AI6 A;  2UXN A;  4XDK A;  5B1A B;  2QEX V;  4X88 A;  1FXK B;  4APF A;  1CPY A;  1EOD A;  4X89 A;  4QJF B;  3ZMZ A;  1H8E G;  4UUJ C;  1K4D C;  3CP1 A;  5LGN A;  1A68 A;  2EZO A;  4I6J C;  2ZD9 A;  2VKP A;  3C6N A;  1GM8 A;  2Y69 B;  4EKW A;  3CCM V;  5HFL A;  1LDK D;  4U2M A;  1Y66 A;  5GW7 A;  1VQ5 V;  3MKS A;  3W7T A;  2WLH A;  1XL4 A;  3WSO B;  1KKD A;  2P6J A;  3AG3 B;  4PEL A;  2IW5 A;  2IF5 A;  2AHZ A;  3E8H A;  3WG7 B;  3ZN0 A;  2XAH A;  4DXW A;  5H7G A;  3SYP A;  3M52 A;  3CMA V;  1F51 A;  5IBK A;  5A15 A;  3W7X A;  1S0V A;  3ABM C;  4PDL A;  3UKM A;  4W9G B;  4WCE V;  2MA9 C;  3CCS V;  5HZG C;  1KQS U;  3KG2 A;  4W9L B;  3D3I A;  4HAM A;  2WLK A;  4JYC A;  3LBZ A;  2IJJ A;  4JYB A;  5LBQ A;  3ABM B;  1V54 C;  1XL6 A;  4FPP A;  1JJ2 U;  2JJ2 G;  1GM7 A;  1MAB G;  2JIZ G;  1NQT A;  4U7O A;  1P22 B;  3F5W C;  5EC1 C;  2HVJ C;  3SJQ C;  4PDR A;  4MVQ A;  4LBE C;  1S1G A;  2WSS G;  1V54 B;  1R29 A;  3MD0 A;  4W9E B;  4CXT A;  2XAG A;  3ABK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...