2A79B

Mammalian shaker kv1.2 potassium channel- beta subunit complex
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
390
structure length
259
Chain Sequence
CERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGTDPFFIVETLCIIWFSFEFLVRFFAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Voltage-gated potassium channel beta-2 subunit
total genus 79
structure length 259
sequence length 390
ec nomenclature
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00520 Ion_trans Ion transport protein
B PF02214 BTB_2 BTB/POZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2a79B03
1.10.287.930 Mainly Alpha Orthogonal Bundle Helix Hairpins Mammalian shaker kv1.2 potassium channel- beta subunit complex 2a79B02
3.30.710.10 Alpha Beta 2-Layer Sandwich Potassium Channel Kv1.1; Chain A Potassium Channel Kv1.1; Chain A 2a79B01
1EXBE 3WSOB 2Q69A 2DYRC 5A6RA 2WLKA 2E31B 3E8FA 3R65A 2ASTA 4JGHC 2JZ3C 3OHUA 2ZD9A 2EINC 2Y69C 3L2OA 5KUKA 3C6PA 3WG7C 5JH5B 3FB8C 3ASNC 4P2ZA 3STZC 4CXTA 4OXSA 2EIMC 5H7HA 3PJSK 1FS2B 4B9KE 4P30A 1VCBB 3ASOC 4R7CA 1OCOC 3M52A 3LBZA 4ZOUA 5B3SC 3ZNGB 2P1MA 4KFMA 2QKSA 1BUOA 4G28B 4LP8A 3LDEA 3K0GA 4DXWA 2P1OA 2OVRA 1T1DA 4WFHA 4MTOA 5EC1C 1S5HC 4W9DB 4X89A 4W9KB 4QE7A 2P1NA 4W9HB 3E83A 2ITCC 2WLLA 2WLLB 3GA1A 3IFXA 4WFFA 5B1BC 3E89A 3OGKA 5EC2C 3ZRCB 5BXDA 1EOFA 4W9IB 2A0LA 2P1PA 3HQIA 3ZTCB 3E4UA 4H37A 2OVQA 4GX0A 3OGCC 4JTAB 3FB7C 1HV2A 2JK5C 2Q68A 4WFEA 3SPGA 4W9LB 3OHVA 1R28A 2R9RB 3T2MA 3T4DA 3BIMA 3RW0A 4PDLA 1R3LC 2IH1C 2P7TC 5CBFA 2DWEC 1LNQA 2MA9C 4B9KB 2IF5A 3M8VA 2Z8HA 1LQBB 4MVOA 5FTAA 1QDWA 4CXJA 2ZXWC 4MW3A 1OCRC 1ZWIC 3OR6C 4XDKA 2H8PC 3STLC 3KG2A 3IGAC 5EK0A 5CBHA 4W9FB 1FS1B 5CBGA 3K03A 1R2BA 5E1AC 2OCCC 3KVTA 2WLIB 4CP3A 3LDCA 5DADA 4J8ZA 4J9ZB 4BGCA 3ZTDB 2HVJC 3ZJZA 2BOCC 4MVSA 3HVEA 4UYIA 4GX1A 1R3KC 3ZRFB 3JYCA 4PA9A 1XL6A 4MVZA 2QTOA 4GX2A 3UKMA 2X6CA 4PDMA 1V55C 3AG4C 4MTFA 4R8CA 1M56C 5EBLC 5HZGC 3X2QC 3OUFA 5HYWB 4BKTB 3M4TA 4PDRA 4MVUA 4MTGA 2W0FC 4HZ3A 5DAFA 2X6AA 4W9EB 4RO2A 5EBWC 4F4LA 2PPIA 2IH3C 2NLJC 3SJQC 3EFFK 4QE9A 3B84A 3I3NA 3RVYA 1OCZC 2EILC 5BO4C 5EUPA 1R3IC 2WLNA 5BXHA 2YEVA 3DRZA 4PA4A 3K08A 2EIKC 1M57C 3ZUNB 4X8AA 2KB1A 3AG3C 4P9OA 4MSWC 1K4CC 4PA6A 1P7BA 3HVEB 4HXIA 3K06A 4EKWA 4WQOC 4U77A 5BZBA 1OCCC 3OUSA 3MKSA 4EOZA 1XL4A 5KUMA 3T1CA 4P9PA 2WLIA 2EIJC 4N9F5 2Q6AA 4XDJA 1V54C 2A9HA 4G27B 2C9WC 2IHCA 1NN7A 3ABLC 3T4ZA 2X6BA 3C6NA 3ABKC 4CRHA 1G4YB 4B95B 3F7VC 2IZVC 2AHYA 1A68A 4MVQA 1DSXA 2VPKA 4XDLA 4R50A 1ORQC 1KKDA 4PDVA 2ATKC 2WLMA 4MS2A 1J95A 3RBZA 2ASSA 4JTCB 3UM7A 2A79B 2WLJA 3E8BA 4W9JB 3HU6A 2OVPA 3M5BA 4U2NA 4UUJC 2NZ0B 1P22B 3SPHA 2FNJC 3V7DA 3OGMA 1CS3A 4MW8A 1S1GA 3SYQA 2WLHA 3ABMC 3GB7C 5A15A 4UIJA 2I2RA 1K4DC 4W9HH 4I9WA 5LLIB 4TWKA 3VOUA 3HTMA 5J9PC 4MVMA 3FB6C 2NN2A 3HPLC 3OGLA 2BOBC 3SYOA 3BEHA 2DWDC 3TETA 1LDKD 4WFGA 2P1QA 3LDDA 4CXIA 4BW5A 3OR7C 2Q81A 3AG2C 4H33A 4X88A 1EODA 3E8HA 1LM8C 1JVMA 1QDVA 2E32B 3C6OA 5B1AC 4PA3A 3F7YC 2ITDC 4APFA 4RUEA 4W9CB 4AJYC 3RVZA 1R29A 5IY5C 3E8GA 4I6JC 4AWJB 4HYOA 4R6ZA 2K1EA 4MVRA 4RUFA 3TCUA 1EOEA 4J9YB 3F5WC 3SPCA 4CBCA 2HG5C 2DYSC 3LUTB 1NEXA 3SYAA 2HFEC 4RAIA 4LCUC 4ZBMA 3K04A 3ZRSA 1R3JC 5EBMC 2VKPA 3ZKJB 5BXBA 3K0DA 4JTDB 3FKCA 1FQVB 4PA7A 1QLEC 3SYPA 2HVKC 3SPJA 4QNHB 4AP2A 4W9GB 2YY9A 3SPIA 3FB5C 4LBEC 2AHZA 5IBKA 5H7GA 4U2MA 4GX5A 4BKSB 2HJFC 2Q67A 3DCGB 3SYCA 3AG1C 3E86A 3LNMB 1BL8A
chains in the Genus database with same CATH superfamily
3NXSA 4YIOA 3JCZA 5LHHA 4BIUA 4DK1A 1YTFB 1DF4A 2IJHA 2E31B 5IWAB 1IURA 3E8FA 1WPXA 5KMGB 3CC4V 3ZMZA 1HNWB 1PNKA 3ZMVA 1HDJA 1HP8A 2ASTA 4NXMO 1CEZA 1U96A 1RSOA 1Q5OA 3OHUA 3OW2U 2NNUA 1B3QA 2EINC 3G71V 1BE3H 2YIBA 5KAIZ 5KUKA 4YHHB 5LXTB 1I94O 1M5IA 5FPRA 5IJ0B 2JIZG 4Z1VA 3JATB 4IHJB 1ROPA 3BA8A 3KCXA 4KHPO 1VCBB 4WFBV 3B8NA 3BY6A 1T5EA 2PYLA 5B3SC 4FZ0A 1GK9A 3ZMTA 1BUOA 4G28B 1EN4A 3QVNA 3G80A 4YIPA 1W0JG 2DE0X 1BZKA 2QJ1A 2CE4A 1EM1A 4DR7B 1H2LA 1YSCA 4O4JB 3P3NA 2P1OA 2UU9O 4RQEA 3KKYA 1M93A 4TV9A 2Q7HA 3MHHC 1IBLO 4W9DB 4DV6O 2E3CA 4W9KB 4FZ1A 2KQXA 4K0KO 1GM7A 2ETNA 4QE7A 4YY3B 1R1BA 4W9HB 2WLLA 1K34A 5B3SB 2CTQA 4CH3A 3HKDB 3T1HO 1H8HG 2A0LA 2P1PA 4JAAA 3T1YO 4DR5B 2OVQA 5EIBD 3DXRA 4LF6B 2PI4A 3FB7C 1AVMA 3CMEV 1HV2A 1HR0O 2Q68A 4X65O 3OHVA 1VQMV 5A2QN 2E75B 3AG2B 4TUYA 4K3AA 4J7JA 1K8AW 2R9RB 1IDSA 1ZSPA 4UFZA 4PDLA 1R3LC 2QE7G 4U3FH 5JH7B 2DWEC 2IJKA 1AJNA 1LUWA 2GTAA 4FLWA 4JI2B 3H1LH 4LF8O 2ZXWC 1FS0G 4GKJB 1YI2V 3OR6C 4EFEA 1KQSU 1HW7A 2H8PC 5B5EZ 2CUGA 4ZGCA 3STLC 1OV9A 4JI1B 2E74B 2XTAA 3KG2A 4B3MB 5KA5A 1WPBA 5B1BB 1Q6UA 3A8TA 4UXNA 5CBHA 4JI4B 1XNQB 1THZA 4UVBA 1UJWB 1XNRO 3ZRVA 1S5JA 3AG4B 2E5LB 1H2GA 1VQ9V 1X59A 1VQ8V 5ITZB 1JFFA 2F4VB 4DUYO 3HB3B 2UXNA 4BGCA 5JVDB 2HVJC 4UYIA 2KKWA 4GX1A 4JZ2A 3PN1A 3QG5A 3ZRFB 5AG2A 2CTWA 3DC6A 4TQDA 3ZMUA 4WF9V 1DTOA 3H1IH 4PDMA 2F95B 1LR1A 4DK0A 2PTMA 4E4EA 3OUFA 5H9CA 4MVUA 3DXRB 4DR2O 3E35A 1N36B 4H44B 5GTIZ 3IJ4A 1GN6A 2AZ2A 4F4LA 4GKKB 1WLEA 4X20A 4XBFA 2NLJC 3EFFK 2Y4UA 3B84A 1BSMA 3OFNG 4DR2B 4FIPC 5BO4C 5EUPA 5LMUO 2WLNA 3CRAA 1GO3F 4LF5B 2O57A 3K08A 4LFAO 2JGUA 4UCOA 1M57C 4JI3O 2P22C 4X8AA 1GTOA 4LF9B 4DR4O 3IC7A 2X7RB 4O4JA 1Q86W 1FXVA 3OD4A 2IW5A 1JOYA 1Y4MA 3MKSA 1XL4A 1O9GA 3B40A 1QVGU 2WLIA 4Q6GA 1OCZB 4N9F5 3ASOB 4X1KA 2A9HA 2E5LO 4J7KA 4G27B 2C9WC 1H2SB 2YIBD 3ABLC 5B1NA 3MD0A 2Q7EA 4ZHQB 5KHGA 5IJ0A 1F4MA 3FYEB 3F7VC 1VQ4V 5JQGB 4X62O 1MZEA 2XHBA 1D5NA 4MVQA 1S3JA 1VQ5V 3GVMA 4I0XB 3ABMB 4KXRA 2JS5A 1OCCB 2UXCB 3QNEA 3G67A 2KSDA 2ZINA 5LA6A 1GM8A 4MS2A 5CA0A 1J95A 1OZ0A 1XI1A 1M4UA 1EZJA 2WLJA 4K0KB 5CB4A 2OCCB 3ABLB 5LMUB 4W9JB 3CXHF 1IBLB 4U2NA 1PNLA 3E22B 2QWOB 4UUJC 4CC5A 1WJZA 5D5QA 3MHSC 2UU9B 3G6BA 1VMGA 4Z1MG 2QM4A 1P22B 3SPHA 3WFVA 4DR7O 1MNGA 1Y76B 3ZIAG 2PYJA 3SYQA 4DR1B 1AJPA 2UUCB 4DR5O 5A15A 4UIJA 3JD4A 4J41A 3IAYA 3CPWU 3JSNA 3ABUA 5LA6B 1HWYA 3HTMA 1AJQA 4JI0B 4MVMA 2NN2A 5B1AB 1Y74A 4O2BB 4NTXA 4JI5B 1FPOA 4GCZA 1IZ3A 5L3CA 1CXZB 2V4DA 3OMNB 1LDKD 1NVPB 1SQGA 3RYFA 5BY1A 3GWOA 5H2FZ 3L70H 2JS3A 3H1HH 2Q81A 1BT8A 3J81N 3AG2C 2QM7A 3JD1A 3CRMA 1NTKH 4U7NA 3VQVA 1HNWO 2LFSA 1JVMA 1WP8A 2JDIG 3JAWA 3L73H 4O4HB 5B66Z 5LOVB 2HP8A 2PZSA 2E32B 5B1AC 1PPJH 4JI4O 3C6OA 4QPJA 1RPRA 3AK2A 3JAKB 2XASA 5JJEB 1F7YA 2QM8A 4UCSA 2LGWA 4EEQA 4W9CB 4EB6B 2FB5A 2Y48A 4I6JC 3D8CA 5EZYB 4KL1A 1M9NA 4AWJB 2RCVA 3LSSA 1EOEA 2A7WA 2PY5A 4DV5B 4CBCA 4D7SA 2WA4A 1PV0A 3FYIB 4IYIA 3CC7V 2HFEC 3KCYA 4NXNB 2GTSA 3W7WA 1VQPV 3K04A 3ZRSA 2CGNA 3CCRV 4UB8Z 3DRYA 1EZVH 1SERA 4NB5A 4PA7A 1QLEC 3SYPA 4NXNO 3T1YB 2HVKC 3SPJA 3L72H 4NYKA 2F1MA 2Q0AA 4JF3A 2P67A 2H94A 3D3IA 3JASA 4DV5O 1X4TA 3B09A 1MABG 1L1FA 2D2CB 3OM3B 5IYZB 3U11A 1GMGA 2QA4V 4X66O 4LFBB 5LYJA 5FNVB 4N21A 2W6JG 3DCGB 3K3WA 2PI5A 3UQ8A 1BL8A 4JI7B 2MK3A 3JD2A 2F4VO 3OGIB 1A32A 2EIMB 3WSOB 1RM1B 2IU3A 2R9IA 1S77D 4WBNB 4B7KA 5CA0B 4BIZA 3K5MA 3R65A 2QDOA 1G8MA 1QQCA 1VF6A 2ZD9A 3ETEA 3M7MX 4K35A 1XOUA 4KHPB 2X0LA 2UXDO 2Y69C 5TISZ 4JI2O 1BCCH 4LF8B 5FPOA 4EB6A 5JJJB 3STZC 2F23A 1NVPD 2BSKA 5JH7A 1TUBA 2Q73A 1WN7A 4B9KE 4LFBO 2F93B 4AI8A 1V9PA 3RYIA 4X1KB 3FAVB 4UVCA 4DR6O 2UXBO 2QKSA 3JAMN 4JYAO 2WPDG 3AK3A 1NH2D 1AILA 3W7TA 4LP8A 3LDEA 3K0GA 4K8XA 3R66A 4GT1A 1VQNV 1EN5A 4LWSA 1D5AA 1N0NA 3ZS8C 2OVRA 2Y0PA 1P4RA 5EC1C 1S5HC 4X89A 4FM0A 4FFBB 1WB7A 2YEVB 1UFIA 2ITCC 2Q7GA 2EZOA 2DMXA 3OE7G 3E89A 3M99B 2VWJA 1JA8A 4DV6B 3LSQA 1UPGA 4DRXA 2QWNB 4B7EA 3HQIA 4FLTA 1WA8B 2Q8VA 1EBOA 4TQFA 3E4UA 3ZMSA 2ZT9B 3OGCC 1Y76A 5KHIA 4JPRA 3A0HZ 1AR4A 4KUMA 5GONB 2DW4A 3E22A 3OEEG 4J7ZA 1S72V 5F2VO 4X66B 3A2FA 3T4DA 2JVDA 2IH1C 2P7TC 3H1KH 2ZM6O 3JATA 2KG7B 1JX9A 1LNQA 3JCUZ 3M8VA 4L8JA 3RYHA 4DR3B 3AEIA 1KB9F 1QDWA 3D36C 2ZNIA 3P30A 4GZRB 3CJHB 4B3RB 1ZWIC 5JJNB 1AP5A 4XDKA 5CA1B 1RP3B 1KKCA 4NXMB 4GLXA 2JRIA 1H2KA 4FM2A 3L71H 1V55B 5CBGA 4FLUA 4DV4B 3KVTA 2OCCC 1N33O 1JJOA 3C90A 2UUBO 4LFCO 1AROP 2WLIB 1YIJV 1SQBH 5C8YB 3ZJZA 2BCCH 1N36O 3HVEA 3HR0A 1R3KC 3G6EV 4DV3B 1WA8A 2B9ZA 4PA9A 4MVZA 4I55A 4D7TA 5IYZA 4TUYB 1F23A 1ZL8A 2UUAB 1V55C 4MTFA 2BTQB 3APQA 5HZGC 1KECA 5GONA 3X2QC 3H9VA 3OMAB 4MTGA 1YDXA 1Q7YW 5BMVA 2ZIOA 1SQPH 2NR5A 3HKCB 3ICXA 2IU0A 1VQKV 2CGOA 2EJ7A 3SJQC 4JI8O 2VQFO 5BMVB 4JI6O 3J80N 4AHCA 3ZEDA 4CS3A 4RQFA 1NJIW 1SQVH 2EILC 5KLVH 1S76D 3FD9A 5BXHA 1VQ6V 3DRZA 1NTZH 2ZE6A 5IYCO 3FAVA 2VS0A 2PF4E 3ZUNB 3AG1B 1E1RG 1SC5B 2UXCO 3NR7A 1K9MW 2DOSA 2HHHO 1VQOV 5D5PA 2BSKB 1K4CC 1P7BA 3HVEB 4HXIA 4JYYA 2FTKA 3UT5B 5BZBA 1NQTA 3H1JH 2EIJC 4Q20A 5LHIA 2EILB 3A0BZ 4H13B 1H8EG 4XDJA 4YJ2A 1TGOA 2HR3A 2RDCA 4FM1A 1TUBB 4LH6A 2ZR3A 3B77A 3JSLA 2AGAA 2IJJA 3T4ZA 1HR0B 3C6NA 4YJ3A 4B95B 3TK1A 4TOIA 4J80A 3THOA 5EYPB 1Z5VA 2VPKA 1OHHG 1KUQA 1QLEB 2ILMA 4PI0A 3RYCA 2YI9A 5LMNO 4PDVA 4E2LA 2ATKC 4LF7B 2N05A 1Y67A 5H5NA 4OX9B 4LF5O 2A79B 4FLYA 3B2EE 1F4NA 2OVPA 3QF7A 1FAFA 4DW1A 5L3DA 1M90W 1OJHA 3BABA 1S1GA 3DC5A 1QVFU 5CB4B 2Q9LA 2M6YA 2YXHA 4JASA 1DGSA 1PD3A 1K4DC 1VQLV 3CC2V 3ETQA 3CCSV 1US6A 4HNAB 3FB6C 3OGLA 3SYOA 4IL6Z 1KYOF 1KU9A 2DWDC 3K9AA 2RNBA 1IX9A 1K3EA 3FKSG 2GSMB 2P1QA 1NT2B 1SA0A 3OMIB 3W7SA 1ZAUA 4W4KA 2Q4PA 1OCRB 3A0RA 2E76B 5IDJA 2XUMA 2JGDB 1Q6HA 3K79A 3OR7C 1G1XB 4JV5O 4H33A 4X88A 1EODA 4ZOLB 3E8HA 4D6TH 4PJ0Z 4AILC 2UUAO 1XNRB 4LF7O 2YIDA 1Y6XA 1VIBA 1HNXB 2IM9A 4W4LA 1L0LH 3OT7A 4EFBA 4Z2WA 1P7GA 4B3TB 1N0JA 2XAGA 4DR3O 4APFA 2ZKOA 2ZE5A 2ZM6B 3DGEA 3JAWB 4O4HA 3E8GA 1XEQA 4ZOLA 2YICA 3C3TA 1H38A 3ZHTA 1L0NH 2C2AA 4MVRA 3BHPA 3F5WC 3N2GB 2PUSA 3LUTB 1TVKA 3AK1A 2PGGA 2JGDA 4UCRA 1XNQO 1JR9A 1AI5A 1R3JC 5EBMC 3AG7A 1EN6A 4UV9A 3FKCA 4BR6A 1YXBA 4JYAB 5GTHZ 2BTOA 5IY5B 4W9GB 2YC0A 3HKEA 2WSSG 5KA6A 3ZHQA 3SPIA 2GV9A 3FB5C 4I5SA 2ZCEA 3CCUV 4BKSB 4ZI7B 3JASB 5LGNA 3DTUB 3LNMB 3OTFA 1O9HA 1AR5A 5JVDA 3W7XA 4I0XA 1HNZB 5B1OA 5IJ9A 2JEUA 2Q69A 4ASUG 2NN4A 1FFXB 1LUVA 1NTMH 3CB2A 2DYRC 1R6NA 1NI8A 4YJ3B 3CE2A 4JGHC 1SQQH 2OIEA 2N04A 2CAZC 4F6EA 3N2GA 1SESA 1FFTB 1N4CA 4YY3O 3F5TA 1MA1A 5EZYA 2ADPA 3CJHA 3DSQA 4DW0A 3C6PA 1AI6A 3WG7C 5JH5B 1M1KW 4CXTA 2EULA 4TV8B 4OXSA 4IIJA 4ABMA 2KG7A 1FS2B 4LNUA 2P6JA 2CK3G 4ICGA 3L9DA 4R7CA 3LBZA 4ZOUA 1RFYA 2R70A 5JWPA 2Z3YA 3JARA 2UXBB 2P1MA 4KFMA 4FLXA 1COWG 4DUZO 4O2AA 5LP6B 4JZGA 4DV1O 5IWAO 1FD9A 3G4SV 3E2EA 1QR9A 3RYFB 3ZCCA 5GW7A 2GUZB 4IYHA 1Z2GA 2AZ0A 4WFHA 4DRXB 2LQTA 3RN4A 3DRXA 4FFKA 1IXMA 1Y74B 2WLLB 2QWQB 3GA1A 4WFFA 3L75H 1VQ7V 5BXDA 1YJ9V 2WWWA 1KMIZ 1NR1A 4G2KA 4PHZA 1I7FA 3ZN1A 3ZTCB 3HKCA 4H37A 4UCTA 5BR8O 5KHHA 4DV1B 1DLBA 4JTAB 4BAYA 1Q90D 2ZE8A 2YSUB 2JK5C 4WFEA 2RQ6A 2QSAA 4W9LB 3CCMV 1IXBA 3ZHRA 4I55B 1VF6C 3T2MA 1Y66A 3CCJV 1SF9A 3OTOO 4OPHA 4IHJA 4LF4B 5DEDA 4QGPA 2YI8A 3JD0A 2Z0AA 3JALB 2MA9C 4B9KB 2IF5A 4MVOA 5J2TB 3CX5F 4X64B 5FTAA 1K33A 2WAMA 4MW3A 2LW7A 1OCRC 5JQGA 1QLNA 1SRYA 2JJ1G 4HBNA 3IGAC 2FMLA 3CYOA 5EK0A 4CZZA 4W9FB 1FS1B 4YJ2B 3K03A 2DYSB 3EXAA 2LP7A 4I4TB 5E1AC 1PM9A 4CP3A 1KP2A 2OWOA 1AR1B 4J8ZA 3ZTDB 3ASNB 2BOCC 3VQWA 4F6RB 1ZUQA 4JI5O 4NTWA 5IT9N 1GH6A 3HKBA 1SS3A 4ZI7A 4KP4A 3VQYA 3ETDA 1TA8A 1N34O 4QJFB 2QTOA 4GX2A 3UKMA 2X6CA 3AG4C 1V54B 1SQFA 4R8CA 1M56C 2H3OA 4BKTB 3M4TA 3B4SA 2W0FC 3TXSA 4HZ3A 1XMQB 5KX5B 1YJNV 2L6LA 3Q4HA 5DAFA 4RO2A 1IBMO 1Z5WA 5EBWC 4IGGA 2B1GA 4UV8A 2PPIA 2OTLV 4FLZA 2P5OA 4I9QA 5KX5A 3I3NA 1XMQO 4JAUA 1OCZC 2QGNA 1P84F 4JAVA 4O4IA 1D2DA 2QKAA 2BTQA 5LMNB 2EIKC 3K58A 3TGUH 2FL4A 2XAJA 3ABKB 4FK5C 4X62B 2R9AA 4DR1O 4DV3O 1R73A 4IIJB 4C7UA 5CMUA 1GN4A 3K06A 4TV8A 4EKWA 3KZIZ 2GBOA 1OCCC 3OUSA 3CSXA 5KUMA 3OTOB 3FX7A 1BHBA 4CH6A 2DQ0A 4YXWG 2Q6AA 1N33B 1OCOB 3RYIB 5JCOA 4X1YA 3WB1A 5JCOC 2HLDG 1URFA 2VQEB 2X6BA 1YTFD 3ABKC 1SA0B 1FXKA 5LXTA 2XAFA 1XREA 4QIWF 3CRCA 2IZVC 2AHYA 1A68A 3ZBHA 1YZBA 4B3TO 5LBQA 4XDLA 2EX3A 4FJCC 4BW9A 3WB0A 3ZRWB 1PP9H 4LF4O 3ZRXA 5LYJB 2ASSA 1QR8A 4JTCB 4WBNA 3UM7A 3W7UA 1N32O 3APOA 2ADQB 5K1PA 1K5QA 4UCUA 4TT3G 5LL6Y 3HU6A 1WB8A 3M5BA 5IJ9B 4DV7O 3FFQA 3P32A 1K5SA 2XAHA 3QO8A 1I5YA 2EJRA 2FNJC 4DV7B 1GN2A 3OGMA 4PI2A 3TJTA 4DYLA 5FNVA 3ABMC 2I2RA 3ABTA 4W9HH 1KP3A 1FKAO 4JI3B 3ML0A 1SQXH 3VOUA 2QR4A 2YDEA 1W59A 1SZTA 4WFAV 3X2QB 2BE3A 5K1XA 4GKJO 1GKFA 1G6UA 1AI4A 1WAZA 3ZHVA 1B6QA 4L87A 3WG7B 3U0ZA 2ZDIA 1KD1W 4WFGA 4N23A 2R72A 4I50A 3LDDA 4CXIA 4ZHQA 3RGBA 3BRCA 3S3WA 2XAQA 2CTRA 4O2AB 4JYBA 4DUZB 1K92A 3O65A 2QEXV 1AB3A 2GDSA 2HKOA 2QKCA 1XDCA 2F66C 1LM8C 1QDVA 1NH2B 3CCVV 1MZFA 2HJDA 3S3XA 3QTCA 1AI7A 5LP6C 1K97A 4YY8A 2ZIMA 4PA3A 4LF6O 3I55V 5KHJA 4LH7A 3AG3B 1CPYA 3F7YC 4RUEA 4AJYC 2W6IG 1XMOO 4DUYB 2FKXA 1R29A 3LNNA 2UXDB 4GYCB 3CD6V 4HYOA 2EIJB 2Q0OC 4I7ZB 2D3OW 4O4IB 2K1EA 3TCUA 4H0LB 4MT8A 2HG5C 4HNAA 1NS1A 2DYSC 4TSFG 1YF2A 2G38A 4RAIA 3ZX6A 5L3GA 3EVKA 2XNDG 2ZNJA 4ZBMA 4DV2B 4B3MO 1FXKC 4UVAA 3ZKJB 5BXBA 1H2NA 3K0DA 1RM1C 1MSDA 4IT5A 5BR8B 1RPOA 4PELA 1ENVA 2LW1A 1JQ0A 2YY9A 1XHZA 3RFRA 4LBEC 3CRQA 4X1IB 2AHZA 5IBKA 1DF5A 2YXYA 1BS3A 5H7GA 3CCLV 5DN6G 2AW9A 2Q67A 1TAEA 3ETGA 5LGUA 3SYCA 1XMOB 3AG1C 1I94B 2MW2B 2Y69B 1E79G 1BGYH 4YHHO 2DQ3A 1EXBE 1KBHA 5EYPA 3U10A 5H6QA 3K57A 5A6RA 2WLKA 2ARHA 3ZHUA 4DV4O 5E79Z 1BQ0A 2DJVA 1VF7A 3VQXA 2JZ3C 1TVKB 3ZRWA 1YCIA 3CHXA 1JCHA 1GM9A 4NKGB 3K5NA 3JD3A 3TXQA 5CA3A 5CA1A 1W2BU 1PL4A 5IE9A 2P90A 2P4KA 3L2OA 1J5EB 3FB8C 3ASNC 4P2ZA 2RMKB 2ZDIC 2JEXA 2EIMC 5H7HA 1Q3EA 3PJSK 5J2UB 5HFMA 4B08A 2V1DA 4P30A 3ZHSA 3SJBC 4PD4F 4LFCB 2UUBB 1MMMA 3ASOC 1OCOC 1QHTA 1HNXO 3M52A 1PKXA 2ZR2A 3ZNGB 2AXTZ 4A5UB 1NBMG 4JI1O 3CCEV 1VARA 3QO5A 5CN0A 3J7AU 5FLXN 4DXWA 3CS5A 4I50B 1PL0A 4X20B 1FYJA 4DV2O 2ZXWB 1T1DA 4BWAA 2L35A 1J5EO 4MTOA 1MOFA 3I5DA 3D36A 3BVOA 2P1NA 3E83A 3IFXA 4FFBA 5B1BC 3OGKA 5EC2C 3ZRCB 4FLVA 2EIKB 2N74A 1EOFA 4W9IB 2EINB 4QPKA 4NTYA 3O9OA 1QNMA 2CDYA 5KHKA 1WP7A 1L8DA 4ZKIA 4GX0A 4B3SB 2EZPA 4F6RA 1GAXA 5FL7G 1W0KG 3BPZA 1FJGO 4U3JA 2Y4TA 3BAAA 3BA9A 2B1IA 3SPGA 3WU2Z 4OPAA 3JARB 1R28A 2Z5UA 2CTPA 4CS2A 2Q5ZA 4JYCA 5L3FA 3BIMA 3RW0A 1MG1A 1M56B 5CBFA 1DK1A 2Z8HA 1LQBB 1VEWA 1VF5B 5C8YA 1FXHA 1U97A 1SKVA 4CXJA 1JFFB 2DYRB 2JJ2G 4I4TA 2WA3A 3RYHB 2EBOA 4K8ZA 4DV0O 3JALA 3MDSA 1Q6IA 3ZN0A 5DM6V 4NVPA 4CH4A 4X1YB 1R2BA 1S0VA 2A06H 3K5OA 5C93A 1B06A 2QWPB 3BFRA 3LDCA 5DADA 1SETA 4RWUA 1HNZO 2FYUH 4J9ZB 5J2TA 5A9GA 5L3BA 4MVSA 1NZ6A 5KAFZ 4GUNA 1AP6A 1TUEB 3JYCA 3WB2A 2OYQA 2HHHB 4U7OA 4J42A 1XL6A 2LO1A 2YXLA 1I5XA 2F43G 5LGTA 2OCHA 4LFAB 3MAQA 1S5LZ 1IVSA 1NU1H 5EBLC 4U3JB 2VWKA 5HYWB 4PDRA 5BXZA 2ZQMA 5IYDO 1QCEA 3SR2C 3CWBH 2X6AA 4W9EB 1N8RW 4GKKO 3GWKC 4FPPA 1F51A 4LWSB 1E1QG 2IH3C 3QO7A 4QE9A 3CRRA 4JGSA 3RVYA 4BIOA 2A3QA 2QWRB 4OGQB 1Q43A 1R3IC 1ZLZA 2YEVA 2IBZH 4PA4A 4OX9O 1ZL8B 2Y0IA 1SZXA 4X9QA 2GUZA 2LFRA 1BQZA 2LJ2A 2KB1A 3AG3C 4LNUB 4MTXA 4P9OA 3I56V 4MSWC 4PA6A 4J10A 3JAKA 4WQOC 5LP6A 3SJAC 4U77A 3M8AA 2XOKG 3IC9A 3L74H 4EOZA 3SGIA 1YITV 3T1CA 4NR1A 4CH5A 4P9PA 1XILA 5ITZA 2V7QG 4UCVA 1V54C 4JV5B 2YIAA 1NR7A 2HEPA 1N32B 1XQ8A 2IHCA 1NN7A 2GHYA 1YVWA 4CRHA 4AQYO 1G4YB 1KC8W 3BCCH 3OEHG 1FFXA 4B3RO 2UXXA 3RT3C 1DSXA 1YHQV 4R50A 1IBKO 1ZTEA 1GN3A 4PV1B 1RSOB 4JI0O 1ORQC 5L3EA 3K9SA 1KKDA 2CH7B 1VP7A 2WLMA 2VQEO 3RBZA 3B8MA 2YUAA 5HFLA 2ODMA 3LSUA 3E8BA 1YEWA 3P3PA 5DECA 3SJCC 4HAMA 2VQFB 2NZ0B 1BMFG 1Q8IA 4JI8B 5IYBO 3V7DA 2DN9A 1IBMB 1R6TA 1CS3A 4MW8A 1JMKC 1K7DA 1XHXA 2WLHA 3GB7C 5H6RA 1WNSA 5LLIB 4I9WA 4TWKA 4DO2A 1EFRG 1NKDA 5LHGA 3HKDA 2CH7A 5J9PC 3OAAG 1N34B 3HPLC 2BOBC 1JJ2U 3BEHA 2UUCO 2P4VA 4TV9B 1JPXA 4LR3A 3TETA 3N2KB 1XUQA 1FXKB 4WCEV 1CP9A 1Q81W 4BW5A 1R6KA 4O4LB 2LGQA 3UO2A 1ZX3A 5LOVA 2P06A 2B5UA 1B04A 4LC1A 2VRZA 4FMTA 2W0XA 4DR6B 1FJGB 2QTSA 2RN9A 3UT5A 4B3SO 2XT9A 1IBKB 4CS4A 5J2UA 1BHAA 2RJZA 2ITDC 1XBLA 1QBZA 3D3QA 1QU7A 1YJWV 1I0HA 4DR4B 3EHBB 4UB6Z 3CEIA 2OT5A 3K5LA 4X64O 3RVZA 3UCSC 4AQYB 5IY5C 3CP1A 1PNMA 4R6ZA 3K59A 4RUFA 4J9YB 3SPCA 4O4LA 1NEXA 3SYAA 4JI6B 3VBBA 4X65B 2M7WA 3H01A 1I08A 3N27A 4LCUC 5KMGA 4DV0B 1GRJA 2VKPA 2OTJV 3N2KA 3Q4HB 3CMAV 4J11A 4JTDB 1FQVB 4O2BA 3SDLA 2ZE7A 5EIBC 3UO3A 1MSWD 4JI7O 3T1HB 4QNHB 4AP2A 4LF9O 3CXCU 2IJIA 4CC6A 4ZIBA 1H2MA 2OIGA 3RWRD 4FVMA 3C3SA 1P49A 4X1IA 3CCQV 4GX5A 4U2MA 2K9PA 2HJFC 3HKBB 2YS8A 1M57B 3HKEB 1K73W 3E86A 3RYCB 1Q82W
chains in the Genus database with same CATH topology
3W7XA 3NXSA 2MK3A 2DQ3A 1EXBE 3JCZA 3JD2A 5B1OA 5LHHA 4BIUA 2JEUA 2EIMB 3WSOB 2Q69A 4ASUG 1RM1B 1YTFB 1DF4A 2IU3A 2R9IA 5H6QA 2IJHA 2DYRC 5A6RA 2WLKA 2E31B 1R6NA 3E8FA 1WPXA 3CC4V 1S77D 3ZMZA 1PNKA 3ZMVA 4BIZA 3R65A 2ASTA 4JGHC 2JZ3C 1G8MA 1CEZA 3ZRWA 1JCHA 1GM9A 1SESA 3OHUA 3JD3A 2ZD9A 5CA3A 3ETEA 3OW2U 1FFTB 1W2BU 2X0LA 2NNUA 2P90A 2EINC 3G71V 2Y69C 3L2OA 5KUKA 3C6PA 1AI6A 3WG7C 5JH5B 3FB8C 3ASNC 4P2ZA 3STZC 1M1KW 4CXTA 1NVPD 2ZDIC 4OXSA 2JEXA 2EIMC 2JIZG 5H7HA 3PJSK 1FS2B 4B9KE 5HFMA 2P6JA 2V1DA 1ROPA 4P30A 2CK3G 1VCBB 4WFBV 3ASOC 3B8NA 4R7CA 1OCOC 3BY6A 3M52A 3LBZA 4ZOUA 1PKXA 5B3SC 4UVCA 2Z3YA 2ZR2A 3ZNGB 1GK9A 2P1MA 4KFMA 2QKSA 1COWG 3ZMTA 2WPDG 1BUOA 4G28B 1NH2D 1NBMG 1W0JG 3W7TA 4LP8A 3LDEA 3K0GA 3CCEV 4GT1A 3G4SV 1VQNV 3E2EA 1YSCA 3QO5A 5CN0A 4DXWA 1QR9A 2P1OA 1PL0A 2OVRA 4RQEA 3ZCCA 2ZXWB 1P4RA 5GW7A 1T1DA 4WFHA 4MTOA 1MOFA 3MHHC 1S5HC 5EC1C 4W9DB 4X89A 4W9KB 3DRXA 3D36A 1IXMA 1GM7A 4QE7A 2YEVB 2P1NA 4W9HB 3E83A 2ITCC 2WLLA 2WLLB 3GA1A 2EZOA 3IFXA 4WFFA 1K34A 5B1BC 5B3SB 3OE7G 3E89A 3M99B 3OGKA 1VQ7V 5EC2C 3ZRCB 2EIKB 3LSQA 5BXDA 1YJ9V 1H8HG 2WWWA 1EOFA 4W9IB 2EINB 4QPKA 1NR1A 2A0LA 4G2KA 3ZN1A 2P1PA 3HQIA 3ZTCB 1EBOA 3E4UA 3ZMSA 4H37A 2OVQA 4ZKIA 4GX0A 3OGCC 1DLBA 4JTAB 2EZPA 4JPRA 4BAYA 3FB7C 5FL7G 2PI4A 4KUMA 1W0KG 3CMEV 2YSUB 1HV2A 2JK5C 2Q68A 4WFEA 2DW4A 3SPGA 2B1IA 4W9LB 3CCMV 3OHVA 3OEEG 1VQMV 1S72V 1R28A 2Z5UA 3AG2B 1K8AW 2R9RB 3T2MA 1Y66A 4JYCA 5L3FA 3T4DA 3BIMA 3RW0A 4PDLA 1MG1A 1R3LC 3CCJV 2IH1C 1M56B 2P7TC 2QE7G 5CBFA 2DWEC 1JX9A 3JD0A 2IJKA 1LNQA 2MA9C 4B9KB 2IF5A 3M8VA 2Z8HA 1LQBB 4MVOA 5FTAA 1FXHA 1K33A 1AJNA 3AEIA 1QDWA 4CXJA 3P30A 2WAMA 2ZXWC 4MW3A 1FS0G 1OCRC 1ZWIC 1YI2V 3OR6C 1KQSU 4XDKA 2H8PC 2DYRB 2JJ2G 1QLNA 4ZGCA 1SRYA 2JJ1G 3STLC 2EBOA 3KG2A 5KA5A 3IGAC 3CYOA 5EK0A 5B1BB 5CBHA 4UXNA 4CZZA 4W9FB 1THZA 3ZN0A 1FS1B 4UVBA 1UJWB 5DM6V 3ZRVA 1V55B 3AG4B 5CBGA 3K03A 1R2BA 2DYSB 1S0VA 2LP7A 5E1AC 1H2GA 2OCCC 1VQ9V 3KVTA 5C93A 1VQ8V 1AROP 2WLIB 4CP3A 3LDCA 5DADA 1SETA 1KP2A 1YIJV 1AR1B 3HB3B 2UXNA 4J8ZA 4J9ZB 4BGCA 3ZTDB 2HVJC 3ASNB 5L3BA 3ZJZA 2BOCC 4MVSA 3HVEA 4UYIA 1TUEB 4GX1A 1R3KC 3G6EV 3ZRFB 3JYCA 4KP4A 3ETDA 4U7OA 4PA9A 1XL6A 4MVZA 3ZMUA 1I5XA 2F43G 5LGTA 4QJFB 2QTOA 4WF9V 4GX2A 3UKMA 2X6CA 1DTOA 1F23A 4PDMA 1V55C 1V54B 3AG4C 4MTFA 1M56C 4R8CA 5EBLC 5HZGC 1KECA 3X2QC 3OUFA 5HYWB 4BKTB 5H9CA 3M4TA 4PDRA 3OMAB 2ZQMA 4MVUA 4MTGA 5IYDO 2W0FC 4HZ3A 1Q7YW 3E35A 1YJNV 1QCEA 5DAFA 2X6AA 4W9EB 4RO2A 1N8RW 5EBWC 4F4LA 4FPPA 2B1GA 1WLEA 4UV8A 2IU0A 2PPIA 1F51A 1VQKV 2OTLV 4XBFA 1E1QG 2IH3C 2NLJC 3SJQC 3QO7A 3EFFK 4QE9A 3B84A 3I3NA 3OFNG 4JAUA 4JGSA 3RVYA 4RQFA 1NJIW 1OCZC 2EILC 4FIPC 1S76D 5EUPA 5BO4C 5LLIB 1R3IC 2WLNA 1VQ6V 2YEVA 5BXHA 4JAVA 1GO3F 3DRZA 4PA4A 3K08A 2EIKC 5IYCO 1M57C 3ZUNB 3AG1B 2XAJA 1E1RG 3ABKB 4X8AA 1GTOA 2LFRA 3IC7A 4FK5C 1K9MW 2KB1A 2X7RB 3AG3C 1Q86W 4MTXA 1FXVA 1R73A 4P9OA 4MSWC 3I56V 1VQOV 5CMUA 1K4CC 4PA6A 1P7BA 3HVEB 4HXIA 3K06A 2IW5A 4EKWA 1JOYA 4WQOC 4U77A 1Y4MA 2FTKA 2XOKG 5BZBA 1OCCC 3OUSA 3MKSA 4EOZA 1NQTA 1YITV 1XL4A 5KUMA 3T1CA 1QVGU 4P9PA 1BHBA 2DQ0A 2WLIA 2EIJC 1OCZB 4Q20A 5LHIA 2EILB 2V7QG 4YXWG 4N9F5 1H8EG 2Q6AA 3ASOB 1V54C 4XDJA 1OCOB 2A9HA 1NR7A 4G27B 2C9WC 2HLDG 2IHCA 1NN7A 3ABLC 2HR3A 2GHYA 5B1NA 3MD0A 2ZR3A 3B77A 2X6BA 3T4ZA 2IJJA 3C6NA 1YTFD 3ABKC 1F4MA 4CRHA 1G4YB 4B95B 1FXKA 3TK1A 1KC8W 2XAFA 4QIWF 3OEHG 3FYEB 3F7VC 2IZVC 1VQ4V 2AHYA 1A68A 4MVQA 2UXXA 1S3JA 1VQ5V 1OHHG 1DSXA 2VPKA 5LBQA 4XDLA 1YHQV 1QLEB 4R50A 3ABMB 1OCCB 4FJCC 3QNEA 1ORQC 5L3EA 1KKDA 3ZRWB 4PDVA 4E2LA 2ATKC 2WLMA 1GM8A 3ZRXA 4MS2A 1J95A 1OZ0A 3RBZA 2ASSA 1QR8A 1EZJA 3B8MA 4JTCB 5HFLA 3UM7A 2A79B 2WLJA 3W7UA 2OCCB 3ABLB 3E8BA 4W9JB 1K5QA 1F4NA 4TT3G 3HU6A 2OVPA 3M5BA 4U2NA 1PNLA 4HAMA 4UUJC 3P32A 5L3DA 1K5SA 2XAHA 1BMFG 3MHSC 2NZ0B 1M90W 5IYBO 4Z1MG 1P22B 3SPHA 3QO8A 1I5YA 2EJRA 3WFVA 2FNJC 3V7DA 3OGMA 1CS3A 4MW8A 3ZIAG 1S1GA 3SYQA 1K7DA 1QVFU 1AJPA 2WLHA 3ABMC 3GB7C 5A15A 4UIJA 3JD4A 5H6RA 2I2RA 4JASA 1PD3A 3ABTA 1K4DC 4W9HH 4I9WA 1KP3A 4TWKA 4DO2A 1VQLV 3CC2V 1EFRG 3ML0A 3CPWU 3VOUA 3ABUA 1NKDA 1HWYA 5LHGA 3HTMA 3CCSV 1AJQA 5J9PC 4MVMA 3OAAG 1SZTA 3FB6C 4WFAV 2NN2A 5B1AB 3HPLC 3X2QB 3OGLA 2BOBC 3SYOA 1JJ2U 1GKFA 3BEHA 1AI4A 2DWDC 4GCZA 1JPXA 5L3CA 3TETA 3K9AA 1B6QA 4L87A 3OMNB 1K3EA 2ZDIA 3FKSG 3WG7B 1KD1W 2GSMB 1FXKB 4WFGA 4N23A 4WCEV 1LDKD 1NVPB 1CP9A 3OMIB 3W7SA 2P1QA 1Q81W 1OCRB 3LDDA 3A0RA 4CXIA 3GWOA 5IDJA 4BW5A 1R6KA 3K79A 3OR7C 2Q81A 2XAQA 3AG2C 2QM7A 3JD1A 4H33A 4JYBA 1K92A 2QEXV 2HKOA 2B5UA 4U7NA 4X88A 1EODA 3E8HA 2LFSA 4LC1A 1JVMA 1LM8C 1QDVA 4FMTA 1NH2B 2JDIG 3CCVV 2E32B 3C6OA 5B1AC 4QPJA 1AI7A 4YY8A 1K97A 1RPRA 4PA3A 2XASA 3I55V 3AG3B 1CPYA 3F7YC 1BHAA 2QM8A 2ITDC 2XAGA 1QBZA 1YJWV 4APFA 4RUEA 3EHBB 4W9CB 4AJYC 2W6IG 2OT5A 3DGEA 3RVZA 1R29A 2Y48A 5IY5C 3E8GA 4I6JC 3CP1A 1M9NA 4AWJB 3CD6V 4HYOA 2EIJB 1H38A 1PNMA 2D3OW 4R6ZA 3LSSA 2C2AA 2K1EA 4MVRA 4RUFA 3TCUA 1EOEA 4J9YB 3F5WC 4MT8A 3SPCA 4CBCA 2HG5C 3FYIB 2DYSC 3LUTB 3CC7V 3SYAA 3VBBA 1NEXA 2HFEC 4TSFG 2M7WA 4RAIA 3H01A 5L3GA 2XNDG 3W7WA 4LCUC 4ZBMA 1VQPV 1AI5A 3K04A 3ZRSA 1R3JC 5EBMC 2VKPA 3CCRV 2OTJV 1FXKC 4UVAA 4UV9A 3ZKJB 3CMAV 3DRYA 5BXBA 3K0DA 1RM1C 4JTDB 3FKCA 1SERA 1FQVB 4PA7A 1QLEC 1RPOA 3SYPA 4PELA 1MSWD 2HVKC 3SPJA 4QNHB 5IY5B 1ENVA 4AP2A 3CXCU 2IJIA 4W9GB 4JF3A 2P67A 2WSSG 1JQ0A 2H94A 5KA6A 2YY9A 3D3IA 3SPIA 3FB5C 4LBEC 4I5SA 1MABG 2AHZA 3OM3B 1L1FA 5IBKA 1DF5A 1GMGA 2QA4V 5H7GA 3CCUV 3CCQV 4GX5A 3CCLV 5DN6G 4U2MA 4BKSB 2HJFC 2Q67A 4N21A 2W6JG 3ETGA 1M57B 5LGNA 5LGUA 3SYCA 3DCGB 3AG1C 3DTUB 1K73W 3K3WA 3E86A 3LNMB 2Y69B 2PI5A 1E79G 1BL8A 1Q82W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EXB E;  3WSO B;  2Q69 A;  2DYR C;  5A6R A;  2WLK A;  2E31 B;  3E8F A;  3R65 A;  2AST A;  4JGH C;  2JZ3 C;  3OHU A;  2ZD9 A;  2EIN C;  2Y69 C;  3L2O A;  5KUK A;  3C6P A;  3WG7 C;  5JH5 B;  3FB8 C;  3ASN C;  4P2Z A;  3STZ C;  4CXT A;  4OXS A;  2EIM C;  5H7H A;  3PJS K;  1FS2 B;  4B9K E;  4P30 A;  1VCB B;  3ASO C;  4R7C A;  1OCO C;  3M52 A;  3LBZ A;  4ZOU A;  5B3S C;  3ZNG B;  2P1M A;  4KFM A;  2QKS A;  1BUO A;  4G28 B;  4LP8 A;  3LDE A;  3K0G A;  4DXW A;  2P1O A;  2OVR A;  1T1D A;  4WFH A;  4MTO A;  5EC1 C;  1S5H C;  4W9D B;  4X89 A;  4W9K B;  4QE7 A;  2P1N A;  4W9H B;  3E83 A;  2ITC C;  2WLL A;  2WLL B;  3GA1 A;  3IFX A;  4WFF A;  5B1B C;  3E89 A;  3OGK A;  5EC2 C;  3ZRC B;  5BXD A;  1EOF A;  4W9I B;  2A0L A;  2P1P A;  3HQI A;  3ZTC B;  3E4U A;  4H37 A;  2OVQ A;  4GX0 A;  3OGC C;  4JTA B;  3FB7 C;  1HV2 A;  2JK5 C;  2Q68 A;  4WFE A;  3SPG A;  4W9L B;  3OHV A;  1R28 A;  2R9R B;  3T2M A;  3T4D A;  3BIM A;  3RW0 A;  4PDL A;  1R3L C;  2IH1 C;  2P7T C;  5CBF A;  2DWE C;  1LNQ A;  2MA9 C;  4B9K B;  2IF5 A;  3M8V A;  2Z8H A;  1LQB B;  4MVO A;  5FTA A;  1QDW A;  4CXJ A;  2ZXW C;  4MW3 A;  1OCR C;  1ZWI C;  3OR6 C;  4XDK A;  2H8P C;  3STL C;  3KG2 A;  3IGA C;  5EK0 A;  5CBH A;  4W9F B;  1FS1 B;  5CBG A;  3K03 A;  1R2B A;  5E1A C;  2OCC C;  3KVT A;  2WLI B;  4CP3 A;  3LDC A;  5DAD A;  4J8Z A;  4J9Z B;  4BGC A;  3ZTD B;  2HVJ C;  3ZJZ A;  2BOC C;  4MVS A;  3HVE A;  4UYI A;  4GX1 A;  1R3K C;  3ZRF B;  3JYC A;  4PA9 A;  1XL6 A;  4MVZ A;  2QTO A;  4GX2 A;  3UKM A;  2X6C A;  4PDM A;  1V55 C;  3AG4 C;  4MTF A;  4R8C A;  1M56 C;  5EBL C;  5HZG C;  3X2Q C;  3OUF A;  5HYW B;  4BKT B;  3M4T A;  4PDR A;  4MVU A;  4MTG A;  2W0F C;  4HZ3 A;  5DAF A;  2X6A A;  4W9E B;  4RO2 A;  5EBW C;  4F4L A;  2PPI A;  2IH3 C;  2NLJ C;  3SJQ C;  3EFF K;  4QE9 A;  3B84 A;  3I3N A;  3RVY A;  1OCZ C;  2EIL C;  5BO4 C;  5EUP A;  1R3I C;  2WLN A;  5BXH A;  2YEV A;  3DRZ A;  4PA4 A;  3K08 A;  2EIK C;  1M57 C;  3ZUN B;  4X8A A;  2KB1 A;  3AG3 C;  4P9O A;  4MSW C;  1K4C C;  4PA6 A;  1P7B A;  3HVE B;  4HXI A;  3K06 A;  4EKW A;  4WQO C;  4U77 A;  5BZB A;  1OCC C;  3OUS A;  3MKS A;  4EOZ A;  1XL4 A;  5KUM A;  3T1C A;  4P9P A;  2WLI A;  2EIJ C;  4N9F 5;  2Q6A A;  4XDJ A;  1V54 C;  2A9H A;  4G27 B;  2C9W C;  2IHC A;  1NN7 A;  3ABL C;  3T4Z A;  2X6B A;  3C6N A;  3ABK C;  4CRH A;  1G4Y B;  4B95 B;  3F7V C;  2IZV C;  2AHY A;  1A68 A;  4MVQ A;  1DSX A;  2VPK A;  4XDL A;  4R50 A;  1ORQ C;  1KKD A;  4PDV A;  2ATK C;  2WLM A;  4MS2 A;  1J95 A;  3RBZ A;  2ASS A;  4JTC B;  3UM7 A;  2A79 B;  2WLJ A;  3E8B A;  4W9J B;  3HU6 A;  2OVP A;  3M5B A;  4U2N A;  4UUJ C;  2NZ0 B;  1P22 B;  3SPH A;  2FNJ C;  3V7D A;  3OGM A;  1CS3 A;  4MW8 A;  1S1G A;  3SYQ A;  2WLH A;  3ABM C;  3GB7 C;  5A15 A;  4UIJ A;  2I2R A;  1K4D C;  4W9H H;  4I9W A;  5LLI B;  4TWK A;  3VOU A;  3HTM A;  5J9P C;  4MVM A;  3FB6 C;  2NN2 A;  3HPL C;  3OGL A;  2BOB C;  3SYO A;  3BEH A;  2DWD C;  3TET A;  1LDK D;  4WFG A;  2P1Q A;  3LDD A;  4CXI A;  4BW5 A;  3OR7 C;  2Q81 A;  3AG2 C;  4H33 A;  4X88 A;  1EOD A;  3E8H A;  1LM8 C;  1JVM A;  1QDV A;  2E32 B;  3C6O A;  5B1A C;  4PA3 A;  3F7Y C;  2ITD C;  4APF A;  4RUE A;  4W9C B;  4AJY C;  3RVZ A;  1R29 A;  5IY5 C;  3E8G A;  4I6J C;  4AWJ B;  4HYO A;  4R6Z A;  2K1E A;  4MVR A;  4RUF A;  3TCU A;  1EOE A;  4J9Y B;  3F5W C;  3SPC A;  4CBC A;  2HG5 C;  2DYS C;  3LUT B;  1NEX A;  3SYA A;  2HFE C;  4RAI A;  4LCU C;  4ZBM A;  3K04 A;  3ZRS A;  1R3J C;  5EBM C;  2VKP A;  3ZKJ B;  5BXB A;  3K0D A;  4JTD B;  3FKC A;  1FQV B;  4PA7 A;  1QLE C;  3SYP A;  2HVK C;  3SPJ A;  4QNH B;  4AP2 A;  4W9G B;  2YY9 A;  3SPI A;  3FB5 C;  4LBE C;  2AHZ A;  5IBK A;  5H7G A;  4U2M A;  4GX5 A;  4BKS B;  2HJF C;  2Q67 A;  3DCG B;  3SYC A;  3AG1 C;  3E86 A;  3LNM B;  1BL8 A; 
#chains in the Genus database with same CATH topology
 3NXS A;  4YIO A;  3JCZ A;  5LHH A;  4BIU A;  4DK1 A;  1YTF B;  1DF4 A;  2IJH A;  2E31 B;  5IWA B;  1IUR A;  3E8F A;  1WPX A;  5KMG B;  3CC4 V;  3ZMZ A;  1HNW B;  1PNK A;  3ZMV A;  1HDJ A;  1HP8 A;  2AST A;  4NXM O;  1CEZ A;  1U96 A;  1RSO A;  1Q5O A;  3OHU A;  3OW2 U;  2NNU A;  1B3Q A;  2EIN C;  3G71 V;  1BE3 H;  2YIB A;  5KAI Z;  5KUK A;  4YHH B;  5LXT B;  1I94 O;  1M5I A;  5FPR A;  5IJ0 B;  2JIZ G;  4Z1V A;  3JAT B;  4IHJ B;  1ROP A;  3BA8 A;  3KCX A;  4KHP O;  1VCB B;  4WFB V;  3B8N A;  3BY6 A;  1T5E A;  2PYL A;  5B3S C;  4FZ0 A;  1GK9 A;  3ZMT A;  1BUO A;  4G28 B;  1EN4 A;  3QVN A;  3G80 A;  4YIP A;  1W0J G;  2DE0 X;  1BZK A;  2QJ1 A;  2CE4 A;  1EM1 A;  4DR7 B;  1H2L A;  1YSC A;  4O4J B;  3P3N A;  2P1O A;  2UU9 O;  4RQE A;  3KKY A;  1M93 A;  4TV9 A;  2Q7H A;  3MHH C;  1IBL O;  4W9D B;  4DV6 O;  2E3C A;  4W9K B;  4FZ1 A;  2KQX A;  4K0K O;  1GM7 A;  2ETN A;  4QE7 A;  4YY3 B;  1R1B A;  4W9H B;  2WLL A;  1K34 A;  5B3S B;  2CTQ A;  4CH3 A;  3HKD B;  3T1H O;  1H8H G;  2A0L A;  2P1P A;  4JAA A;  3T1Y O;  4DR5 B;  2OVQ A;  5EIB D;  3DXR A;  4LF6 B;  2PI4 A;  3FB7 C;  1AVM A;  3CME V;  1HV2 A;  1HR0 O;  2Q68 A;  4X65 O;  3OHV A;  1VQM V;  5A2Q N;  2E75 B;  3AG2 B;  4TUY A;  4K3A A;  4J7J A;  1K8A W;  2R9R B;  1IDS A;  1ZSP A;  4UFZ A;  4PDL A;  1R3L C;  2QE7 G;  4U3F H;  5JH7 B;  2DWE C;  2IJK A;  1AJN A;  1LUW A;  2GTA A;  4FLW A;  4JI2 B;  3H1L H;  4LF8 O;  2ZXW C;  1FS0 G;  4GKJ B;  1YI2 V;  3OR6 C;  4EFE A;  1KQS U;  1HW7 A;  2H8P C;  5B5E Z;  2CUG A;  4ZGC A;  3STL C;  1OV9 A;  4JI1 B;  2E74 B;  2XTA A;  3KG2 A;  4B3M B;  5KA5 A;  1WPB A;  5B1B B;  1Q6U A;  3A8T A;  4UXN A;  5CBH A;  4JI4 B;  1XNQ B;  1THZ A;  4UVB A;  1UJW B;  1XNR O;  3ZRV A;  1S5J A;  3AG4 B;  2E5L B;  1H2G A;  1VQ9 V;  1X59 A;  1VQ8 V;  5ITZ B;  1JFF A;  2F4V B;  4DUY O;  3HB3 B;  2UXN A;  4BGC A;  5JVD B;  2HVJ C;  4UYI A;  2KKW A;  4GX1 A;  4JZ2 A;  3PN1 A;  3QG5 A;  3ZRF B;  5AG2 A;  2CTW A;  3DC6 A;  4TQD A;  3ZMU A;  4WF9 V;  1DTO A;  3H1I H;  4PDM A;  2F95 B;  1LR1 A;  4DK0 A;  2PTM A;  4E4E A;  3OUF A;  5H9C A;  4MVU A;  3DXR B;  4DR2 O;  3E35 A;  1N36 B;  4H44 B;  5GTI Z;  3IJ4 A;  1GN6 A;  2AZ2 A;  4F4L A;  4GKK B;  1WLE A;  4X20 A;  4XBF A;  2NLJ C;  3EFF K;  2Y4U A;  3B84 A;  1BSM A;  3OFN G;  4DR2 B;  4FIP C;  5BO4 C;  5EUP A;  5LMU O;  2WLN A;  3CRA A;  1GO3 F;  4LF5 B;  2O57 A;  3K08 A;  4LFA O;  2JGU A;  4UCO A;  1M57 C;  4JI3 O;  2P22 C;  4X8A A;  1GTO A;  4LF9 B;  4DR4 O;  3IC7 A;  2X7R B;  4O4J A;  1Q86 W;  1FXV A;  3OD4 A;  2IW5 A;  1JOY A;  1Y4M A;  3MKS A;  1XL4 A;  1O9G A;  3B40 A;  1QVG U;  2WLI A;  4Q6G A;  1OCZ B;  4N9F 5;  3ASO B;  4X1K A;  2A9H A;  2E5L O;  4J7K A;  4G27 B;  2C9W C;  1H2S B;  2YIB D;  3ABL C;  5B1N A;  3MD0 A;  2Q7E A;  4ZHQ B;  5KHG A;  5IJ0 A;  1F4M A;  3FYE B;  3F7V C;  1VQ4 V;  5JQG B;  4X62 O;  1MZE A;  2XHB A;  1D5N A;  4MVQ A;  1S3J A;  1VQ5 V;  3GVM A;  4I0X B;  3ABM B;  4KXR A;  2JS5 A;  1OCC B;  2UXC B;  3QNE A;  3G67 A;  2KSD A;  2ZIN A;  5LA6 A;  1GM8 A;  4MS2 A;  5CA0 A;  1J95 A;  1OZ0 A;  1XI1 A;  1M4U A;  1EZJ A;  2WLJ A;  4K0K B;  5CB4 A;  2OCC B;  3ABL B;  5LMU B;  4W9J B;  3CXH F;  1IBL B;  4U2N A;  1PNL A;  3E22 B;  2QWO B;  4UUJ C;  4CC5 A;  1WJZ A;  5D5Q A;  3MHS C;  2UU9 B;  3G6B A;  1VMG A;  4Z1M G;  2QM4 A;  1P22 B;  3SPH A;  3WFV A;  4DR7 O;  1MNG A;  1Y76 B;  3ZIA G;  2PYJ A;  3SYQ A;  4DR1 B;  1AJP A;  2UUC B;  4DR5 O;  5A15 A;  4UIJ A;  3JD4 A;  4J41 A;  3IAY A;  3CPW U;  3JSN A;  3ABU A;  5LA6 B;  1HWY A;  3HTM A;  1AJQ A;  4JI0 B;  4MVM A;  2NN2 A;  5B1A B;  1Y74 A;  4O2B B;  4NTX A;  4JI5 B;  1FPO A;  4GCZ A;  1IZ3 A;  5L3C A;  1CXZ B;  2V4D A;  3OMN B;  1LDK D;  1NVP B;  1SQG A;  3RYF A;  5BY1 A;  3GWO A;  5H2F Z;  3L70 H;  2JS3 A;  3H1H H;  2Q81 A;  1BT8 A;  3J81 N;  3AG2 C;  2QM7 A;  3JD1 A;  3CRM A;  1NTK H;  4U7N A;  3VQV A;  1HNW O;  2LFS A;  1JVM A;  1WP8 A;  2JDI G;  3JAW A;  3L73 H;  4O4H B;  5B66 Z;  5LOV B;  2HP8 A;  2PZS A;  2E32 B;  5B1A C;  1PPJ H;  4JI4 O;  3C6O A;  4QPJ A;  1RPR A;  3AK2 A;  3JAK B;  2XAS A;  5JJE B;  1F7Y A;  2QM8 A;  4UCS A;  2LGW A;  4EEQ A;  4W9C B;  4EB6 B;  2FB5 A;  2Y48 A;  4I6J C;  3D8C A;  5EZY B;  4KL1 A;  1M9N A;  4AWJ B;  2RCV A;  3LSS A;  1EOE A;  2A7W A;  2PY5 A;  4DV5 B;  4CBC A;  4D7S A;  2WA4 A;  1PV0 A;  3FYI B;  4IYI A;  3CC7 V;  2HFE C;  3KCY A;  4NXN B;  2GTS A;  3W7W A;  1VQP V;  3K04 A;  3ZRS A;  2CGN A;  3CCR V;  4UB8 Z;  3DRY A;  1EZV H;  1SER A;  4NB5 A;  4PA7 A;  1QLE C;  3SYP A;  4NXN O;  3T1Y B;  2HVK C;  3SPJ A;  3L72 H;  4NYK A;  2F1M A;  2Q0A A;  4JF3 A;  2P67 A;  2H94 A;  3D3I A;  3JAS A;  4DV5 O;  1X4T A;  3B09 A;  1MAB G;  1L1F A;  2D2C B;  3OM3 B;  5IYZ B;  3U11 A;  1GMG A;  2QA4 V;  4X66 O;  4LFB B;  5LYJ A;  5FNV B;  4N21 A;  2W6J G;  3DCG B;  3K3W A;  2PI5 A;  3UQ8 A;  1BL8 A;  4JI7 B;  2MK3 A;  3JD2 A;  2F4V O;  3OGI B;  1A32 A;  2EIM B;  3WSO B;  1RM1 B;  2IU3 A;  2R9I A;  1S77 D;  4WBN B;  4B7K A;  5CA0 B;  4BIZ A;  3K5M A;  3R65 A;  2QDO A;  1G8M A;  1QQC A;  1VF6 A;  2ZD9 A;  3ETE A;  3M7M X;  4K35 A;  1XOU A;  4KHP B;  2X0L A;  2UXD O;  2Y69 C;  5TIS Z;  4JI2 O;  1BCC H;  4LF8 B;  5FPO A;  4EB6 A;  5JJJ B;  3STZ C;  2F23 A;  1NVP D;  2BSK A;  5JH7 A;  1TUB A;  2Q73 A;  1WN7 A;  4B9K E;  4LFB O;  2F93 B;  4AI8 A;  1V9P A;  3RYI A;  4X1K B;  3FAV B;  4UVC A;  4DR6 O;  2UXB O;  2QKS A;  3JAM N;  4JYA O;  2WPD G;  3AK3 A;  1NH2 D;  1AIL A;  3W7T A;  4LP8 A;  3LDE A;  3K0G A;  4K8X A;  3R66 A;  4GT1 A;  1VQN V;  1EN5 A;  4LWS A;  1D5A A;  1N0N A;  3ZS8 C;  2OVR A;  2Y0P A;  1P4R A;  5EC1 C;  1S5H C;  4X89 A;  4FM0 A;  4FFB B;  1WB7 A;  2YEV B;  1UFI A;  2ITC C;  2Q7G A;  2EZO A;  2DMX A;  3OE7 G;  3E89 A;  3M99 B;  2VWJ A;  1JA8 A;  4DV6 B;  3LSQ A;  1UPG A;  4DRX A;  2QWN B;  4B7E A;  3HQI A;  4FLT A;  1WA8 B;  2Q8V A;  1EBO A;  4TQF A;  3E4U A;  3ZMS A;  2ZT9 B;  3OGC C;  1Y76 A;  5KHI A;  4JPR A;  3A0H Z;  1AR4 A;  4KUM A;  5GON B;  2DW4 A;  3E22 A;  3OEE G;  4J7Z A;  1S72 V;  5F2V O;  4X66 B;  3A2F A;  3T4D A;  2JVD A;  2IH1 C;  2P7T C;  3H1K H;  2ZM6 O;  3JAT A;  2KG7 B;  1JX9 A;  1LNQ A;  3JCU Z;  3M8V A;  4L8J A;  3RYH A;  4DR3 B;  3AEI A;  1KB9 F;  1QDW A;  3D36 C;  2ZNI A;  3P30 A;  4GZR B;  3CJH B;  4B3R B;  1ZWI C;  5JJN B;  1AP5 A;  4XDK A;  5CA1 B;  1RP3 B;  1KKC A;  4NXM B;  4GLX A;  2JRI A;  1H2K A;  4FM2 A;  3L71 H;  1V55 B;  5CBG A;  4FLU A;  4DV4 B;  3KVT A;  2OCC C;  1N33 O;  1JJO A;  3C90 A;  2UUB O;  4LFC O;  1ARO P;  2WLI B;  1YIJ V;  1SQB H;  5C8Y B;  3ZJZ A;  2BCC H;  1N36 O;  3HVE A;  3HR0 A;  1R3K C;  3G6E V;  4DV3 B;  1WA8 A;  2B9Z A;  4PA9 A;  4MVZ A;  4I55 A;  4D7T A;  5IYZ A;  4TUY B;  1F23 A;  1ZL8 A;  2UUA B;  1V55 C;  4MTF A;  2BTQ B;  3APQ A;  5HZG C;  1KEC A;  5GON A;  3X2Q C;  3H9V A;  3OMA B;  4MTG A;  1YDX A;  1Q7Y W;  5BMV A;  2ZIO A;  1SQP H;  2NR5 A;  3HKC B;  3ICX A;  2IU0 A;  1VQK V;  2CGO A;  2EJ7 A;  3SJQ C;  4JI8 O;  2VQF O;  5BMV B;  4JI6 O;  3J80 N;  4AHC A;  3ZED A;  4CS3 A;  4RQF A;  1NJI W;  1SQV H;  2EIL C;  5KLV H;  1S76 D;  3FD9 A;  5BXH A;  1VQ6 V;  3DRZ A;  1NTZ H;  2ZE6 A;  5IYC O;  3FAV A;  2VS0 A;  2PF4 E;  3ZUN B;  3AG1 B;  1E1R G;  1SC5 B;  2UXC O;  3NR7 A;  1K9M W;  2DOS A;  2HHH O;  1VQO V;  5D5P A;  2BSK B;  1K4C C;  1P7B A;  3HVE B;  4HXI A;  4JYY A;  2FTK A;  3UT5 B;  5BZB A;  1NQT A;  3H1J H;  2EIJ C;  4Q20 A;  5LHI A;  2EIL B;  3A0B Z;  4H13 B;  1H8E G;  4XDJ A;  4YJ2 A;  1TGO A;  2HR3 A;  2RDC A;  4FM1 A;  1TUB B;  4LH6 A;  2ZR3 A;  3B77 A;  3JSL A;  2AGA A;  2IJJ A;  3T4Z A;  1HR0 B;  3C6N A;  4YJ3 A;  4B95 B;  3TK1 A;  4TOI A;  4J80 A;  3THO A;  5EYP B;  1Z5V A;  2VPK A;  1OHH G;  1KUQ A;  1QLE B;  2ILM A;  4PI0 A;  3RYC A;  2YI9 A;  5LMN O;  4PDV A;  4E2L A;  2ATK C;  4LF7 B;  2N05 A;  1Y67 A;  5H5N A;  4OX9 B;  4LF5 O;  2A79 B;  4FLY A;  3B2E E;  1F4N A;  2OVP A;  3QF7 A;  1FAF A;  4DW1 A;  5L3D A;  1M90 W;  1OJH A;  3BAB A;  1S1G A;  3DC5 A;  1QVF U;  5CB4 B;  2Q9L A;  2M6Y A;  2YXH A;  4JAS A;  1DGS A;  1PD3 A;  1K4D C;  1VQL V;  3CC2 V;  3ETQ A;  3CCS V;  1US6 A;  4HNA B;  3FB6 C;  3OGL A;  3SYO A;  4IL6 Z;  1KYO F;  1KU9 A;  2DWD C;  3K9A A;  2RNB A;  1IX9 A;  1K3E A;  3FKS G;  2GSM B;  2P1Q A;  1NT2 B;  1SA0 A;  3OMI B;  3W7S A;  1ZAU A;  4W4K A;  2Q4P A;  1OCR B;  3A0R A;  2E76 B;  5IDJ A;  2XUM A;  2JGD B;  1Q6H A;  3K79 A;  3OR7 C;  1G1X B;  4JV5 O;  4H33 A;  4X88 A;  1EOD A;  4ZOL B;  3E8H A;  4D6T H;  4PJ0 Z;  4AIL C;  2UUA O;  1XNR B;  4LF7 O;  2YID A;  1Y6X A;  1VIB A;  1HNX B;  2IM9 A;  4W4L A;  1L0L H;  3OT7 A;  4EFB A;  4Z2W A;  1P7G A;  4B3T B;  1N0J A;  2XAG A;  4DR3 O;  4APF A;  2ZKO A;  2ZE5 A;  2ZM6 B;  3DGE A;  3JAW B;  4O4H A;  3E8G A;  1XEQ A;  4ZOL A;  2YIC A;  3C3T A;  1H38 A;  3ZHT A;  1L0N H;  2C2A A;  4MVR A;  3BHP A;  3F5W C;  3N2G B;  2PUS A;  3LUT B;  1TVK A;  3AK1 A;  2PGG A;  2JGD A;  4UCR A;  1XNQ O;  1JR9 A;  1AI5 A;  1R3J C;  5EBM C;  3AG7 A;  1EN6 A;  4UV9 A;  3FKC A;  4BR6 A;  1YXB A;  4JYA B;  5GTH Z;  2BTO A;  5IY5 B;  4W9G B;  2YC0 A;  3HKE A;  2WSS G;  5KA6 A;  3ZHQ A;  3SPI A;  2GV9 A;  3FB5 C;  4I5S A;  2ZCE A;  3CCU V;  4BKS B;  4ZI7 B;  3JAS B;  5LGN A;  3DTU B;  3LNM B;  3OTF A;  1O9H A;  1AR5 A;  5JVD A;  3W7X A;  4I0X A;  1HNZ B;  5B1O A;  5IJ9 A;  2JEU A;  2Q69 A;  4ASU G;  2NN4 A;  1FFX B;  1LUV A;  1NTM H;  3CB2 A;  2DYR C;  1R6N A;  1NI8 A;  4YJ3 B;  3CE2 A;  4JGH C;  1SQQ H;  2OIE A;  2N04 A;  2CAZ C;  4F6E A;  3N2G A;  1SES A;  1FFT B;  1N4C A;  4YY3 O;  3F5T A;  1MA1 A;  5EZY A;  2ADP A;  3CJH A;  3DSQ A;  4DW0 A;  3C6P A;  1AI6 A;  3WG7 C;  5JH5 B;  1M1K W;  4CXT A;  2EUL A;  4TV8 B;  4OXS A;  4IIJ A;  4ABM A;  2KG7 A;  1FS2 B;  4LNU A;  2P6J A;  2CK3 G;  4ICG A;  3L9D A;  4R7C A;  3LBZ A;  4ZOU A;  1RFY A;  2R70 A;  5JWP A;  2Z3Y A;  3JAR A;  2UXB B;  2P1M A;  4KFM A;  4FLX A;  1COW G;  4DUZ O;  4O2A A;  5LP6 B;  4JZG A;  4DV1 O;  5IWA O;  1FD9 A;  3G4S V;  3E2E A;  1QR9 A;  3RYF B;  3ZCC A;  5GW7 A;  2GUZ B;  4IYH A;  1Z2G A;  2AZ0 A;  4WFH A;  4DRX B;  2LQT A;  3RN4 A;  3DRX A;  4FFK A;  1IXM A;  1Y74 B;  2WLL B;  2QWQ B;  3GA1 A;  4WFF A;  3L75 H;  1VQ7 V;  5BXD A;  1YJ9 V;  2WWW A;  1KMI Z;  1NR1 A;  4G2K A;  4PHZ A;  1I7F A;  3ZN1 A;  3ZTC B;  3HKC A;  4H37 A;  4UCT A;  5BR8 O;  5KHH A;  4DV1 B;  1DLB A;  4JTA B;  4BAY A;  1Q90 D;  2ZE8 A;  2YSU B;  2JK5 C;  4WFE A;  2RQ6 A;  2QSA A;  4W9L B;  3CCM V;  1IXB A;  3ZHR A;  4I55 B;  1VF6 C;  3T2M A;  1Y66 A;  3CCJ V;  1SF9 A;  3OTO O;  4OPH A;  4IHJ A;  4LF4 B;  5DED A;  4QGP A;  2YI8 A;  3JD0 A;  2Z0A A;  3JAL B;  2MA9 C;  4B9K B;  2IF5 A;  4MVO A;  5J2T B;  3CX5 F;  4X64 B;  5FTA A;  1K33 A;  2WAM A;  4MW3 A;  2LW7 A;  1OCR C;  5JQG A;  1QLN A;  1SRY A;  2JJ1 G;  4HBN A;  3IGA C;  2FML A;  3CYO A;  5EK0 A;  4CZZ A;  4W9F B;  1FS1 B;  4YJ2 B;  3K03 A;  2DYS B;  3EXA A;  2LP7 A;  4I4T B;  5E1A C;  1PM9 A;  4CP3 A;  1KP2 A;  2OWO A;  1AR1 B;  4J8Z A;  3ZTD B;  3ASN B;  2BOC C;  3VQW A;  4F6R B;  1ZUQ A;  4JI5 O;  4NTW A;  5IT9 N;  1GH6 A;  3HKB A;  1SS3 A;  4ZI7 A;  4KP4 A;  3VQY A;  3ETD A;  1TA8 A;  1N34 O;  4QJF B;  2QTO A;  4GX2 A;  3UKM A;  2X6C A;  3AG4 C;  1V54 B;  1SQF A;  4R8C A;  1M56 C;  2H3O A;  4BKT B;  3M4T A;  3B4S A;  2W0F C;  3TXS A;  4HZ3 A;  1XMQ B;  5KX5 B;  1YJN V;  2L6L A;  3Q4H A;  5DAF A;  4RO2 A;  1IBM O;  1Z5W A;  5EBW C;  4IGG A;  2B1G A;  4UV8 A;  2PPI A;  2OTL V;  4FLZ A;  2P5O A;  4I9Q A;  5KX5 A;  3I3N A;  1XMQ O;  4JAU A;  1OCZ C;  2QGN A;  1P84 F;  4JAV A;  4O4I A;  1D2D A;  2QKA A;  2BTQ A;  5LMN B;  2EIK C;  3K58 A;  3TGU H;  2FL4 A;  2XAJ A;  3ABK B;  4FK5 C;  4X62 B;  2R9A A;  4DR1 O;  4DV3 O;  1R73 A;  4IIJ B;  4C7U A;  5CMU A;  1GN4 A;  3K06 A;  4TV8 A;  4EKW A;  3KZI Z;  2GBO A;  1OCC C;  3OUS A;  3CSX A;  5KUM A;  3OTO B;  3FX7 A;  1BHB A;  4CH6 A;  2DQ0 A;  4YXW G;  2Q6A A;  1N33 B;  1OCO B;  3RYI B;  5JCO A;  4X1Y A;  3WB1 A;  5JCO C;  2HLD G;  1URF A;  2VQE B;  2X6B A;  1YTF D;  3ABK C;  1SA0 B;  1FXK A;  5LXT A;  2XAF A;  1XRE A;  4QIW F;  3CRC A;  2IZV C;  2AHY A;  1A68 A;  3ZBH A;  1YZB A;  4B3T O;  5LBQ A;  4XDL A;  2EX3 A;  4FJC C;  4BW9 A;  3WB0 A;  3ZRW B;  1PP9 H;  4LF4 O;  3ZRX A;  5LYJ B;  2ASS A;  1QR8 A;  4JTC B;  4WBN A;  3UM7 A;  3W7U A;  1N32 O;  3APO A;  2ADQ B;  5K1P A;  1K5Q A;  4UCU A;  4TT3 G;  5LL6 Y;  3HU6 A;  1WB8 A;  3M5B A;  5IJ9 B;  4DV7 O;  3FFQ A;  3P32 A;  1K5S A;  2XAH A;  3QO8 A;  1I5Y A;  2EJR A;  2FNJ C;  4DV7 B;  1GN2 A;  3OGM A;  4PI2 A;  3TJT A;  4DYL A;  5FNV A;  3ABM C;  2I2R A;  3ABT A;  4W9H H;  1KP3 A;  1FKA O;  4JI3 B;  3ML0 A;  1SQX H;  3VOU A;  2QR4 A;  2YDE A;  1W59 A;  1SZT A;  4WFA V;  3X2Q B;  2BE3 A;  5K1X A;  4GKJ O;  1GKF A;  1G6U A;  1AI4 A;  1WAZ A;  3ZHV A;  1B6Q A;  4L87 A;  3WG7 B;  3U0Z A;  2ZDI A;  1KD1 W;  4WFG A;  4N23 A;  2R72 A;  4I50 A;  3LDD A;  4CXI A;  4ZHQ A;  3RGB A;  3BRC A;  3S3W A;  2XAQ A;  2CTR A;  4O2A B;  4JYB A;  4DUZ B;  1K92 A;  3O65 A;  2QEX V;  1AB3 A;  2GDS A;  2HKO A;  2QKC A;  1XDC A;  2F66 C;  1LM8 C;  1QDV A;  1NH2 B;  3CCV V;  1MZF A;  2HJD A;  3S3X A;  3QTC A;  1AI7 A;  5LP6 C;  1K97 A;  4YY8 A;  2ZIM A;  4PA3 A;  4LF6 O;  3I55 V;  5KHJ A;  4LH7 A;  3AG3 B;  1CPY A;  3F7Y C;  4RUE A;  4AJY C;  2W6I G;  1XMO O;  4DUY B;  2FKX A;  1R29 A;  3LNN A;  2UXD B;  4GYC B;  3CD6 V;  4HYO A;  2EIJ B;  2Q0O C;  4I7Z B;  2D3O W;  4O4I B;  2K1E A;  3TCU A;  4H0L B;  4MT8 A;  2HG5 C;  4HNA A;  1NS1 A;  2DYS C;  4TSF G;  1YF2 A;  2G38 A;  4RAI A;  3ZX6 A;  5L3G A;  3EVK A;  2XND G;  2ZNJ A;  4ZBM A;  4DV2 B;  4B3M O;  1FXK C;  4UVA A;  3ZKJ B;  5BXB A;  1H2N A;  3K0D A;  1RM1 C;  1MSD A;  4IT5 A;  5BR8 B;  1RPO A;  4PEL A;  1ENV A;  2LW1 A;  1JQ0 A;  2YY9 A;  1XHZ A;  3RFR A;  4LBE C;  3CRQ A;  4X1I B;  2AHZ A;  5IBK A;  1DF5 A;  2YXY A;  1BS3 A;  5H7G A;  3CCL V;  5DN6 G;  2AW9 A;  2Q67 A;  1TAE A;  3ETG A;  5LGU A;  3SYC A;  1XMO B;  3AG1 C;  1I94 B;  2MW2 B;  2Y69 B;  1E79 G;  1BGY H;  4YHH O;  2DQ3 A;  1EXB E;  1KBH A;  5EYP A;  3U10 A;  5H6Q A;  3K57 A;  5A6R A;  2WLK A;  2ARH A;  3ZHU A;  4DV4 O;  5E79 Z;  1BQ0 A;  2DJV A;  1VF7 A;  3VQX A;  2JZ3 C;  1TVK B;  3ZRW A;  1YCI A;  3CHX A;  1JCH A;  1GM9 A;  4NKG B;  3K5N A;  3JD3 A;  3TXQ A;  5CA3 A;  5CA1 A;  1W2B U;  1PL4 A;  5IE9 A;  2P90 A;  2P4K A;  3L2O A;  1J5E B;  3FB8 C;  3ASN C;  4P2Z A;  2RMK B;  2ZDI C;  2JEX A;  2EIM C;  5H7H A;  1Q3E A;  3PJS K;  5J2U B;  5HFM A;  4B08 A;  2V1D A;  4P30 A;  3ZHS A;  3SJB C;  4PD4 F;  4LFC B;  2UUB B;  1MMM A;  3ASO C;  1OCO C;  1QHT A;  1HNX O;  3M52 A;  1PKX A;  2ZR2 A;  3ZNG B;  2AXT Z;  4A5U B;  1NBM G;  4JI1 O;  3CCE V;  1VAR A;  3QO5 A;  5CN0 A;  3J7A U;  5FLX N;  4DXW A;  3CS5 A;  4I50 B;  1PL0 A;  4X20 B;  1FYJ A;  4DV2 O;  2ZXW B;  1T1D A;  4BWA A;  2L35 A;  1J5E O;  4MTO A;  1MOF A;  3I5D A;  3D36 A;  3BVO A;  2P1N A;  3E83 A;  3IFX A;  4FFB A;  5B1B C;  3OGK A;  5EC2 C;  3ZRC B;  4FLV A;  2EIK B;  2N74 A;  1EOF A;  4W9I B;  2EIN B;  4QPK A;  4NTY A;  3O9O A;  1QNM A;  2CDY A;  5KHK A;  1WP7 A;  1L8D A;  4ZKI A;  4GX0 A;  4B3S B;  2EZP A;  4F6R A;  1GAX A;  5FL7 G;  1W0K G;  3BPZ A;  1FJG O;  4U3J A;  2Y4T A;  3BAA A;  3BA9 A;  2B1I A;  3SPG A;  3WU2 Z;  4OPA A;  3JAR B;  1R28 A;  2Z5U A;  2CTP A;  4CS2 A;  2Q5Z A;  4JYC A;  5L3F A;  3BIM A;  3RW0 A;  1MG1 A;  1M56 B;  5CBF A;  1DK1 A;  2Z8H A;  1LQB B;  1VEW A;  1VF5 B;  5C8Y A;  1FXH A;  1U97 A;  1SKV A;  4CXJ A;  1JFF B;  2DYR B;  2JJ2 G;  4I4T A;  2WA3 A;  3RYH B;  2EBO A;  4K8Z A;  4DV0 O;  3JAL A;  3MDS A;  1Q6I A;  3ZN0 A;  5DM6 V;  4NVP A;  4CH4 A;  4X1Y B;  1R2B A;  1S0V A;  2A06 H;  3K5O A;  5C93 A;  1B06 A;  2QWP B;  3BFR A;  3LDC A;  5DAD A;  1SET A;  4RWU A;  1HNZ O;  2FYU H;  4J9Z B;  5J2T A;  5A9G A;  5L3B A;  4MVS A;  1NZ6 A;  5KAF Z;  4GUN A;  1AP6 A;  1TUE B;  3JYC A;  3WB2 A;  2OYQ A;  2HHH B;  4U7O A;  4J42 A;  1XL6 A;  2LO1 A;  2YXL A;  1I5X A;  2F43 G;  5LGT A;  2OCH A;  4LFA B;  3MAQ A;  1S5L Z;  1IVS A;  1NU1 H;  5EBL C;  4U3J B;  2VWK A;  5HYW B;  4PDR A;  5BXZ A;  2ZQM A;  5IYD O;  1QCE A;  3SR2 C;  3CWB H;  2X6A A;  4W9E B;  1N8R W;  4GKK O;  3GWK C;  4FPP A;  1F51 A;  4LWS B;  1E1Q G;  2IH3 C;  3QO7 A;  4QE9 A;  3CRR A;  4JGS A;  3RVY A;  4BIO A;  2A3Q A;  2QWR B;  4OGQ B;  1Q43 A;  1R3I C;  1ZLZ A;  2YEV A;  2IBZ H;  4PA4 A;  4OX9 O;  1ZL8 B;  2Y0I A;  1SZX A;  4X9Q A;  2GUZ A;  2LFR A;  1BQZ A;  2LJ2 A;  2KB1 A;  3AG3 C;  4LNU B;  4MTX A;  4P9O A;  3I56 V;  4MSW C;  4PA6 A;  4J10 A;  3JAK A;  4WQO C;  5LP6 A;  3SJA C;  4U77 A;  3M8A A;  2XOK G;  3IC9 A;  3L74 H;  4EOZ A;  3SGI A;  1YIT V;  3T1C A;  4NR1 A;  4CH5 A;  4P9P A;  1XIL A;  5ITZ A;  2V7Q G;  4UCV A;  1V54 C;  4JV5 B;  2YIA A;  1NR7 A;  2HEP A;  1N32 B;  1XQ8 A;  2IHC A;  1NN7 A;  2GHY A;  1YVW A;  4CRH A;  4AQY O;  1G4Y B;  1KC8 W;  3BCC H;  3OEH G;  1FFX A;  4B3R O;  2UXX A;  3RT3 C;  1DSX A;  1YHQ V;  4R50 A;  1IBK O;  1ZTE A;  1GN3 A;  4PV1 B;  1RSO B;  4JI0 O;  1ORQ C;  5L3E A;  3K9S A;  1KKD A;  2CH7 B;  1VP7 A;  2WLM A;  2VQE O;  3RBZ A;  3B8M A;  2YUA A;  5HFL A;  2ODM A;  3LSU A;  3E8B A;  1YEW A;  3P3P A;  5DEC A;  3SJC C;  4HAM A;  2VQF B;  2NZ0 B;  1BMF G;  1Q8I A;  4JI8 B;  5IYB O;  3V7D A;  2DN9 A;  1IBM B;  1R6T A;  1CS3 A;  4MW8 A;  1JMK C;  1K7D A;  1XHX A;  2WLH A;  3GB7 C;  5H6R A;  1WNS A;  5LLI B;  4I9W A;  4TWK A;  4DO2 A;  1EFR G;  1NKD A;  5LHG A;  3HKD A;  2CH7 A;  5J9P C;  3OAA G;  1N34 B;  3HPL C;  2BOB C;  1JJ2 U;  3BEH A;  2UUC O;  2P4V A;  4TV9 B;  1JPX A;  4LR3 A;  3TET A;  3N2K B;  1XUQ A;  1FXK B;  4WCE V;  1CP9 A;  1Q81 W;  4BW5 A;  1R6K A;  4O4L B;  2LGQ A;  3UO2 A;  1ZX3 A;  5LOV A;  2P06 A;  2B5U A;  1B04 A;  4LC1 A;  2VRZ A;  4FMT A;  2W0X A;  4DR6 B;  1FJG B;  2QTS A;  2RN9 A;  3UT5 A;  4B3S O;  2XT9 A;  1IBK B;  4CS4 A;  5J2U A;  1BHA A;  2RJZ A;  2ITD C;  1XBL A;  1QBZ A;  3D3Q A;  1QU7 A;  1YJW V;  1I0H A;  4DR4 B;  3EHB B;  4UB6 Z;  3CEI A;  2OT5 A;  3K5L A;  4X64 O;  3RVZ A;  3UCS C;  4AQY B;  5IY5 C;  3CP1 A;  1PNM A;  4R6Z A;  3K59 A;  4RUF A;  4J9Y B;  3SPC A;  4O4L A;  1NEX A;  3SYA A;  4JI6 B;  3VBB A;  4X65 B;  2M7W A;  3H01 A;  1I08 A;  3N27 A;  4LCU C;  5KMG A;  4DV0 B;  1GRJ A;  2VKP A;  2OTJ V;  3N2K A;  3Q4H B;  3CMA V;  4J11 A;  4JTD B;  1FQV B;  4O2B A;  3SDL A;  2ZE7 A;  5EIB C;  3UO3 A;  1MSW D;  4JI7 O;  3T1H B;  4QNH B;  4AP2 A;  4LF9 O;  3CXC U;  2IJI A;  4CC6 A;  4ZIB A;  1H2M A;  2OIG A;  3RWR D;  4FVM A;  3C3S A;  1P49 A;  4X1I A;  3CCQ V;  4GX5 A;  4U2M A;  2K9P A;  2HJF C;  3HKB B;  2YS8 A;  1M57 B;  3HKE B;  1K73 W;  3E86 A;  3RYC B;  1Q82 W; 
#chains in the Genus database with same CATH homology
 3W7X A;  3NXS A;  2MK3 A;  2DQ3 A;  1EXB E;  3JCZ A;  3JD2 A;  5B1O A;  5LHH A;  4BIU A;  2JEU A;  2EIM B;  3WSO B;  2Q69 A;  4ASU G;  1RM1 B;  1YTF B;  1DF4 A;  2IU3 A;  2R9I A;  5H6Q A;  2IJH A;  2DYR C;  5A6R A;  2WLK A;  2E31 B;  1R6N A;  3E8F A;  1WPX A;  3CC4 V;  1S77 D;  3ZMZ A;  1PNK A;  3ZMV A;  4BIZ A;  3R65 A;  2AST A;  4JGH C;  2JZ3 C;  1G8M A;  1CEZ A;  3ZRW A;  1JCH A;  1GM9 A;  1SES A;  3OHU A;  3JD3 A;  2ZD9 A;  5CA3 A;  3ETE A;  3OW2 U;  1FFT B;  1W2B U;  2X0L A;  2NNU A;  2P90 A;  2EIN C;  3G71 V;  2Y69 C;  3L2O A;  5KUK A;  3C6P A;  1AI6 A;  3WG7 C;  5JH5 B;  3FB8 C;  3ASN C;  4P2Z A;  3STZ C;  1M1K W;  4CXT A;  1NVP D;  2ZDI C;  4OXS A;  2JEX A;  2EIM C;  2JIZ G;  5H7H A;  3PJS K;  1FS2 B;  4B9K E;  5HFM A;  2P6J A;  2V1D A;  1ROP A;  4P30 A;  2CK3 G;  1VCB B;  4WFB V;  3ASO C;  3B8N A;  4R7C A;  1OCO C;  3BY6 A;  3M52 A;  3LBZ A;  4ZOU A;  1PKX A;  5B3S C;  4UVC A;  2Z3Y A;  2ZR2 A;  3ZNG B;  1GK9 A;  2P1M A;  4KFM A;  2QKS A;  1COW G;  3ZMT A;  2WPD G;  1BUO A;  4G28 B;  1NH2 D;  1NBM G;  1W0J G;  3W7T A;  4LP8 A;  3LDE A;  3K0G A;  3CCE V;  4GT1 A;  3G4S V;  1VQN V;  3E2E A;  1YSC A;  3QO5 A;  5CN0 A;  4DXW A;  1QR9 A;  2P1O A;  1PL0 A;  2OVR A;  4RQE A;  3ZCC A;  2ZXW B;  1P4R A;  5GW7 A;  1T1D A;  4WFH A;  4MTO A;  1MOF A;  3MHH C;  1S5H C;  5EC1 C;  4W9D B;  4X89 A;  4W9K B;  3DRX A;  3D36 A;  1IXM A;  1GM7 A;  4QE7 A;  2YEV B;  2P1N A;  4W9H B;  3E83 A;  2ITC C;  2WLL A;  2WLL B;  3GA1 A;  2EZO A;  3IFX A;  4WFF A;  1K34 A;  5B1B C;  5B3S B;  3OE7 G;  3E89 A;  3M99 B;  3OGK A;  1VQ7 V;  5EC2 C;  3ZRC B;  2EIK B;  3LSQ A;  5BXD A;  1YJ9 V;  1H8H G;  2WWW A;  1EOF A;  4W9I B;  2EIN B;  4QPK A;  1NR1 A;  2A0L A;  4G2K A;  3ZN1 A;  2P1P A;  3HQI A;  3ZTC B;  1EBO A;  3E4U A;  3ZMS A;  4H37 A;  2OVQ A;  4ZKI A;  4GX0 A;  3OGC C;  1DLB A;  4JTA B;  2EZP A;  4JPR A;  4BAY A;  3FB7 C;  5FL7 G;  2PI4 A;  4KUM A;  1W0K G;  3CME V;  2YSU B;  1HV2 A;  2JK5 C;  2Q68 A;  4WFE A;  2DW4 A;  3SPG A;  2B1I A;  4W9L B;  3CCM V;  3OHV A;  3OEE G;  1VQM V;  1S72 V;  1R28 A;  2Z5U A;  3AG2 B;  1K8A W;  2R9R B;  3T2M A;  1Y66 A;  4JYC A;  5L3F A;  3T4D A;  3BIM A;  3RW0 A;  4PDL A;  1MG1 A;  1R3L C;  3CCJ V;  2IH1 C;  1M56 B;  2P7T C;  2QE7 G;  5CBF A;  2DWE C;  1JX9 A;  3JD0 A;  2IJK A;  1LNQ A;  2MA9 C;  4B9K B;  2IF5 A;  3M8V A;  2Z8H A;  1LQB B;  4MVO A;  5FTA A;  1FXH A;  1K33 A;  1AJN A;  3AEI A;  1QDW A;  4CXJ A;  3P30 A;  2WAM A;  2ZXW C;  4MW3 A;  1FS0 G;  1OCR C;  1ZWI C;  1YI2 V;  3OR6 C;  1KQS U;  4XDK A;  2H8P C;  2DYR B;  2JJ2 G;  1QLN A;  4ZGC A;  1SRY A;  2JJ1 G;  3STL C;  2EBO A;  3KG2 A;  5KA5 A;  3IGA C;  3CYO A;  5EK0 A;  5B1B B;  5CBH A;  4UXN A;  4CZZ A;  4W9F B;  1THZ A;  3ZN0 A;  1FS1 B;  4UVB A;  1UJW B;  5DM6 V;  3ZRV A;  1V55 B;  3AG4 B;  5CBG A;  3K03 A;  1R2B A;  2DYS B;  1S0V A;  2LP7 A;  5E1A C;  1H2G A;  2OCC C;  1VQ9 V;  3KVT A;  5C93 A;  1VQ8 V;  1ARO P;  2WLI B;  4CP3 A;  3LDC A;  5DAD A;  1SET A;  1KP2 A;  1YIJ V;  1AR1 B;  3HB3 B;  2UXN A;  4J8Z A;  4J9Z B;  4BGC A;  3ZTD B;  2HVJ C;  3ASN B;  5L3B A;  3ZJZ A;  2BOC C;  4MVS A;  3HVE A;  4UYI A;  1TUE B;  4GX1 A;  1R3K C;  3G6E V;  3ZRF B;  3JYC A;  4KP4 A;  3ETD A;  4U7O A;  4PA9 A;  1XL6 A;  4MVZ A;  3ZMU A;  1I5X A;  2F43 G;  5LGT A;  4QJF B;  2QTO A;  4WF9 V;  4GX2 A;  3UKM A;  2X6C A;  1DTO A;  1F23 A;  4PDM A;  1V55 C;  1V54 B;  3AG4 C;  4MTF A;  1M56 C;  4R8C A;  5EBL C;  5HZG C;  1KEC A;  3X2Q C;  3OUF A;  5HYW B;  4BKT B;  5H9C A;  3M4T A;  4PDR A;  3OMA B;  2ZQM A;  4MVU A;  4MTG A;  5IYD O;  2W0F C;  4HZ3 A;  1Q7Y W;  3E35 A;  1YJN V;  1QCE A;  5DAF A;  2X6A A;  4W9E B;  4RO2 A;  1N8R W;  5EBW C;  4F4L A;  4FPP A;  2B1G A;  1WLE A;  4UV8 A;  2IU0 A;  2PPI A;  1F51 A;  1VQK V;  2OTL V;  4XBF A;  1E1Q G;  2IH3 C;  2NLJ C;  3SJQ C;  3QO7 A;  3EFF K;  4QE9 A;  3B84 A;  3I3N A;  3OFN G;  4JAU A;  4JGS A;  3RVY A;  4RQF A;  1NJI W;  1OCZ C;  2EIL C;  4FIP C;  1S76 D;  5EUP A;  5BO4 C;  5LLI B;  1R3I C;  2WLN A;  1VQ6 V;  2YEV A;  5BXH A;  4JAV A;  1GO3 F;  3DRZ A;  4PA4 A;  3K08 A;  2EIK C;  5IYC O;  1M57 C;  3ZUN B;  3AG1 B;  2XAJ A;  1E1R G;  3ABK B;  4X8A A;  1GTO A;  2LFR A;  3IC7 A;  4FK5 C;  1K9M W;  2KB1 A;  2X7R B;  3AG3 C;  1Q86 W;  4MTX A;  1FXV A;  1R73 A;  4P9O A;  4MSW C;  3I56 V;  1VQO V;  5CMU A;  1K4C C;  4PA6 A;  1P7B A;  3HVE B;  4HXI A;  3K06 A;  2IW5 A;  4EKW A;  1JOY A;  4WQO C;  4U77 A;  1Y4M A;  2FTK A;  2XOK G;  5BZB A;  1OCC C;  3OUS A;  3MKS A;  4EOZ A;  1NQT A;  1YIT V;  1XL4 A;  5KUM A;  3T1C A;  1QVG U;  4P9P A;  1BHB A;  2DQ0 A;  2WLI A;  2EIJ C;  1OCZ B;  4Q20 A;  5LHI A;  2EIL B;  2V7Q G;  4YXW G;  4N9F 5;  1H8E G;  2Q6A A;  3ASO B;  1V54 C;  4XDJ A;  1OCO B;  2A9H A;  1NR7 A;  4G27 B;  2C9W C;  2HLD G;  2IHC A;  1NN7 A;  3ABL C;  2HR3 A;  2GHY A;  5B1N A;  3MD0 A;  2ZR3 A;  3B77 A;  2X6B A;  3T4Z A;  2IJJ A;  3C6N A;  1YTF D;  3ABK C;  1F4M A;  4CRH A;  1G4Y B;  4B95 B;  1FXK A;  3TK1 A;  1KC8 W;  2XAF A;  4QIW F;  3OEH G;  3FYE B;  3F7V C;  2IZV C;  1VQ4 V;  2AHY A;  1A68 A;  4MVQ A;  2UXX A;  1S3J A;  1VQ5 V;  1OHH G;  1DSX A;  2VPK A;  5LBQ A;  4XDL A;  1YHQ V;  1QLE B;  4R50 A;  3ABM B;  1OCC B;  4FJC C;  3QNE A;  1ORQ C;  5L3E A;  1KKD A;  3ZRW B;  4PDV A;  4E2L A;  2ATK C;  2WLM A;  1GM8 A;  3ZRX A;  4MS2 A;  1J95 A;  1OZ0 A;  3RBZ A;  2ASS A;  1QR8 A;  1EZJ A;  3B8M A;  4JTC B;  5HFL A;  3UM7 A;  2A79 B;  2WLJ A;  3W7U A;  2OCC B;  3ABL B;  3E8B A;  4W9J B;  1K5Q A;  1F4N A;  4TT3 G;  3HU6 A;  2OVP A;  3M5B A;  4U2N A;  1PNL A;  4HAM A;  4UUJ C;  3P32 A;  5L3D A;  1K5S A;  2XAH A;  1BMF G;  3MHS C;  2NZ0 B;  1M90 W;  5IYB O;  4Z1M G;  1P22 B;  3SPH A;  3QO8 A;  1I5Y A;  2EJR A;  3WFV A;  2FNJ C;  3V7D A;  3OGM A;  1CS3 A;  4MW8 A;  3ZIA G;  1S1G A;  3SYQ A;  1K7D A;  1QVF U;  1AJP A;  2WLH A;  3ABM C;  3GB7 C;  5A15 A;  4UIJ A;  3JD4 A;  5H6R A;  2I2R A;  4JAS A;  1PD3 A;  3ABT A;  1K4D C;  4W9H H;  4I9W A;  1KP3 A;  4TWK A;  4DO2 A;  1VQL V;  3CC2 V;  1EFR G;  3ML0 A;  3CPW U;  3VOU A;  3ABU A;  1NKD A;  1HWY A;  5LHG A;  3HTM A;  3CCS V;  1AJQ A;  5J9P C;  4MVM A;  3OAA G;  1SZT A;  3FB6 C;  4WFA V;  2NN2 A;  5B1A B;  3HPL C;  3X2Q B;  3OGL A;  2BOB C;  3SYO A;  1JJ2 U;  1GKF A;  3BEH A;  1AI4 A;  2DWD C;  4GCZ A;  1JPX A;  5L3C A;  3TET A;  3K9A A;  1B6Q A;  4L87 A;  3OMN B;  1K3E A;  2ZDI A;  3FKS G;  3WG7 B;  1KD1 W;  2GSM B;  1FXK B;  4WFG A;  4N23 A;  4WCE V;  1LDK D;  1NVP B;  1CP9 A;  3OMI B;  3W7S A;  2P1Q A;  1Q81 W;  1OCR B;  3LDD A;  3A0R A;  4CXI A;  3GWO A;  5IDJ A;  4BW5 A;  1R6K A;  3K79 A;  3OR7 C;  2Q81 A;  2XAQ A;  3AG2 C;  2QM7 A;  3JD1 A;  4H33 A;  4JYB A;  1K92 A;  2QEX V;  2HKO A;  2B5U A;  4U7N A;  4X88 A;  1EOD A;  3E8H A;  2LFS A;  4LC1 A;  1JVM A;  1LM8 C;  1QDV A;  4FMT A;  1NH2 B;  2JDI G;  3CCV V;  2E32 B;  3C6O A;  5B1A C;  4QPJ A;  1AI7 A;  4YY8 A;  1K97 A;  1RPR A;  4PA3 A;  2XAS A;  3I55 V;  3AG3 B;  1CPY A;  3F7Y C;  1BHA A;  2QM8 A;  2ITD C;  2XAG A;  1QBZ A;  1YJW V;  4APF A;  4RUE A;  3EHB B;  4W9C B;  4AJY C;  2W6I G;  2OT5 A;  3DGE A;  3RVZ A;  1R29 A;  2Y48 A;  5IY5 C;  3E8G A;  4I6J C;  3CP1 A;  1M9N A;  4AWJ B;  3CD6 V;  4HYO A;  2EIJ B;  1H38 A;  1PNM A;  2D3O W;  4R6Z A;  3LSS A;  2C2A A;  2K1E A;  4MVR A;  4RUF A;  3TCU A;  1EOE A;  4J9Y B;  3F5W C;  4MT8 A;  3SPC A;  4CBC A;  2HG5 C;  3FYI B;  2DYS C;  3LUT B;  3CC7 V;  3SYA A;  3VBB A;  1NEX A;  2HFE C;  4TSF G;  2M7W A;  4RAI A;  3H01 A;  5L3G A;  2XND G;  3W7W A;  4LCU C;  4ZBM A;  1VQP V;  1AI5 A;  3K04 A;  3ZRS A;  1R3J C;  5EBM C;  2VKP A;  3CCR V;  2OTJ V;  1FXK C;  4UVA A;  4UV9 A;  3ZKJ B;  3CMA V;  3DRY A;  5BXB A;  3K0D A;  1RM1 C;  4JTD B;  3FKC A;  1SER A;  1FQV B;  4PA7 A;  1QLE C;  1RPO A;  3SYP A;  4PEL A;  1MSW D;  2HVK C;  3SPJ A;  4QNH B;  5IY5 B;  1ENV A;  4AP2 A;  3CXC U;  2IJI A;  4W9G B;  4JF3 A;  2P67 A;  2WSS G;  1JQ0 A;  2H94 A;  5KA6 A;  2YY9 A;  3D3I A;  3SPI A;  3FB5 C;  4LBE C;  4I5S A;  1MAB G;  2AHZ A;  3OM3 B;  1L1F A;  5IBK A;  1DF5 A;  1GMG A;  2QA4 V;  5H7G A;  3CCU V;  3CCQ V;  4GX5 A;  3CCL V;  5DN6 G;  4U2M A;  4BKS B;  2HJF C;  2Q67 A;  4N21 A;  2W6J G;  3ETG A;  1M57 B;  5LGN A;  5LGU A;  3SYC A;  3DCG B;  3AG1 C;  3DTU B;  1K73 W;  3K3W A;  3E86 A;  3LNM B;  2Y69 B;  2PI5 A;  1E79 G;  1BL8 A;  1Q82 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...