2A7BA

On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
120
structure length
120
Chain Sequence
b'MIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords gamma-adaptin appendage domain
molecule tags Endocytosis/exocytosis
source organism Mus musculus
publication title On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
pubmed doi rcsb
total genus 22
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a7bA00
2YMTA 1GYUA 1IU1A 2A7BA 1KYUA 1GYVA 1P4UA 1GYWA 3MNMA 3ZHFA 2VJ0A 1OM9A 5CN1A 1NA8A 3ZY7A 2DWXA 2E9GA 1B9KA 5CN2A 4BCXA 3HS8A 1QTSA 1KYDA 1KY7A 1QTPA 2DWYA 1KY6A 1KYFA 1W80A
chains in the Genus database with same CATH superfamily
1JVKA 3PXJA 1ODAA 1B4RA 3HE7C 3SKMA 1MJ7H 4H8WL 1SLVA 4MB1A 5I71B 3VMPA 2QTVA 3DLQR 1RJYA 1MDAA 2Z3FA 4OZHB 2MFNA 4YEEA 4OLWH 3ZMNA 1FL3B 2C7UB 3AUWB 4PJHA 2X28A 4A2EA 5EF3A 4E68A 1QABA 4P07A 3CVBA 3SDDD 1MCLA 3NIFB 3ARTA 3MOQA 4XXCC 5JUEL 2X70B 2X4PB 3D0AA 1KIRB 1AGFB 5HYSG 2VDPB 4H0HB 4LK4A 5DRNB 4AW4A 2DQEH 1NBZB 2X53A 1QBLH 1CXKA 1U93A 1XD0A 1VEPA 2HWZL 4DO6A 2NQ3A 4JKLA 3SBQA 3L7FA 4NGHH 3HMXA 5LDUA 2DLTA 3M1CA 2WY3B 2FJFB 2NYKA 4GFXA 4PJ5A 4LOEA 3GMMA 4XNZC 2R27A 4F2MA 1KNOB 4CBZA 1V8HA 1A4AA 2AK1L 4F2MB 5F88A 1NWOA 3SE6A 3DTXA 2IO5A 3JVGA 2J88H 3FQTB 1SRDA 1E3FA 2ZTBA 4LVNC 4P5TD 2Z7UA 5DUBA 1J9QA 5EEYA 4KHTL 1E4XI 2UXFA 1DQQB 5FFGA 3C60A 3P2BA 2ED6A 3WUWA 2QADD 1Y18A 2IPKA 2V2WB 3S4SB 2X9ZA 1GYWA 1UWXK 2YZ1A 1Y18B 2IPKB 4X5XB 3GJEA 3MV7D 3WEOA 5FLVA 2WGNB 1RJZA 1D6EA 5AAWC 5F9DC 1ORQA 2W81C 1NBYA 3ZR5A 4D3CL 3L4VA 5BRQA 1EA9C 4KVNL 2PCFA 5CM1A 3CMOH 4WWPA 2QHRL 5AKRA 3ZQWA 4J3BA 4PD4J 5GISL 4YXHH 4OM0L 4AEHL 2WKGA 1VGKB 5F0LB 4E9LA 2WVUA 4JY6A 4X9FA 4KVCL 3D3VE 2VLRD 4NKIL 4XP9L 1UURA 3G7TA 3WKMH 3CH1A 1FVCB 2PW1B 1J12A 1I1AD 3QG6B 2BVOB 4ZMXA 4AM0B 5LWYH 2Y1VA 4OF5A 2HT2C 5D72L 1I1FB 1W72B 4AJVA 4XMLL 2AZAA 4NKOB 4OD1H 1TIUA 2WAQA 3MRGB 1BD2E 1CTOA 1G9MC 5FO8B 2R0ZL 4WNJA 2E56A 3CSGA 4URTB 2AVFA 4NHCH 1VLXA 5DZOA 1KN4L 1HH6B 3P0VH 4HZLA 3VWJA 4P23B 3IBOA 3SDDC 1QX1A 2QQKL 4BBWA 2B0SL 3NN8A 4JFWA 4X99A 3X1BA 3NN8B 3SDCA 3R4RA 4JAMB 2FUTA 3QUXD 1IBFA 1I9IL 1AGEB 4IBSA 4LGPB 5CZRA 4WEMB 4C59B 3HB3D 4JJ5A 2HT4D 4MA7H 3QA3B 4AVHA 4B50A 1TQWA 2YD4A 4JJ5B 4DN4L 5CD5D 3FH7A 4PJXA 4KAQH 3RE0A 2R51A 4Z8FH 3GSWA 3KPPB 5I1HL 2F54E 4PJXB 4TNGA 1IE5A 1WCQA 1P1ZB 4XCCH 2FJHB 1ZLWK 3U6RB 2EAEA 5I71C 4FF9A 1CI5A 3MXVL 2HX7A 4L4TD 2E86A 2QTEA 2VM9A 1T0NA 5GGRY 2VXVL 4RFEB 4PG2A 2FGWH 3MRCB 3LYRA 3DUHA 3MOAH 1IGIL 1SZNA 3KPMB 4YAQB 4GRLC 2FYYB 2F08A 3FQUA 5JHDE 4A67A 5J9PA 3H56A 4BUHA 3D39D 1EDQA 3T4YB 4GKOA 2LAGB 4HAKA 3PABB 4N8PA 4TLTA 2HB0A 4FTVA 5JIMA 4ZFOL 3VD3A 4DPBX 2Z8SA 1MN4A 2ZX9A 1KCRL 3KWTA 3RAJH 3L8QA 1KV3A 5GGTL 4JANB 5DVPA 5E2WL 5DHEA 1H15B 4L3AA 4CGTA 3EH5B 4QTIH 3TEWA 2O5ZL 2IDFA 5GRUH 1GTFA 2R8SL 3LKNA 5IQ7H 4R97B 3CZNA 5K1VA 1JPST 3GSRA 2VZTA 3OHMB 1JWMB 3K7UA 4JG1L 3PDOB 4X6DF 3LXCA 4C57C 2OXGB 3C8KB 3WJJA 1OK8A 5GS0C 4ZW8A 5BO0D 5AAMC 1YMMD 3L17A 5AVSB 4Z77B 2AJUL 1UATA 2Z4TA 2ZUWA 5CP3A 1AZUA 3HPLA 1RUKH 5DURB 1GAFH 2OZ4A 1XMEB 1NOAA 3VSVA 1NLDH 2AK4B 2A77L 4NT6B 1WAPA 3MR9A 4N0CD 4EOWL 2Z93A 1OQXA 5CP7B 1MWAB 4XVTH 5I2IB 3G5ZB 2VR3A 5T3XD 1P1VA 5BV7B 2Z92B 3H3BC 3LKOA 1X3DA 3RIFK 4N20A 4NQSA 2GJRA 4KTDL 4G70B 2ADGB 1CE1L 4HWZB 4S10A 2AHIA 2J6EL 1NGWB 3QS2A 5KOMC 5IT2L 3IWUA 4FJYA 4MMZC 3HTLX 1TQCB 3H7BA 1ZSDB 3HC2A 4U1IB 2BINA 2AV1B 1A7RL 4ES8A 1FYTE 3E9UA 1AZVA 1BOYA 3QJFB 2XWRA 4QKXB 4U1MB 1G7JA 4BXVA 4OAWA 1Z9PA 4YWGH 1G7JB 3GSUA 4POUB 3LQAL 1QHPA 3ABKB 2X1OA 4UQEA 2FNBA 3L5XL 2DQGH 3HI5L 1TZGH 1AFVH 2YD5A 3K2MC 4XP4H 4N6RA 5AB9A 5EC1A 3V5DB 3KS0H 3D2TA 2WOBA 5SWSE 2NY5C 4XCEA 3VCLA 4M93B 3CLEH 4AJYV 1Z32X 4DO5A 1MLCB 4UM9B 1NCIA 1WA0X 4ZS7H 3N04A 3DMMC 4GQPH 3UXFA 1L9SA 1UM6L 2XWTA 4NWTH 4XB7A 1WFMA 1ZT1B 3CFCL 3A4AA 4L4VE 1URIA 2X2HA 1QSZA 5IJBC 5LNDA 1NCWH 2VL5A 3BXNA 3QQDB 3ARXA 3P3UA 1BWWA 3BP6B 1V3LA 4FLSA 4OF0A 1HEHC 1MFCH 5ELIA 1VFAB 4ICWA 3EGSA 3AACA 5E8EB 3L1FA 4PB0H 1IGJA 1EH9A 3KWWB 4LSUH 4M7ZC 5D2LA 4CADB 4NLAA 3C6LB 1MH5B 2HN7B 2R4RL 3BAKA 4LHJB 4E9YA 4R4FL 4LKXB 1IC7L 3H2QA 1JYWA 2ALAA 4H88L 3TIDB 2KUTA 4G8IA 1MAML 3ZKXC 2V5SA 1YN7A 2GSIB 1MQ8A 3NH7L 4M7LH 4P46B 3HLKA 4BV1A 4KKAD 4PJCF 1KTCA 3MROA 1XR8A 3T8VA 3WNIA 4LLMB 1F4HA 3ZY7A 5IVXF 2VAAB 3HNSL 3UBXG 3N42F 1XB8A 1OM3H 1HCVA 3OAUL 1CGWA 2NY2D 4H25B 1KYAA 4OLZH 4LP4A 2OTPA 3V0IA 5KVEE 4HUXB 4FG2A 3IFLL 5F9WC 4B3VA 3U2JA 3MJ8B 3PQYE 4N9GB 1CZ8L 4KUCD 1YYML 3UMNA 3B2VH 5B3JF 3NA9H 2VTFA 1TTGA 4YOKA 3DVGA 2PWFA 3L3JA 3BDYH 1R1CA 2E47A 2K1MA 5AOIA 4BFOA 4HT1L 2OTWA 4XI5D 1UT2A 1YAIA 2V5YA 4Q74A 1O9VA 2QGCA 1LEGA 1IC4L 1ETJA 1FL5A 1IEBA 1N59A 1FL5B 1S3KL 4FNLH 5HYSA 4PSPA 1I7UB 5GJTH 3MUGA 1U8JA 3FZUD 3RVVD 3T3PB 1OGAA 3AU1B 3DI3B 3GDCA 2CPUA 3BO8B 3C6SA 3OXSB 5T5FA 4LVHC 3DIVA 4Y2DC 1MCBA 2IV9A 3PGCB 5DD3L 2Y7MA 3SDAB 1QATA 1INQB 2LQRA 4LLYA 4QY8B 5B1CA 2WLJA 3NJIA 1E27A 1U8LB 3KYAA 4PS3A 1CB4A 2EDMA 2MKWA 2DI9A 1M7IB 5J1AB 5DJDB 2HRPL 2OJEB 4FFZA 5J1AA 4AE1A 4JFED 3MRDA 5ITBH 5D7KD 1A6TA 3CFTA 2RIKA 4JY6B 4QRRD 2YD9A 3EJZC 4YLQT 5C0CB 3QULB 1IRAY 5JR1L 1BQSA 2L8AA 3FQ2A 3N41F 3T0DA 5E6YA 4KC3B 1J86A 1QUNA 1A9EA 2XZQH 2AITA 2EZ0D 4JFHD 4PCYA 3ULUH 4OB5L 1R33A 4QHUB 4BFFA 2VDOL 3BD5A 2RQ8A 3AY4C 4UU9B 1BEXA 3S3BB 4ZMZA 5E2UH 1YY9D 3SQOH 2AXHA 4EUPG 2CNYA 1KB5A 1RZJL 4F9PC 3K6SB 4BKSC 4O00A 1DFBL 2Y23A 4XMPL 1ZLSH 3CK0L 5CEZD 3SKOB 3IU4H 2X44D 5ACZB 3P1VA 1ZE3H 3VXPB 1E4HA 4I9XA 4G7VH 5JNYA 1CFVH 1DLFH 2XFXB 2WXHA 4FHKA 1JPSH 3L9YA 1WUNT 2O5XH 4MJ2A 1YA5A 5E2VH 1KTDA 1AO7A 3F8UB 4FQXD 1WG3A 3HFMH 1G94A 1DVYA 1GS7A 4ZUVA 3UBXI 4E36A 2OMWA 4RFEA 3WAKA 1XCQB 2FCBA 2XV2A 3V4PB 4XO4A 1TZHB 1IGYB 3Q2WA 4O2FB 5EDSA 4WI5A 3QS3A 5F3HB 2CIIA 1GL4B 2JI3A 3TO4D 1JNLL 3QDGA 5C0ND 3UTQB 3FZUC 5FUOL 4I0PC 1YUHA 4PS4L 1HHJA 1OPGH 2OPCA 1BV8A 1OT1A 3B1TA 2ZOOA 1T2XA 4FC3E 4G8GE 4WI3A 1KC5H 4JGUA 2EVIA 1SQ2N 3HN8A 3B7SA 3ETSA 4PJ6A 4LEXH 3X3GH 2OMVA 4B9CA 4PP1C 5C0EB 1RPUA 1L5GB 4PVMA 4FXGA 2DKMA 4YK4B 3VXUD 5F1NB 2KT6A 4I18A 4GQQA 4FFWD 4HV8A 5I6XC 1MREL 3VW3H 1F02I 1MZZA 1IVTA 4U1NA 1NGQH 3W82A 3TH3T 4X4XB 5DVLA 2OYPA 4PRHE 4OCRL 4G1MA 1JOIA 43CAB 1KV7A 3ENEA 4IGBC 1PLAA 3OLGA 4GT7A 4LPTA 4MDJA 4JDTH 2XOTA 4MNQE 5IG7A 1J0JA 3HI6H 3AB0B 3OKLA 5GS1C 5B3JE 5DQ9B 2AXFA 1ZE3C 3FO2A 4CU6A 4O2EA 4EBQH 4N28A 2LLLA 4HAGA 1YMMB 3ILQC 1F11A 4NQVB 5I1LB 3LIZL 1KTRL 4N2MA 2ZPKH 4KY2A 3ZW3A 1S5HA 3GPEA 5TE6H 5I1LA 1C5BL 1KDIA 1HX0A 2ZIDA 35C8L 4M1GL 4OGYH 3BEVA 4HK0A 3NAAH 2X4NA 2IDQA 1FPTH 1UHVA 4HIJA 2CCWA 3IAGC 2QPUA 2CK2A 2VDRL 5BOZG 5CEYA 1F90H 1ZHNB 2MPAH 3B34A 5AKSA 1NCTA 2H32B 1XXDC 2Q7NA 5AVWB 5K9JL 2OAAA 1TFPA 2GTWA 2EUXA 3C5ZA 3NJJA 3AG2B 4WO4C 3IS0X 2J71A 5E94B 5CBEA 4F7CB 1HQ4A 3CQPA 3PRZA 4PJXF 3JBG7 3FFDB 3NT0A 3WJMB 4GIPD 4HSAC 1IAIL 3TFBA 5CJ5A 3L6FA 1IFGA 4YPGB 5K33A 2XZCH 1O9ZA 3W11D 4XR8C 1WISA 1JZ4A 3NSXA 2Q8BL 3HEIB 3L1EA 4IRSC 3WFHB 4YL9A 2E7BA 5F70A 5BZWA 3O3DA 1H3PL 3OKMB 4JZJC 2J5WA 3ZL4L 3RWCB 1TJIL 1TQBB 3GJEB 4YLBA 5JW5B 4DN3H 3TOPA 3ZE0E 5JW5A 3QIUA 4H8UA 4WHDA 1OWWA 3NMEA 2JIXB 1NBQA 3IRCA 4C4KT 1F4YL 2F19L 4FQLL 3AU0A 1JS4A 2OCFD 3KAAA 4RWYH 3U4KA 2V37A 3QDMA 3V7AG 1IL1A 3MV8E 1SBBA 2EE9A 1ZANH 3WN5C 4AIXA 3HG3A 1SVZA 4ES9A 2APFA 1N0XH 4OCWL 5KYUB 1R3IL 3D18A 4K3EH 2APBA 4KDTA 2VQTA 2KZKA 5F96H 1HHGA 1XQ4A 3U4EB 3E8UL 3FW6A 3GMLA 1S8DB 4NJ9L 2Q9OA 2CKBB 2NT0A 4ABVA 1MI5D 2J6EA 3GSNL 4KK5D 3F7KA 3J7HA 1U58A 5DEGA 5IUSA 2ZAGA 4MMYB 2C3XA 2Q3AA 2EDOA 1RCYA 1FYTA 2P24B 4O5LL 4MGXA 3D2UA 4AV5A 4ONHA 2QELA 5FKPA 2C9VA 4QRSA 2ARWA 3PHOB 1O7SA 2PABA 2FT8A 5IV2B 5IB1B 1OWRM 3RKDC 1F2QA 2R2HA 3QDJB 3V4VB 5KBMA 3QDJA 5IFHH 2XWDA 2NY6C 1UZ6F 3CVCA 4ODWB 2YA2A 1G0XA 4QRAA 3VGBA 1OAQH 1FFTB 2IGFH 3BAIA 4O02A 5F1SA 4JFUA 5I1IH 5IWLC 3ES6A 3PP4H 4KJPD 1FO0H 1BVLB 1M7XA 4WWOA 4Y4HA 3MO1B 3KPSE 3QUMA 4MYWB 2N7BA 1TVBB 4U1HA 3A6CL 4GAYA 3MKGA 3ZGHA 2W59A 3OLIA 3UC0H 1MF2L 3L9RB 5F21B 5I0VA 4NWUH 1H6EA 4Y1AE 5E95B 3U0PB 2P5WE 3RFZC 4OVUA 5KYXA 4Z8FL 5CJBA 5KS9E 1BEYH 5J8OA 4NKMB 2WNKA 1N59B 2VSCA 4XZ4A 3I6SA 1AG6A 4ANWA 4PJFE 4Y5YA 3ZZQA 3G04B 2V5MA 1KEGH 1MRDL 3LB6D 1I9JL 4HJSA 1JD9A 5B21A 1UXMA 1GC1C 2AMUA 1UOVA 1UJ3B 2DTMH 2CU9A 3PDOA 3L3GB 5AAPA 2A9MH 1FH2A 3P4NB 2J5LC 4Z3GA 2BHFA 1NIFA 2ETWA 3P4MB 1HHHA 4ZMOA 1WAAA 3NSFA 4ONGL 2H1PH 4PWJA 2MEJB 4PJDE 3VI3A 4N5ED 5FA4A 1KYOK 5DJ2B 5HHQB 1QI3A 3PWPD 4FNQA 1OIOA 5AYTA 1A3ZA 2BOCB 3F7PC 4C56B 4UQ2B 1BZOA 2EEDA 4N8CL 5EU5A 9PCYA 2BOCA 3D5OF 3OKDA 3QR1A 1OAZL 4J3SA 4CVZB 5KJ4A 4O02L 1Z2KA 5D7IF 3O2VH 1GMIA 3CCHA 4GKZA 4HFUL 3RKPA 1MUJA 1YDPB 5LKNA 2ZOWA 5EU6A 1I8LC 3GLZA 4M4PA 1MCWM 1JF1B 3OAYK 1CFTA 4LGSB 4PTTB 2NY7H 5CZXC 2FEJA 3CV5A 5C0AE 1DN0B 3WNPA 2VGLM 4W9GC 3VD7A 3IFNH 2WLHA 1YY8B 4M6ML 5D2LE 4GS7C 7FABL 1RURH 1VKXB 5BS0A 1GIGH 4HWBA 4K0OA 5DK0A 3QO1A 2AJUH 4A6YH 3TBSB 3GHEL 1T1XA 4JLRA 3AG1B 4JN2B 3STLA 1KBPA 1U3ZA 3RDJA 3D0VA 2D8KA 4P59L 3ULVE 1U95B 2IFGA 2RR3A 5DJXA 4I77H 1WJ3A 4LB8A 5KSUA 4C4KO 3GKWH 3P3YA 2HRGA 4ERSH 3KW8A 3G6JE 2P7TB 3QAQA 2XBDA 4NQXA 3S36H 1OZUA 2EKSB 3MV8B 1HXKA 1PY9A 1U8PB 2Z34A 3CIQA 4NM4H 4HC1H 3IXAB 4HX1B 3U2IA 3DETD 4MDRA 3B5GA 5ANME 3AT8A 5CN1A 3MKKA 2O5NA 1JZ6A 5B8CB 2W9EH 3AUVA 2K8QA 1RJLB 1I7RA 5EC2B 3HAEB 4X6BA 2YMXL 3B6SB 3ZTNH 3NRFA 3P9MB 3WTSA 5L0QC 4LDCA 3K2KA 5A2LH 1IBDA 3CHOA 3B9KD 2XQYA 5E9DA 3EW3B 5ID0A 3MRMB 1LP9B 1T0PB 5AW2B 4PLJC 5LBSH 2ZSVB 1A7RH 1E9OA 1JXJA 3SPJA 5HDRA 1B9ZA 4WO4A 4IKKA 5FKAA 4JVUA 4YWGL 4UANA 5KVGH 3QIWA 4QAWA 1QWHA 1T4KB 1D5ZB 3P69A 3WFDL 1NBVH 2E4TA 3QIWB 3PPEA 2QPSA 5CO1A 3BVWA 2CHZA 2KLTA 3KJ6L 5E8EA 4DOHB 1NAML 3EH2A 1OTUC 1G6RH 4MASA 2EEFA 3H0TB 1S9YA 1D7CA 4FQ2H 1E2VA 1E9PA 1FNGB 1MVUA 5ILTL 2VZ3A 3T2NH 3ZDYF 1E9PB 1E40A 1FNGA 1MVUB 2ZZUT 4GBXD 3AY4A 4YHLH 3FH8A 2VDPL 2BIIA 1BVZA 1XDTT 5GZOC 1DVQA 4JDVB 3B9DA 3DVNA 5EO9A 1XGUB 5FV1L 4XWGL 4LSTH 4O2EB 2E9JA 2BIPA 3II3A 2PWEA 4PV1C 3RNKA 1BXVA 2YEZB 1PCXA 3ARYA 1GH7A 1DCLA 2BW5A 2YEZA 1NAKH 2EIBA 3DJZA 4N2KA 1NH6A 5AFAA 1HSBB 4QYAA 1F1DA 1ZWIB 2GJ6E 3KPOA 2ZXQA 3ZZ1A 2BY3A 3MLXH 1QLEH 4N8VG 6FABH 5CLYA 4NZRH 4WWKA 4KPHL 1BD2A 1I85A 1XF3A 3BRDA 1G1CA 1SLXA 3LMJL 3CC5B 4OKDA 5IQMA 3D9AL 4Q9BA 5CIPA 2A9NL 3IKKA 4IJTA 2OTWB 5IMLB 4JO4H 3O3AB 3PFQA 1RZGB 3JTSB 4PWEA 3RU8L 4ZMTA 4JM2A 2VLRA 5FUCC 1TMCB 4N85A 4LSDA 4OFIA 2DWTA 4A7TA 1B0RB 2GPZA 2ZCHH 2PPDA 5BOPA 5I18L 3QW9A 1CTMA 1HN1A 4L0ZA 3EYVA 4KGLA 3VFGL 4XNBA 3GMQA 5IB4A 3WD5L 4NDMA 1IM3A 4QAMB 1QHOA 2EH7H 4MVBC 2X40A 4L9LA 1W0WB 3ULVH 4XMKH 5MP6H 2VABB 3QBTB 2DMGA 1HYSC 4P2RE 5MEOB 1CZ8H 2VABA 4NN6C 1AI1L 5TH2A 1L6PA 1BOGB 2MKLC 1D6EB 5IQ9B 1ZPUA 2WYHA 5DZ9A 4Q9RH 3APMA 4EIGB 1TF4A 2WTRA 3AAZA 5JOPE 2BFVH 3MRRA 3O2WH 1MOEA 3PREA 4HPYL 4ZUTA 3OB0K 1GR7A 1XFPA 3HG1D 3MV01 3MNZA 4N2FA 2KH2B 3T3MB 4FNLL 1B90A 1FZKB 4M8VA 4XZUB 3RWJB 4P5MA 1X5ZA 1PLCA 5GS0H 2PW1A 1OGPA 3QG6A 2UVFA 2XCMC 4OIAA 1SGKA 4UINH 4PJEB 3NIFF 1AOZA 1RIUL 1I9RH 1EJOL 1U6AL 3T09A 1GSMA 2R9HD 5LGHL 3ASWA 4XP6L 3M8OH 5JHDB 1NIEA 1XBDA 1A1NA 1V10A 2I5YL 1ZJBA 4OV5B 1FIGH 4JFPA 4G7YL 2OSWA 3FCUB 4ZSOE 3US9A 4BQ8A 4WAFA 1QO3A 3ZVVA 2Y22A 1EHLL 3BP5B 5IB1A 4XN2A 4HKJA 2IOOA 2Y9RT 4R26H 5CCKL 4QJ5B 2X4QA 5EU4B 3DTDA 4G9DB 1BP3B 2YGNA 1SJHA 5EU4A 5IOPA 4Z3TA 3EBHA 4Y7MA 5FWQA 4JZOB 1PSKH 2XSKA 4YHOH 2C9SA 4Q89A 4ZO6A 4KRPC 4J3OD 1AO7B 4DEPC 5DA4A 1G7PB 4Z7UE 3ULUL 2WWOA 2FD6L 4E41E 1UZ8B 1IAMA 1BFOA 5HYQB 5TQ0L 3RWEA 5DFVC 5D1QA 1AJ7L 4FP8L 1N26A 2EDLA 4YQXH 1ZGLP 1M2VB 1A4KA 3L9RA 3FTZA 3DGCR 2Z35A 1CO1A 4JBSA 1V3MA 3RWGB 3RFRA 1N5AA 5IW6B 1E43A 3GEWB 2HJLA 2JKSA 3ARDB 4FTVB 4BCZA 1A6WH 4F37K 4HIQA 3CIAA 1T0MA 4V33A 25C8L 3Q43A 4XAKE 5KVEL 3KHOA 4K94C 3UPCA 5L88L 3CN0A 2PNDA 3WV0A 1UD5A 1HSAB 2XZAL 4OFYD 3GTNA 3H3KA 5A2CA 3DROA 4GAJH 4BJLA 3D12B 1RSYA 1VJSA 1B4JH 1EBAA 1C1EL 4HOWA 3SKMB 3PL6D 2WVSA 2KERA 2EDEA 4DK6A 5EEWA 4GRWB 4GEJA 2I60L 5FOBB 2QLYA 1BQ5A 2PW2A 3X3GL 5HHPA 3UBXB 3GQFA 3LV3B 4B9YA 4X80H 2P44B 1UB6A 1QVOB 2M26A 4B3EA 2HRHA 5CINH 1BWMA 4YXLL 1N6QL 4LCWB 4K9EC 3QHFH 5IBLD 3X14A 4RRPG 1W80A 2RB8A 8FABA 5I66B 1L3NA 5GGUA 2GBUA 1D9KA 4ONFH 4AXWA 1GA2A 4KI5F 1HDMA 4C83A 5LLIC 2HLAA 3ARDC 4JY5H 2FZ3A 1F3DH 1UXWA 2NNRA 3H4HA 1VKXA 1MCJA 4DHLA 1JFQH 4PY8J 2P48B 2F5BH 2R0WH 1FGNH 3TBSA 1E2ZA 3OHXB 3TN0B 1DUZB 3WS3B 2VUKA 3F85A 4Y2LA 4CL7A 2X3BA 5B3NA 5HJ3A 5C0FA 4MQ7B 1LQBC 2NNAB 4KO7A 4JFZH 1Z9OA 1ZT4B 3BAEL 1S7VB 4YSDA 5I73B 2IBBA 2YRBA 3CLWA 2RMNA 3HMWH 1QA9A 4MZ2A 3KGSA 3MJ9L 3QDHA 3WFEH 1QBAA 3ZL1A 3U9PH 4LMQI 4X5XA 4U6VH 4KTGA 5HYFA 3NESA 2CJ3A 2IPUK 3KEHA 3PV6B 4EQ2A 1H3UA 4O51A 5KVDH 4KH2A 2WBJA 3LS5H 4PW3A 4IOIA 4MNHB 4DFHA 2B4CL 2D0FA 5AEAA 3ILDA 4GSDL 5KYWB 5DC2A 4PV8B 2PLTA 2A74B 4JKWA 1FZOB 1U8MA 2RHEA 1WRFA 2KI6A 3QORD 1AKPA 5FDWB 5J6GB 4M5ZH 2B59A 4WTWA 3EYQD 1EV2E 2IFFH 3RQ3A 4Z7OB 2A7BA 2UX6A 3MACH 4L1TA 3HZMA 4ZFZB 1JZFA 4QRFA 1LP9F 1PZ5B 1FVCA 2WXLA 4POZC 1SN5A 4XN8A 3FUKA 3ZDZB 1M9WA 3VXSD 3BZDA 7CGTA 2DKUA 4NRXA 2X6VA 5A7BA 2AVGA 1JPFB 3ULVF 4IDJL 4QGTA 4K71C 1ASOA 2X4RB 3A67H 3CZUB 3QEUA 5TDNB 3LTVA 2X4RA 2FX8H 4YE0A 3HI1B 4OLWL 1G4MA 2NRDA 4JAMA 3NFPB 2O1AA 3DDGA 1JNNL 4LZKA 2GTZB 2WOYA 2WXOA 1T83C 4XE0A 4ZT1A 4I4WB 2GTZA 2CO6B 3GHBH 4P46A 4HIIA 5IHLB 5F96L 2CDGA 2FLBT 5FYJL 2G60L 1KGCD 2Y07H 3QFGA 4HIIB 4EAEA 3LCYA 1KLUB 3ZE2B 4JG9A 2P8PA 4DQAA 2V6HA 4AGPA 1B3IA 1XIWB 5TPWH 2B14A 2FO1A 5DUML 5JORB 1CC3A 2NPLX 2JKWA 5JW4N 4ZPTA 3L5HA 2XACC 4ODSL 1I8KA 5SWSA 3NEEA 5BZZA 3MBWA 3SPVB 4J3OG 1V7ML 1VEMA 4UUJB 3MRIB 2BP8B 4XN4A 1ASPA 3TWCL 4XAKD 5EIVA 2ZP9A 4UUJA 5EUOA 4QHPA 3D69B 2DMHA 3C8HA 3HC3H 1QSED 3KPNB 4CKQA 2I9TA 1WZKA 3B83A 4MS8D 2WB7A 2YKKA 3A0OA 4D94A 1P5VB 3KGUA 3V0DA 4LLDA 4F8NA 5LBSA 2NTFB 4JB9H 2L7QA 1MQKH 1NSNH 2CMRL 4P23D 3QJHB 4I2XB 4XO5A 4XH2A 2IQAA 3RVTD 2G0KA 1AS7A 1MIMH 2VR9A 1PY4A 4R7DB 3BH9A 2F8VA 4ZD3H 4W9HC 3HR6A 2YXVA 1NAMA 1WGVA 2A6DA 4OZFG 4GW1A 3ZBMA 1IFHL 1ZY9A 2WLNA 4TPRL 4EDWH 3S35L 1I1AB 4KRPB 1INQA 4UAOB 3M46A 2IVFC 2IAMC 2F7OA 2HKFH 2QVKA 1UEMA 2VDLL 2DTSA 2FIKA 1BQHG 1HXMA 5KANI 4XP9H 1ZV5A 1QWUA 4J3TA 2XJLA 4J6RL 1P9MC 3FTYA 2AK4A 2W07A 4P2RA 4HSCX 4QGYA 3WHXA 1KGYE 2YGVA 4AYFA 1M05A 4IK7A 5T5NF 3DARA 3D7PA 2QQLL 3DJSA 2TRHA 3K6IA 4MA3A 5TQ2H 2R0ZH 4FLOA 4TSAL 2H32H 3ESPA 5GJSH 3BDBA 3HS9A 3N5AA 2VLLA 3M1OA 4AITA 1HJBC 2DMBA 3ZDYE 3QHZH 3WEXB 3S34L 3WEXA 3LQZA 3EH3B 4FMVA 3DUSB 3G08A 4YXKH 4B9GA 4NO5A 3LNHA 1JHTB 1PG7W 2C1OB 2JJWA 1RZJC 1JHTA 1W6LA 5D2NC 1Z1WA 4WI9A 3NIGF 4WI8A 4L3FA 4OD2A 5DEFA 1RHHB 4Q2ZA 4UTBA 3FMGL 2WP3T 3BPNC 3MXVH 1U8PA 3DHUA 4LP8A 1S7QB 2LU3A 3BVNA 4QT5A 3X1GA 4Q9QH 1T6VN 2NY7L 1W91A 3MOAL 1AZBA 4ZUSB 2YPVH 1Z5LB 3BRFA 2WUBL 5GGQL 2CM5A 3VWKD 4JO5A 4DWHA 4LIQL 4KUZH 3LX9A 5F3BB 5EEXA 5E6UB 4YDVB 5FF6A 5G4NA 2FWSA 3O4OC 1MCEA 2ZX6A 4F92B 2MNWA 3VACA 1ZAGA 4BM7A 2CJUL 2DQDL 4MB3A 2PCYA 4DVRH 4N6QA 3SBWC 3ARDA 1NTDA 2HJLB 1C5CH 1E8XA 2AKRB 1XAKA 1U8QB 2FYVA 2NY5H 2O4EA 3EOAB 5EIIB 4HKZA 3S37L 3WFCH 3BWUC 2UXVA 3LN5B 2A83B 5CJQL 3WEAA 5D4QA 1DVXA 1UGNA 3LN5A 3TN0C 4E2OA 2A9BA 1XL4A 1XTLA 4BHUI 2BSRA 4UNVA 4LESA 3HPJA 4EI5D 3VWJB 4NXSA 4EIBA 4X8CA 5DEJA 2JK5A 4ZX6A 5FYKU 3OKKA 3KLKA 1YEIL 4PMEA 3ZTNL 2JB6A 5C9JA 1Y07A 2BIQA 4LLQB 2HXAA 2L7EA 3QA3A 1FAIH 2HKHL 5L4MA 1X6NA 4F93B 2AXFB 1EXUB 4KDWA 3TA3A 3V9CA 3M17A 3NJLA 5GZNA 3GSWB 1L9QA 4IOSD 3I3EA 2HWZH 4V1DE 5AD0A 3L13A 1IMHC 3MROB 5MEPB 1XR8B 3GGWA 1IGCL 4XVTL 1URLA 5L2JA 4AG4H 1JRHI 1T0NB 4P3CH 5D5MB 5GS3A 2VLME 4Z3FA 1ZGLA 2G3NA 2R1XA 3FUJA 4KU1A 4IIQB 5I66A 4IBUA 1OW0C 2E27H 4BSJA 4OM1L 4O9HL 1CLOL 4PI0A 4XN9A 1EZLA 3HRPA 4WU5B 2DW5A 1GGUA 1P84J 3QXAA 5AVTB 1NCAH 4ODUB 4S1RH 3N06B 2IH3B 2FB4L 1RZQA 1JZEA 2J73A 2X12A 3GXNA 5D7JB 1PZBA 3FONB 1H5BA 3LH2H 1NIAA 2WINB 2XLLA 4LSTL 5EOTA 1U8IB 5D71L 3TN0A 3UX9B 2FECL 3RWFA 4RAVA 3FFDA 4MJID 2MSPA 2W65A 1KXVA 3HR5A 4UNTA 3D85D 4KROC 3QDAA 1PLGL 4ZTPH 1J1OH 4NDMB 1E28A 3P4OB 3TBWB 1CQYA 4LNVA 4PJBF 1K3IA 1MZYA 1XR9B 2R69A 3Q3GB 4JN1H 4BYHA 1RZKH 2BVQB 1PG7L 1XR9A 3Q3GA 5KN5A 1RLBA 2HX9A 1JI1A 3AMKA 2WCPA 2UV3A 1D5MA 2CRYA 4KVCH 4NKIH 1LWRA 3OXSA 2FSEB 1WWAX 1C16B 1S9WA 1T22A 2IANB 2IEPA 1CE6A 1XO8A 4L4TA 1TFHA 5EU6E 4Y4KA 5TF1H 1I75A 4N1HB 1EUTA 3UBHA 4NPKA 5AAWA 2HTLD 5DWUL 4XMLH 3WENA 4UB0H 1FHNA 3VRIB 3VNYA 4TRPH 4AEEA 3IJ9A 4K5OA 3H9SB 3BUPA 3WSQH 4KQ3H 1A14L 4H13C 3MUHL 5B4MD 5L7XL 3QUXB 5CEXB 2B0SH 2K45A 5KYUA 2FJGB 3HNTL 5AVUB 1UQSA 3K2IA 3VXTB 2IDCA 4HIHA 3PL6C 3ZTCC 1T1ZA 3HZMB 4ZFZA 1MWAA 2VQUA 4IBWA 4OW6A 2CKBA 1BCIA 3QUYA 4XBPA 5EEZA 1DANT 4OCXH 5DEGB 1A9EB 1L7IH 4PJ9B 4LSUL 3G6JA 4KKPA 4XPTH 1WK0A 1JD7A 2Z4QB 4NRZA 5G2NA 3PGDA 2V3EA 2P5PA 2ZNWA 1PYWB 5EUOE 1X5IA 1E3XA 2Z31B 4PYHA 3IGKA 1JGUL 4U1KB 1YQ2A 2AF2A 2NQDA 3K3QA 2YKLL 2JQAA 2ZF8A 3PPSA 1XGRB 5EU3B 3VXPA 4APXB 4QO1A 3WUZA 2YC1A 4KK8D 1AR1D 2R69L 4DH2A 2NY6B 1OM3L 4JO1H 5A43C 4HS6B 1OARH 4FTVE 4N2HA 3VB9A 5C07B 4OLZL 3VH8G 4NQEE 1HI6A 4AQEA 4MJ6A 1OXYA 3I84A 4QRRE 2OL3B 1KCRH 3TIEA 4ZPTB 4CU8A 4MKMA 3FB7B 1SY6L 2VLKB 3UCQA 1A4KB 4PJ7A 1A0QH 1RJCA 2ZWSA 4JHWL 2DWDA 4F8QA 1E4XL 4MJ5A 2H1LM 3F6LA 1AGDA 4NN7B 3GMPA 3HVNA 4HG4J 1SXCA 3IGLA 2QR0A 3MMEA 2K3TA 1IC4H 2ITEA 2ZKHL 4AKOA 5EG6C 1MLCA 3QZBA 2NMSA 1FZMA 4I0PD 4UM9A 4DGVL 4Z23A 5LB1A 5FGCB 1G7HB 1WC7B 1DUYA 1BZ7B 1ES0B 1FG2B 4PJ5D 3U25A 4DEUA 1WS7A 4K23H 4P0DA 4OD3H 1LNUB 1IBZA 2CKBL 3IFOA 4P5KA 4X8GA 5J11C 4A2LA 2FD6H 3K6OA 1ZVHA 1MLBA 1SMOA 1ZMYA 4P2AA 1PMYA 1KGXA 3ABMB 3HC4L 4B9PA 3SE8H 1YG9A 2Z31C 1NGPH 5AW7B 3EG9B 1DEDA 3CUPA 4MBOA 4YQXL 1EEUA 4LSQL 2WHVA 1GC1L 4NNPL 4X83A 3A23A 1TQVA 4IGBD 5D9SA 3S36X 2E9IA 4PJHB 2LAAA 1EEQA 3IKCB 3CFBB 3MLVH 1YN7B 5G4OA 4OZHA 3BIAX 2VNCA 4ZW5A 4ZXBC 5A6MA 5DVKA 3ECBB 4F15C 1PLBA 3QDMD 2MTAA 5FOJA 1YNKL 1DJIA 1YC7A 4NC0B 2AGJH 1HZHL 2MQ0A 1B2WL 3GK8H 9CGTA 4YZWA 4LASL 4N2BA 2YQBA 2X42A 4QMEA 5D1ZC 1WD9A 1BDYA 2WXFA 5KBPA 5HDWA 4TNVK 3RBSA 2Y1ZA 4WWNA 3HS0C 3KS0J 2LTQC 1JRHH 2XNAB 2EIMB 3N9GL 1WIPA 1CIDA 4LSRL 4LU5H 4M3HA 1IO4C 3ZT5A 5JIHA 1MHEB 1OAYL 3HLAB 3F12A 5A1AA 2NLJA 5AB0A 4IK6A 3C5ZC 4S1QH 1DFBH 4JM2C 1F3JA 1HINL 2OM5A 1NC4A 1AGBB 5E8NA 1LWJA 2XTSA 2LOEA 2AQPA 1ZVNA 2CDFA 3EO1A 4BH8B 1FE8L 1T20A 1MW1A 2JELL 5DYFA 4AX3A 5BRPA 3DXAD 1YEGH 5IW1B 2ZOLB 1KIPB 4Y4FA 1E65A 4HVBA 3CDFA 3KLAB 5FYKD 3KL5A 1BQRA 2LFEA 4OD2B 5CEZH 1H8NA 5HD8D 3C6LD 3FQTA 4PLJD 3EKCA 3GDBA 2RACA 2YD6A 4X7CC 4FJZA 2RCSL 4XPBH 3JWNG 1ZOXA 5BZWB 4DT2A 5DWPA 3ZGIA 4KK8C 1PZAA 3PWVA 4QRBA 2PR4L 4PRPD 4Z5RA 1DE4B 1IZKA 4F15B 5B8CA 3FT4A 2HJKB 2J6WA 2F58L 1FZOA 4ODHH 4NERA 1P5UA 1QPKA 2P5WD 4XCFH 3WEMA 5E6ZA 5L2KB 2VDOB 3I02A 5GZOD 4JRXA 2HVBA 3SDXF 2AJXH 1GJUA 1HWWA 4R5VA 2XI9A 1P9MA 3P11H 5IK3B 4AM0A 3GMLB 1EO7A 2R2EB 1PZUB 4WEEA 3L1GA 3D30A 3U9PL 2G5RA 1FO0A 1OGTB 2ARJA 2ITCB 1LWHA 3NH7H 4M7LL 3TU6A 3WE6A 4U49A 1IBBA 3T0EB 1RPQA 3GFUA 2R1WB 1JV5A 2KL6A 1NLBL 3SE9L 3GTVA 1AAJA 3NFPA 2X87A 1JV5B 1TQUA 3KYMA 3BPLC 5ACZA 4WSJA 3C5SA 3HHRB 4Y4KC 3BSZH 5F6IC 4YEFA 3TNMB 3CDZB 2N01B 4MCYB 3NZUA 3PAUA 4K2UL 5LDSA 5DRZA 2X1WL 2VLMD 3RWHA 1J5HA 3FKUS 1WV7T 2NZ9C 5DRZB 3UTZA 3U6RA 1CURA 4E9SA 3G5VA 4HZ1A 5E1HB 5D5MA 3AWGA 4XN5A 5SWSB 4WWKB 4FMFA 3FF8A 3A67L 1JHLH 1U2CA 3FSOA 5EN2A 4TN9A 2XA8H 3LPOA 5IMLA 1KOAA 1CU4H 3WY2A 1E6JH 1YUHB 4M7JL 4DGIL 1AIFA 1HEZA 5D8JH 1GOGA 1ZLEA 2BPBA 2XC8A 4OZGB 1SJXA 4R7NB 3CHSA 4GRWF 2Q8BH 5F7DA 3KPSB 5E5RB 1MI5E 3TVMC 3PJSA 1R24B 3R8BB 1XSOA 3PJSB 1VF5C 3QO0B 1AQKL 1J0IA 2IV8A 3P3SA 4N2LA 3VFPA 1BQHA 3MRNA 5F9JB 1BQHB 3LPFA 4OV6F 1UWYA 4G6KL 1Z0NA 1CD1B 1PKQA 1DYZA 4Y7OC 1FLRL 3VFUB 1YEHL 2HG5A 2NX5E 2HH0L 1GPOH 5KS9B 3U36A 1A5FL 2WTRB 3HC3L 3LZNA 1ZANL 3ZZSA 1G9EA 5C0BA 4G3YL 2GBVA 4OIIH 2HMIC 5HHMD 1R3JB 4RMSA 5EZIL 4UYPA 3FB6B 5C0IB 5A2KH 2HMID 3T8MA 3CBKB 3FO1B 4DKEH 3NEOA 2XFGB 3AVEA 3O8XD 1SM3L 5T3ZH 5M94B 3KNBA 4EZMA 2Z8RA 5JW4Q 5CP7A 3PCYA 2VDML 3LKOB 1AY1H 2AEPH 1T04B 2WWKT 3ESUF 4AIEA 4L37A 2PYEA 2XYCA 3O2DL 3UTTA 1KDJA 1SVCP 2VC2B 4MAYC 4N3TA 4AH2B 3GI9H 5E2VL 2VDLH 2Z31A 3LVEA 4H26B 4JUTA 2COVD 3DPDA 3AM8C 3WJMA 3VM5A 2DLIA 3CLFH 4IJ3C 2D03H 1AVAA 3CZEA 3QWQB 4K15A 1COBA 4R83A 2ZKMX 2J25A 5KSAA 3KG5A 5TQ2L 1F86A 4BFBD 4UZUA 4EI5B 4KTYA 4OVVA 3HW7A 4CN1A 2Y3NA 3D25B 4GINA 4QXUH 2CNZA 3IXAA 3W1ZA 4R3SB 2WC7A 1LE9B 2BC4B 1A6ZA 2MHAA 4MNGA 5F1IB 1CGSL 1TVDA 1GZPA 2E9GA 4KJPC 4NNXA 5E6ID 2VZUA 4XNYH 4ZAKA 5MHSD 3B3IA 3VCLB 1GSKA 4G6JH 2DWDB 2VDQH 2VXUL 3PWLA 5EBLB 4PJ5E 3UBFA 1K2DA 4CA4A 3NBNA 5KYYA 3ABZA 4E0RA 3FOMB 5I30L 1KCUL 2EP6A 5BUPA 1NGYA 3ZQXA 1D5XB 2VW6A 1PVHA 3U30B 4Z0BL 4XMUA 4FERA 4BFNA 4UTAA 1ESOA 1LNUA 1YJDH 4MA1C 1QACA 3EYOA 1U8CB 1T66D 4UV4H 1ID2A 4Z7WE 1LK2A 4MMYA 3R7RA 4U6XB 3GRBA 4AMWA 2GI7A 3QI9D 2FATL 2G4GA 3I6KB 3RDTD 5SWZB 3DROB 5KTEL 2B20A 5E99H 5D2LB 3KYNB 1E4JA 5D7LA 2J4WL 2NT1A 4XOCA 5D7LB 2V9QA 1A4CA 3A6OA 2EDQA 2G5BB 3DX8B 4X0NA 2WW8A 1XH3B 3PE9A 1U2HA 2J44A 2ZCKH 4J4PA 2EVHA 4KBPA 2ESVE 3FU7B 2QDWA 3UJJH 3Q1SL 4KHTH 1SLWA 2N0MA 4POZD 1NL0H 2VAAA 2XWCA 3FU6A 1EANA 5F0MB 3SPIA 5AWNH 4EPSA 2RH0A 1QR1A 3KXFE 3Q9PA 3QRGL 5CBAB 3NSDA 5IVZB 4J3OH 4BK5A 1AQMA 1DQMH 4M5SA 4PGDB 1A9BB 4I5BB 3CPLA 3RTLA 1MIEL 2Q5BA 3BQUC 2D7NA 3JTTA 4HLZG 1J8HD 3BGFB 3RTQB 3MI6A 3CMOL 3F3HA 1RK7A 3HLAA 4WV1A 3GB7B 4N2CA 4P06A 3MJWA 3ZL4H 5J57B 1DN2A 3QCUL 4GSQA 3RVUC 2C1PB 2IALB 1X7TA 1QSEB 4RMUA 1IKNC 1DUZA 3WS3A 5M7QA 1IIKA 3Q9QA 2FEEL 1KTBA 3BE1H 5FGBC 5C0RH 3BPNB 1MHPH 1KIPA 4FADA 3NCYP 4G59C 4IQHA 4NZJA 5GPRA 5HYSB 4A7GF 1S7VA 4OZFH 3DX1A 2NSMA 1OP5K 4HC1L 4NUMA 3UJIH 1WT5C 4HEME 4NO0D 1E30A 2P8MA 1UA3A 4R5TA 2X2JA 4NZFA 4E41D 3B9AA 2X1XR 4J3UA 2ZXCA 1CLOH 1ZLVK 5AOLA 4K7PH 4EJ1C 1HYRC 2GJ6D 2B39A 3PWVB 2XPGA 4CSZA 4S1RL 4WI2A 2VDQB 2YRZA 5I6OA 5DJ2A 5FS5A 5HHQA 3MLSH 4X5WB 3TCXA 2DQEL 3D3VD 1KENH 4KAQL 5CWSB 5DHDA 1EAJA 5F9AC 5I23A 4O58L 3QQ3A 4JZNB 5DHVB 3ARBC 4Y5VB 4YDZA 1Q1PA 1DQTA 1PLGH 2ATPB 5F7LB 2ROXA 4X98B 5GGSY 3WN5A 5DS8B 1ZA3B 3BKYL 2QT6A 4NP4L 4UILH 3RWJA 4XOBA 3VE0B 4WUUB 1VHPA 1AZCA 2E46A 3QCTL 4HMDA 1CFTB 3FBKA 3T6WA 5FM4A 3UDWC 3T4AC 1NGXA 3K74B 4PP2A 3MRGA 4G1EA 5F8RC 4NEHB 2Z4QA 1KEMH 1XIWD 1J88A 4MXQD 2J88L 3ILQD 4HSQA 4NQDB 4P4KB 1KB5B 3O6ML 5HHNB 3EJTA 2J8UB 3QNZA 4GXVL 4TTDD 3FB8B 4OLYL 3SDCB 1OE2A 1SDAB 1OB0A 2CRIA 2CH8A 3DKHA 1NCUA 3N43F 1A14H 3EO9H 3RZCB 2E76C 5E2WH 2D31A 3DI2B 1PAMA 3D34A 2Z91B 4A39A 4B9KC 4F7KA 1G4RA 4IKNA 2X4OB 4D3CH 3FUMA 3ZKND 1Z5YD 2ESVB 5EZLA 1EEYA 3RX5A 3BZEB 4KQ0A 5CHNB 4RAUB 3ZIYA 3GRGA 2XTJD 3F7LA 5BRZA 4RAUA 5IEHA 4NAQA 4GO9A 1NC2B 1TUPA 3BP7A 2Y3AA 1NMAH 4F8PA 3NCYS 1BYOA 1FGVL 3EBIA 1T6BX 3SCMC 5LUMA 1OZTG 1R17A 4OGXL 5DMJB 1M2VA 1A3LH 3U4BH 1JGUH 4Q4IA 4OD1L 4DAGH 1A3QA 4FL4C 3VFTA 3KPNA 12E8L 2ODIA 3QRLA 1KB9K 5F7YC 5F9WB 4P2OB 4PJDA 5T1MA 5DMKB 1UB5A 4PGZA 2AFNA 2HFEB 3BZFA 4NO2B 1IEHA 3ZIMA 4ERSL 1T0MB 2WNGA 1BAFH 2CO2A 1T4KA 2XVBA 1QI5A 1NCNA 4APQC 1A7QH 4L8SC 2BM3A 5AW9B 5DRXB 4P2QE 2X41A 3ULUF 4JHAL 1HSAA 4YDLB 1NEZG 1A6AB 4U1NB 4DW2H 1Z5HA 5I75C 1FIEA 3LN4B 4BZ2A 4HIXH 3CDYA 4FKEA 5D5MF 3HMXL 3F04A 3DECA 2BFVL 3MRBB 1KXHA 3RLSA 2VDNL 2R0KL 2CJTA 3EO0A 3T2LA 5HHME 3FT2A 1SXAA 2EO7A 3P73A 5C0BB 5LQBL 4BSVA 5GRXG 4Y16A 2YR3A 3T3PF 5I1AA 3P73B 4CRPA 4BSWB 1DBKL 1UD2A 4YHYC 3PL6B 5GS0L 4KZDL 1J8HE 2HT3D 3KYOB 5I8OL 4CSPA 4I0CC 5T1DH 3VRLF 3CSYA 4CBPA 3LQAH 5DRNA 2AEQL 3WELA 4DKFL 1M05B 3A4FA 1CBVL 2BHUA 4OF7A 4UF7C 4JO2H 1D9KC 2WBWB 2KPWA 2XT1B 2JMRA 4MAUL 4TQHA 3U4AA 1R3HB 4I77L 1XEDA 4G7YH 3Q7JA 4HUUA 3TASA 3TCTA 3NPSB 1QBMH 4FQIH 2QL1A 2I32A 4BUQA 4OTXH 4RDBA 4WI0A 5GRUL 4F7CA 1QFOA 4G43B 4BH8A 3LQZB 3W38A 4P9ML 4H26A 1CLVA 2QFPA 3WTXA 1ZV9A 1YNKH 2BK8A 3PUUA 4PGCB 4AQ1A 4XHQA 2OSYA 2TSAA 1S7XA 1FFRA 2GUOB 3LQMA 2Q86A 3RZWA 3U0TB 3O3DB 4NSKB 1PW3A 2J8HA 1RVFH 3BVNB 3W0WB 2DPKA 4J4PC 1GAFL 3BJ91 4P57B 2ZP0T 1O5PA 4HUCA 1AJ7H 1TZAA 4LDEB 5AG9A 1OAYH 2FGZA 1DE4A 2EO1A 5EO1B 4KKLD 3NIGB 4ZMWA 2O5YH 4P9HL 4UDUB 1Z9SB 2H5UA 5IHWA 2CDEB 4BCYA 1TG8A 5J89A 4F58L 5DHYB 1QOKA 4MA8L 2ICES 2GY7B 3NG5A 2XWBA 1SEQL 1GZHA 2FECI 4A2DA 2VMJA 5BJTB 5HP5A 2ZXWB 3HNSH 2FL5B 2X88A 3FOMA 4WSGA 3HG2A 4M1CC 4YHLL 2J6EH 5B1AB 5AB2A 1UWEH 1U58B 1PZ5A 2YD1A 1U8CA 4MD5B 2ROYA 2ITCA 1YECH 3TTYA 1CL7I 1FFOA 4L4VA 2JE8A 1ANUA 3LPGA 3BDYL 2BNRA 3OWRA 1B4JL 3I6KA 1TNNA 2HYMA 2X9YA 2XVGA 4RETB 4FEIA 2XICA 5BNXD 1TLMA 2AABH 1PKQE 2CRMA 3E38A 3LKQA 3QUZB 2IIJA 1I7TB 1R6VA 4JPVL 4PBWD 3K1KC 4OZ4A 1BQKA 3S3SA 4JFOB 5LG1A 2YPLA 3CDCA 5I74C 5D6DA 2J1ZA 1RIHH 3AQDA 4X7SL 4GG6F 4XT1C 1JVOA 4JO4L 3P11L 2WKLA 1QFWM 5I1GL 1L7TL 1BVLA 1TEYA 2VKWA 1IGFH 2FE0A 3WO4C 3L3KB 1DJXA 1WHOA 1MKFA 2HFFA 2P8PB 1QSFD 2X1QA 4HF5L 2HT3C 4EI0A 5J0BA 3V6OC 4WWKC 5E6RB 1ML0A 4NWTL 1I8KB 4IIQC 3NZSA 3BX7C 2EH7L 1NCGA 2DQMA 5DR5H 5ESQB 2HFGL 5EUOB 3O4OB 3P9WB 4YE4H 3RVXC 5EOTB 1XD1A 1AI1H 3H9HB 4BDVB 3IJYB 4DVBA 5CNHA 1CFNA 2EEXA 1O5DT 4WRLA 4F9LA 1A1OB 4HWEH 5E08H 4Q6IA 3BI9X 3C87A 4NKMA 1A1OA 3WXVL 5AVZB 1UZ6E 3BPCB 1KBWA 2YXFA 3VGAB 1JK9B 1JYXA 3E0GA 3UTSB 2PPEA 4OCLC 4H20H 1F00I 1E90A 3BO8A 4L2YA 1JHLL 3GTTA 5ECJE 3BLKA 4M4RA 4F8OA 1DQLH 1E4WH 2D3NA 4JL1A 5I6KA 1F4AA 4XMPH 3WNJA 1INEH 1U21A 4AQ8A 2LABA 5FECB 3VD1A 5SV4A 1S4IA 1RUAH 2OJ1A 2R1YB 3OKDB 5A16A 2F7IA 3LXAA 1FNFA 4UQ2A 2AQ1A 2X09A 3SCMA 1JZ8A 1SMDA 1KCVL 2AXJA 3B5HA 3GSXA 2FJGA 2FX7H 4L23A 2J1KA 4R96A 5I1JL 3CCHB 4GKZB 3KNBB 2ED7A 4G42B 3NIGE 2J2ZB 4QCIA 4OJCA 4BFIB 2JJSA 4L37B 4DJMA 3LRKA 3BW9B 4J3VA 5EEUA 3A47A 1FLRH 2WV3A 1ZVSA 2XTLA 1SFHA 1Y0LA 4NYLB 4P4KA 5IMKA 1GPOL 1OCZB 4DP1X 1BBJB 1UJ3C 2WO4A 1NDGB 4XMWA 5SV3A 5C09D 3OHXA 4JFHE 3MRLA 5AG8A 2LU4A 3FSWA 5AZEH 4QYOB 4JDZB 2AANA 2W0FA 3I3BA 3FSZA 4JHZA 2QPFA 4MQ7A 1KACB 2NNAA 3WJLC 4PJFA 2Y07L 2Z91A 4NIYE 3DHPA 3MV8A 2DQJH 2ZWLT 5CSZA 1IM9D 5K1NA 2IAND 1KTDB 1KJVB 1PPIA 5BRZB 1AY1L 1BVNP 4R3SA 3LEVH 3H3PH 4A2FA 2EVJA 2GITB 2FH8A 4NNXB 1V7MH 4RGMC 2FUQA 5JR1H 2VLJD 4PJ7B 5EC2A 3VSUA 3DX6A 4Y88A 5KYWA 3BSGA 3DX6B 5LN8A 1DSYA 3SB3A 1SXZA 2WGXA 2XZAH 1GGCH 2C3GA 1A6UL 1LP9A 3K1DA 1SYVB 1CG9B 1LD9B 5C0EA 4WNSA 3E6HA 4HKXB 1JZ5A 4Z7NB 4FXGB 4P2QD 2HFEA 3BZFB 3LJ3A 1U8HA 4NAJA 5I15L 3QDJE 1MIML 5DJCB 2ED9A 1F90L 3IDNA 1KJMB 4RGNB 1JERA 2H2SD 2A6KB 3PGFH 1CFVL 4OQTL 4L1HA 4NX0A 3SJVE 3TNNA 4A7GA 4D0DA 4XPAH 2VMDA 3IDXH 4FXKB 6PAZA 5TJWK 1UM4H 5KAQG 2OQJA 2P5ED 3CN2A 1JPSL 4XNYL 4EE2A 3RY4A 4G1MB 4PJDF 5DDHA 4B60A 4PJAF 1BX2A 3TIDA 2VDQL 1VFBA 2GEEA 1H19A 2OKMA 2CWRA 3HFML 1IAIH 3K72A 2UZIL 4JG0H 3FT2B 3ECVA 5H4YA 1BF2A 3BN3B 5KSBF 3CFNA 4JW3A 1MWOA 2BWIA 1SN0A 2ICWA 2JF1A 1CICA 4R9HA 1AACA 2HPOA 2R0WL 1UENA 2FHCA 3X1FA 4PGDA 3AXLA 1RUQH 1TJGL 4LEXL 2YJLA 2JI1A 2MOVA 3EDFA 1HFUA 4HJGB 2VAJA 3OZ9H 4PM1A 3HS0B 2K6ZA 3GWJA 5I8EA 2EDWA 4BQBA 3ZYIA 3LVTA 4LBAA 1MREH 3VW3L 2APXA 4OCNC 3JYBA 1NEZB 4X7TB 3NJNA 2OYMA 15C8H 3QE5A 2BZ7A 1TETL 2G9HA 2WINA 1TYEB 3KCPB 4WNQB 2BWQA 1HOEA 1NL0L 2WZPA 3CMGA 4J8QA 3FT0A 1GOFA 3H85A 4Q9QL 3ALPA 3HI6L 3Q01A 3VQ2C 2VB5A 3WKYA 1JK8B 5FYKH 2VMCA 3QFJB 3WKNA 4ZZKA 5KN5B 2BNRE 2WUBH 4M5ZL 3T3MF 1K72A 3CHXA 1S5IL 3JWDC 4Z9KB 2FO8A 1F6AA 4N90E 1DJWA 1PF3A 1C5BH 2JIXA 4JG5A 1K5WA 4NM8H 1M7IA 3HE7B 5EUKA 4AK1A 2MRYA 1PQZA 1HXMB 4XNMA 3AAZB 3QQ3B 3TT3H 4DTGL 2A73B 4NI6A 4U6TA 3V6OA 1IL1B 3TESA 1C5CL 3QUXC 4LCIL 3RA7L 2NY5L 1XAUA 3H55A 4NXKA 5C0CA 3RP1A 2H2PD 3LIZA 4Y16C 4JGNA 5TE4L 5K5YA 3B9EA 2EACA 1Q9OB 3ZOAA 1SXBA 3UJIL 1HIMH 4S2SA 4PP2B 2VDLB 5C09E 1BPVA 3CZKA 3VFRB 3F05A 4BWWA 2YGOA 5IMOB 1MF2H 2R2BA 3VFRA 1OGTA 2ARJB 3WE6B 1GW6A 1KFAH 5BCAA 5JHDA 2BW4A 1C08A 2JTDA 4PJGB 2WQXA 3FO0H 4CNIA 4OGAC 4RGOH 1YEFL 3BP5A 5ENWB 1OOWA 3PHOA 5GISH 3QUZA 4YXHL 3BGMA 1QO3B 3VXRD 5MEND 5D1ZI 3CD4A 5DUMH 2DLGA 2M2DA 3VFOA 1P6AB 2C1OA 1BPLB 2XFXA 3WKML 4EN3D 5DFWH 3MUUA 3LKPB 2BNQA 4EZKA 4NP4H 3TO2A 4ZOBA 1B6DA 3F64A 4LLAA 3UZEC 5KVDE 3L3HA 2Y7SA 4RWYL 4AG4L 4G8GA 4P3CL 2IH9A 5HY9A 5C07A 4JRWA 2X89A 2AJVH 4XBMA 3H2WA 5D1QB 1OP3K 4Q9CA 4DCQA 3TO4C 1KLGA 4FNTA 2JCCA 4OR1A 3QDGB 1KLGB 2FEDD 5CU9A 1I3RB 2FB4H 5I9QC 2VRAA 3MXWH 1HILB 3QJZA 3RJOA 4TQEH 4DN4H 1OAZH 1XGYL 2Q3XA 1AR2A 1K6QH 5E5MA 2X1PA 4NUGH 4O5LH 2ZNXA 1FLTX 4MA1B 4FG6C 4TPRH 3O4LB 3DA0A 4DVBB 3O6FA 1J05B 1U4EA 2V0AA 1PEWA 4R7NA 3CJJA 4B7IA 4K8RL 5DRXA 5FGSA 3IFOB 4P5KB 2DQFB 4QOKB 3QQ4A 4FYTA 5HDBF 1MCIA 2I7SA 4QOKA 3HBZA 2O30A 3QO0A 1OTSC 3S5LB 1NJ9A 3VXSB 3OGCB 5JXEC 4J6RH 4N2EA 3IFPB 3QNYA 3D1MC 3QHTC 2XPZA 3V7MA 2I24N 2ICCA 3MCYA 1AP2A 2LHAA 4OUOA 2VN3A 2DM4A 2FEEI 2Z7YA 3JQOB 4LPWA 1EGJA 4H0GA 4P59H 3RAJL 1JNHA 2YEVB 12E8H 2DYPA 2WXNA 4HXAL 5IBTH 5GJSL 1GTNA 3K2UL 4N2AA 3AG3B 1KCBA 2K4AA 4HEMA 2Q8AL 5JMRA 3OR6A 3QJSB 1BM7A 2GUYA 4PJBB 4W4OC 3IMVA 3S36L 3UC0L 2EDNA 5DTFB 4EVNB 5D6DC 4GJTB 3MX0A 2CKNA 2R8SH 1KY7A 1CTNA 4EVNA 3UO1H 2L7UA 1UOLA 5TF0A 5TDPA 4OCXL 3DSNB 5LXGL 2NW3B 1R3HA 4A7UA 1BEYL 4OZIB 3MCLL 1NKGA 1RERA 4JRFA 4OZIA 3LQAC 2G9KA 3CBRA 5JHLH 3LAFA 4PG2C 1HDMB 2JH2A 5JQHC 3ZE2F 5D7JA 3QFJE 4JFFA 2MIZA 4B41A 5ES4B 4QR7A 3TVMD 4FABL 4YSAA 2IWEA 4XBGA 4EOWH 5HHOD 1Z9LA 3U48A 1BG9A 2DQTH 2FLMA 1UFUA 1EX0A 3JT2A 4KZDH 5C09B 1ZT4A 2FWOB 5IQNA 3VH8A 3F01A 5ERWA 2GEQA 5HJ3B 5C0FB 4FNRA 2BRRH 4JO2L 4N8CH 4M7KL 1BZ8A 2NXZC 3O2VL 2YLHA 1VFMA 3NDYE 2UY6A 2GITA 2NXZD 3VFVA 2VDPH 5TE7H 4MNHA 4KKLC 3WFCL 4BZ1L 1HAUA 2WBJB 4IHBA 1DQIA 2W91A 1RJLA 3CNKA 3ARQA 4APQD 2EDFA 3OQ3B 4UQIM 4PY8I 4ZMQA 3AG4B 4NUPA 3CBJB 4W9ZA 2CAKA 3MRMA 5F71A 1CG9A 3TC9A 1OT2A 1UQSB 1UOKA 4TQPA 3SBWA 4HHAB 3MLXL 3I02B 3HE6B 2QHRH 1YNTB 3TO4B 1YRKA 2I9LA 3GHEH 3HE6A 3TBYA 2KDGA 4LARL 2BP5M 1FFOB 4L4VB 1NGZB 1YVLA 1KJMA 1LO4H 3T2QA 1NGZA 3P40A 2MQGA 5IKCB 3PGDB 1XSKA 2G75A 4QKTA 5IKCA 1U8KA 5CSBA 1DJYA 5IESL 4PJAA 5EMYA 4I1PA 3HHSB 4X6CF 3KYNA 1ROWA 3I6LD 2YBGA 3RUGA 1SOSA 3MLVL 5L8JB 3V4VA 4JFOA 3F7VA 4LIQE 4Y8AA 2QHLA 4GH7B 4JZJA 3MBEA 3O41B 3H1ZA 4OM1H 4PJ8D 3C5SB 2KZWA 3Q6GL 4PBVC 1AHMA 5FCSH 4LHUB 1OP5H 4Y9BA 4JPWL 2XN1A 1KWGA 4Z7UB 3WJLA 3TFKC 5GGSA 1AD0B 4LU5L 5I1HH 1A7PH 1U3NA 2R4RH 3FFCB 5CR1A 2EUVA 3UAJD 4YDMA 3RFZB 2QKSA 3HC0B 1MCOH 3SO5A 1O7VA 5DJ0B 4RVBA 1HL4A 3ZQ9A 1RZKL 3EOBB 3TBBA 2BP8A 2JTYA 4X7TA 4K94L 1IT9L 3O11B 1AIFB 1HEZB 3D3VA 4KK9D 1NAMH 3FCGA 4LCWE 1EXGA 1O75A 3D3VB 2ILLA 4WNQA 1TEGA 4XGZA 3PQYB 3BUTA 2HTKC 1KELH 4M8QA 1RIUH 1L4IA 3A6BH 4M56A 3MUGB 4W93A 4TRPL 3RNQB 3SDAD 5ISZB 2WIIB 5L4FA 3VDAA 4KXAA 2GT9B 3NA9L 5K59E 2R56H 3W11C 1U91B 2ZJSH 4RNRA 2XWEA 4OFDA 4N0RA 1YLBB 3E9TA 1BOGA 5HGAA 4MLSA 2BNQD 3KYKL 3S8FB 1WCBA 4H1LA 3HE7A 4JPIB 4QRQA 5EUKB 3WEBA 1WCBB 4H1LB 3DOSB 5JOEA 4ABWA 2E8YA 4KQ4H 4YH6A 3EZJB 1NCHA 1PZ2A 2J20A 4XZUA 4YBLC 1MHCA 5T3ZD 2F1AA 3IMTA 4K3GA 3FO1A 2V2TA 1XGPA 1CT8A 2A77H 4ZNEE 4HMCA 2RD0A 5B8CC 3MJ7B 3TA4D 2WQWA 4J3OC 5IMOA 2R2BB 3FRPG 4L2LA 2FBRA 3OMZA 4XXWC 3WDIA 3UGUA 2ZQKA 4JO1L 3FQWA 3THMH 2D7TH 5MENE 5CEZE 3CDGB 3CVHB 4BHUA 5C0CE 1HWHB 2Y5QA 2ZCZA 1A9VA 3FB8A 4WDIB 3ROOA 1KGJA 2C3WA 3EO1B 3GI8L 3SKOA 4WDIA 1KYOJ 4YFLI 3FHEA 3V6ZB 3TPUA 1SOKA 1GGBL 4Q2ZB 1P7QB 3QAZC 5B7EA 1UTDA 2JKJA 3R06A 1PNCA 3VQ1C 1AZRA 2L3BA 1BZDA 1F45A 5GQBA 2VJ8A 3TEUA 1ACYL 1OAJA 1ZA6A 5HI5D 1JUFB 2WXPA 3EDEA 3BKJL 1IQWL 4FYSA 2XUWA 5DD0L 3TYFB 5CGMA 1W0VB 2H8PA 1IV8A 1NICA 4AZ8B 5KYNA 2IDUA 4LPXA 5F6HI 2X9WA 2H8PB 4AZ8A 2OW6A 2VXQH 4G71B 3CK0H 1CU4L 4FS0A 4NOBA 4MVBD 4DGIH 2B5IC 2JQMA 2QQNH 2XKNB 3HZKA 3ZK0A 3NSCA 1F4WH 3K4ZA 4Y2DD 1U8QA 4LSQH 2EO9A 4WFED 2XXMB 4AQZA 5DMKA 1AKJD 3HNVH 4ZYKB 3TPKA 1SF5A 3CFJA 3JXAA 4IBTA 4WZ9A 3SKNA 4YHMH 5GS0D 2EILB 4MNGE 4KNSA 3C12A 1DBBH 2IAMD 4R84A 5AOMA 1ICTA 3B9VA 2BSRB 3NCBB 5DC4B 2PXYA 1HJCA 3CZSA 3OKOB 2FDBP 5KSAD 1G1YA 4WUKL 4X4XA 4WFGD 5SWZA 3TXAA 4ENZA 3MLRL 4ODVL 2WQRA 1JPGA 4PYGA 1OCRB 4J12A 1W72H 1AS6A 1JPGB 2DLEA 2WZAA 3X2QB 1EXUA 1EERB 1YEDB 3IJ7A 4IBZA 4K3HA 5DURD 4PJEF 2AEWA 4JFZL 5CN3A 4FP8H 5JQIB 1G7QA 1YC8A 5D2NE 1JYNA 2F8OA 3S4SG 3BPLB 3L81A 3HMWL 4A7VA 2NY0B 1HINH 1HSBA 3RWHB 3RYMA 5I15H 1DDTA 2PYED 2YMOA 3ME0B 3OKNA 4YGVA 5T1KD 5G5DB 4HP5A 4Q0XH 5B1JA 4UOW0 3EF7A 5KVDL 3BRGC 2I07B 3ULSA 5EN2B 3NFNB 4WU5A 4PLOB 4AXWB 2MJWA 3N6YA 1NPJA 2BOBB 3W0WE 4CMHB 3SYQA 3IFLH 2VZOA 4NKDA 3S5LG 2UZIH 5F7WC 2VDMB 1TTBA 1NKOA 4JFFB 3B7UX 3MYJB 1MXDA 4LXFA 5ICXA 5D1XE 1AC6A 2PPFA 2EE0A 3PWNA 4N2NA 4XBGB 4OZGA 3IDMB 4OT1L 2PR4H 3PWNB 4NC1C 5TE6L 1E28B 3N40F 4CJ0A 3U2SB 4JY4A 3QQ9C 4YPGA 3QH3A 3QC6X 5EA0H 4TL5A 5FFOA 3MZGB 4HPOH 2I60H 4IDJH 3UPRB 3MC0A 4DFIA 5ITFA 3W0WA 4KKCC 1CDCA 1R3KB 1J5OL 5LXVA 3UYOD 5FHAH 2C34A 3KXFD 2AJXL 3H8NA 4GQZA 1C16A 4ZXBD 2Z65C 1ITCA 1UD6A 4G9FE 4YXLH 1JGLL 3MYZA 4ODBD 4GXFA 3NACL 1GHFH 1MRFL 1X5YA 3DHMA 3ZRFC 4LOUC 5DD3H 1JSYA 1EGJH 1QRNB 5FYJH 4ZJ9A 5AAMA 5I30H 1JTPA 3FRPA 3ARFB 4PRPE 1KT2B 3KPRB 3FB6A 1I82A 4JY5L 4HIHB 2ATPA 3WN5B 5GGRB 1SNRA 1FJ1A 2BY2A 5CP3H 4NUQA 1CDIA 5GGRA 4IKIA 2XVLA 2EVGA 4DZ8B 3MSPA 3KPLA 4WFHE 3T08A 4DN3L 1IE4A 3K8KA 2FATH 3QUYB 2P43B 2A6IB 4HWBH 4ZK8A 4RMRA 5F7BA 4PGEA 4ZMPA 1OKEA 2ZOUA 4Y5YC 1H9VA 3W81A 1NMCB 3GM0A 2NZIA 1WH0A 4NRZB 3CHRA 1M1SA 1RU9L 2B1OA 2UUDK 4S1DD 4Y2DA 5IHHA 5GRZA 4N8VB 4U1KA 4FQCL 2R2HB 3WMSA 1MJUH 3VTAA 3C9NB 5CR8A 4AJWA 3O2DA 4UQBA 1KCLA 1R5IB 1RY7B 2XA8L 3BMWA 3VFNB 1ZSHA 4I3RL 2LGNA 1J5DA 4BRVA 5D7IE 3QRGH 4GSDH 3BPOC 2Y72A 4AOFA 5I24A 5A40E 4HU2A 3CAFA 2UZYA 4AEFA 3T1WA 2K0RA 1HI6B 3GXPA 3H54A 5IEHB 4L29B 2QKIC 1KLFB 3ATEA 4EXKA 4L29A 1RMFL 5IW3A 2FBOJ 4L1BA 1XF2B 4MQSB 3CFKB 3RILA 5D7SH 5AZ2L 4ACTA 4MJ5B 2V9UA 2X4SA 3KD4A 3P54A 4AZUA 1NEPA 2CIKA 4ELME 3HAEH 4C58B 5DJ8A 43C9A 1XSIA 2DWEA 2P5WB 3JV6B 1UACH 2Z8VC 1EFXD 4QRUB 2X6CA 1OAQL 4JR9L 3Q2NA 1O6TA 4WI4A 3N0AA 2W1NA 3CE1A 4XGZB 3PQYA 3DUUA 4F7PA 5I6XB 1PCSA 3EIFA 3VTMA 5HYJB 1XV8A 3BXNB 4K5LA 4WTXA 4R4ND 1QWNA 2ZOTA 4Y1AB 2NR6D 3O0RH 3BWZA 4YX2L 4IKLA 1UYWL 3ZMRA 3TJEH 5I17B 2YIHA 3R0NA 5EF1A 3QJUB 1MCNA 5B4MC 2APVA 3EG9A 1AP2B 4GQ9H 3EFOB 2XTJE 4GW1B 1C12A 4L8BA 4ZNEA 3BISA 3HCVB 3N85H 3QARA 1S9KC 5D5ME 2SEBB 2B2XL 1UUSA 2DYPB 2F18A 3K81A 3T9WA 1QP1A 4G9FB 4AMKL 5GSRB 4K7PY 4P2YA 3TFKD 3LV3A 1GGTA 2WXRA 5IF0B 3WNMA 3WTWA 2R23A 1ZJAA 4BSWA 1EDHA 1UWGL 1DVFB 3FT3B 4HOXA 1M53A 3SOBH 2YUWA 2YUVA 2H2SC 2ENQA 3KYOA 5E6IB 3WHXB 4X4MA 3MGOB 2B5IB 4AYFB 4OI8A 4DZBA 4PN6A 1DBAH 3TJHD 2YPVL 5FDYA 1T6WA 4I5BA 1G5GA 4P4RA 4MJHA 4LSVH 1AANA 1O6VA 3MJ7A 3MJ8A 1NBZA 1OGSA 3RTQA 2XNAA 1O7DE 3CLFL 4Y8DC 3L3JB 3B56A 1QFWH 3OLDA 1XGZA 3D07A 3KPRE 4Z1PA 4ZFFB 1FAKT 1OLLA 3VWKC 1ZDSA 5FK9B 4KJWD 2IALA 3GLEA 3GSQA 4OLUL 3UMTA 2BSED 4OIFA 5ALCL 1I8IA 2Q8AH 1CGVA 4NO5B 3UGEA 2JKIS 1KNOA 4IU3A 1K85A 1XWVA 2OLDA 3QIBD 5IVXB 4GI8A 3UDWA 4NBXB 1JVLA 2YARA 3FN0L 3VMOA 1U42A 3UO1L 2O6EA 3GXTA 3R06B 5DUBB 2DL2A 4U0QB 5LBGA 2C9XA 2AP2A 5GRVL 2Q86B 2LFGA 3U0TA 1X44A 2YSTA 2IMNA 3Q48A 4LLVB 3ATFA 3X12B 5F6IB 1X5KA 3X12A 4A7QA 3O45B 5JYMA 4B9FA 1QSFE 2V2WA 5JIKA 3QISA 4R4BB 3S4SA 4PRHD 1BBDH 1CF8H 2V2XB 1LQSR 4UV7L 4FKHA 1HNYA 1H6UA 1ZDQA 3OPZH 3QJVB 4AIOA 2ERJB 4UDUA 5EZJB 4OZFA 3KWUA 2CK0H 5KVMC 1GKEA 3B6SA 4HJ0C 5CLTA 5EZJA 5C0AA 5SX4H 2OW7A 3AQYA 2NY1B 1PX8A 2XN9D 2DQTL 4KO6A 1BIIA 3NFSL 1V3JA 2XWBB 1F4YH 1KZQA 1IGCH 5J1SC 4IOFD 5L0QB 5A6IA 4FQLH 4LAQH 4WU7A 2W9DL 2PTUA 2MCMA 3VE0A 4W9FC 2WLIB 2F7QA 4N2DA 2BHZA 4OFQA 5F72S 2YBRB 3O3UN 4NRXB 2F54B 4PJXE 2EE2A 3Q5OA 4Q56A 4GKNA 3US0A 4QHUA 3L08A 5HI3C 3UJJL 1UA7A 2A6KA 3K6FA 4HWUA 5JUEH 2HTLC 4UIMA 3RRQA 5KSVA 3QEUB 5F7NC 5F2FA 2BNRB 3VO0A 2X5PA 3GSNH 4K8RC 3MLYH 3QNZB 3HI1A 3QUZC 3B43A 1VGEH 4NO3B 1DQML 2OMUB 4FLRA 5HGGS 3IJSA 4BH7B 3T04D 2ZXBA 3JUZA 1AGEA 3KYMB 4ZTPL 4KJQC 1F41A 4APQA 2HRLA 3U7YL 1NEUA 3WY1A 2GIMA 3ZSTA 3WFDH 3TNMA 4UTBL 1UD3A 4Z7UA 3JWNC 3AWFA 1VA9A 1MELA 4LARH 2AK1H 2CBOA 6PCYA 3G5VB 1JPTL 2CJUH 2DQDH 3SD5A 3UTZB 3NJHA 2WQUA 5F93C 1CFQB 3T2NL 4GRLA 5ILTH 1KXTA 1Z6JT 3IN2A 2M83A 4FQ1H 2CIIB 1CIUA 1TQSA 3MRIA 2BNUA 1S7TA 4U33A 1FWXA 3EJCA 3Q8AA 1MRCH 5HD8C 4ETQB 2NSQA 3D4YA 4G82A 4MJIE 3T4YA 3RIKA 3ARFD 2OMTB 5HHOB 2Z7ZA 2D2OA 5ICXB 1OE1A 4HUWB 3Q6GH 1WA1X 4NWUL 4GP4B 3IDMA 1CVRA 2YZ8A 4W9EC 5IHUL 5JHBA 1N2RA 3IM1A 2M1KA 4EKXA 3ARBD 3T0EC 4Z7QE 4PJIE 2PO6A 4NZDA 4FXGC 4JJHA 4UTCA 4FFVD 2XWJB 5GRJH 3VFPB 1FQ9C 3SZ6A 2BFGA 4X5PA 1FNAA 2C4FT 5CS7A 3N2JA 1F6AB 3GZQA 4KI5C 3WBDA 2JQZA 1REIA 4M1CD 2FIKB 1CGTA 2YKLH 1IT9H 3TP4A 1SEQH 3SDYL 3K80A 3FO2B 2CD0A 4BSVB 4CVUA 3G5WA 2R1YA 5H35A 4FI7A 1CLYL 1CUOA 1IC0A 5CEXA 4XOAA 2DIEA 3L4UA 3CHQA 3RUGF 4WY7L 4OLYH 4UAHA 1N8OE 2ZCLL 1BSIA 5D71H 5E7BA 2IXQB 3BP4B 1F8TH 5EULV 2ZJSL 5DD1L 3MV9D 1B0WA 4Q9RL 4BELD 2H26A 4JS7A 5LAXB 1ET7A 1AXIB 2PYEB 1C08B 1WQVT 4PJGA 3MVSA 3KYKH 3BVVA 5CJ8A 3QVAA 5T1LD 3W2DL 3DUSA 3G08B 3V55A 4L1SA 4YS4A 5J1TC 1B9KA 3IN0A 2WXIA 4L8SB 1NFKA 4GMSL 4K23L 4LHQB 4AVJA 7FABH 4G6FD 3MJ9A 1P7QA 1XF4A 5TF1L 3IMSA 1ZT7A 3E6FA 4NC2B 5E51A 5L6YL 2X0UA 1L9OA 1LMKA 4M6NL 3U4BL 1THAA 3HC4H 3HIZA 3VI4E 4TNEA 4CC4A 4EI5A 4L1LA 4ZMYA 2I5YH 5KSAB 3JV5A 5GGTH 2VR4A 4NO0A 1FIGL 2VRKA 4E41B 5H37G 1GC1H 4NO0B 1V7NH 4NNPH 5F1IA 2CBPA 2B9BA 1A7OH 4QTIL 3ZL2A 3TEZA 5HGBB 2WQAA 2ITDA 2NX5A 1LE9A 3CFKA 1GZPB 3W37A 1QLFB 1OD7A 2ZSWB 5IY5B 4YO0A 3QDMB 4ELDA 3GI8H 3U6XA 4MWFA 1CGYA 2WB1A 2EIZB 3I6GA 5EEVA 3DMMA 5FW7A 1TTRA 1GGBH 3C09B 1OTTC 3MUJA 4HWEL 5E08L 1ORSA 3FTVA 3UEQA 1LD9A 1OY3B 2YMXH 1BZ7A 5LG6A 1N9PA 4G7QB 4UI2A 4HGKC 3F58L 4GEIA 3R19A 3EYFB 2OFQA 3VWKB 1ROCA 3WO3B 1U9KA 3EYFA 3K91A 5D96C 3C2AH 4PJIA 1PZ3A 1MLBB 3DOHA 2C8NA 2MOQA 2VL5B 3QEQB 2OI9C 4Z7AA 2YS4A 5D1ZD 1RHFA 2P24A 4XX1E 5DT1L 1MXGA 1NBCA 2WKOA 3DJ9A 4UDTB 2GTQA 5BXFA 3BWAA 1YEDA 3TTSA 2XHNA 4OZHF 1AE6H 1ACXA 1QSVA 2VLJE 3H4FA 4OSUH 5G4MA 5AD0B 5IF0A 4XOEA 4CC1A 2FX7L 1LL1A 3BDXA 1JAEA 1N8ZB 4GAFB 5IT2H 4NOFA 1UB6B 1W9XA 4ELMA 4QUOA 1D2PA 5L2JB 3V8CA 2OJZL 2F74B 2C3VA 3QI9A 4DEPB 2F74A 3QWRA 2YD7A 3U7WL 4KK6C 2Q2EB 3KLQA 1NAKL 4ZW3A 2FQDA 1KIUB 4YLCA 1YEKH 3S2CA 3GB7A 4EZLA 4P9HC 3DVGB 4GYBA 4G8FB 5J6SA 2EUWA 4NZRL 5KG9B 2VQ4A 5CZXD 3HG0A 1GS6X 3U6XS 4A2HA 2WWMC 3HR5B 4ZQKA 3GBNH 5CINL 2DQHH 2NUTB 2JLLA 2P80D 2H6OA 3QHFL 2HVKB 4P9HH 4ZOEA 3D4ZA 3C60C 2YAOA 2A9DA 1QQDA 3Q6FB 3RU8H 2X6UA 3N41B 1RK0A 4QXWA 5IB3B 4WSKA 2ENYA 1SYSA 1X6LA 3MLZH 1IC1A 3OC8A 1SYSB 2XETA 3LEVL 3SJVD 4X42A 3WIAA 1S2EA 3L4TA 3GRWH 3P4NA 5DO8A 3OMNB 1VB9A 3SHSA 1OCWL 1CICD 2DZEA 1MFVA 3NIDB 1MCKA 2BMKB 3BIKB 1JWSB 3OQRA 4X5WA 4XMKL 5MP6L 1BJ8A 4C47A 1DSFL 2H3KA 2R0LL 2AJZB 2WXJA 3QPXH 1KCKA 5DC0A 3FPYA 3MV7E 4DPRA 2IBGA 3TZVA 3QJXA 1IX2A 4JZNA 3G5XB 4ZO8A 4G72B 5FDWA 5J6GA 1PKOA 4B97A 3ILPA 3WE1A 1H6TA 3H9ZA 3O2WL 4BUGA 5FHBL 2AZUA 4HD9A 3ZO0A 1BVOA 4JPVH 4EI6A 1QNIA 4XBPB 5I1DB 3SO3B 1PZSA 1NGXB 3EOTH 4R0LC 3EH1A 4E9TA 4PGEB 4QXTA 4MLIA 2E9BA 4M93C 4ABUA 5J6HB 4RGND 3DIFA 4HISA 4TSCH 5CMAA 3X1EA 4JFDB 4MJJA 4UINL 3T0EA 4Y5XA 4F9PA 1E6JL 1QFWI 1I4FA 1XX9C 2YAHA 4OI9A 4PV9B 5FIEA 5IMKB 2X0WA 1GHFL 1MRFH 1EJOH 1U6AH 3TURA 5ENWA 1EZUA 4M03A 3D05A 5DFTA 2NY1D 3SGKA 1CQKA 1R46A 1CXIA 5C0BE 1MJJB 4APXA 3MREA 4JKKA 1G43A 2G3MA 1FCGA 3QPKA 4PJIF 2JKNA 3DURB 4OZIF 5FA3A 2VLJB 1JNJA 3N1FC 5CCKH 4TOYL 4I13B 4ODHL 1AR1C 2GAZB 3L3HB 5HYIA 2YWYA 4I48A 1DANU 5KBLA 2HTKD 3MLUL 4YHYB 1HCFX 1AXSB 1FNEA 4X9YA 5DK3A 2YGQA 5JORA 1OB1A 4N90D 1LO5B 1XCQA 3L1OH 5ISZE 1SDDB 3P30H 1N5YL 3DO4A 2AQNA 2N7AA 4E9RA 3LH9A 3GD1C 2RAMA 2A2QT 2WM0A 4FG6D 4HBCL 5KWYC 2ICWJ 3MA7A 4F9LC 2HRPH 4QJ3B 1I53A 4M61A 1OP4A 1OVZA 3QJHA 1P4BH 4I2XA 4KMLB 4M7LT 5ISZA 5C7XL 4ZO7A 1A6WL 3TNNB 3EDDA 4KXZH 3ZDXE 3N44F 1FV1A 2GB2A 1S9XB 4AMXA 4DO4A 5I26A 3QXDA 4I7ZC 3WGUB 1PJ9A 1WBZA 3ROLA 1ODUA 1VFBB 3CFBA 1A4JA 2X7LB 5LGJA 3UJTL 2QFRA 3U36B 4JDVA 1HOCB 1Q0YL 4FFYL 2R23B 3VG0L 1JGEB 2GW5A 3P4LA 4J23A 3CVDA 3EFFB 1C1EH 3HOGA 3ZDYB 4F80A 1PY0A 5HVWA 1WICA 5TE4H 1EO8L 1KIRA 2B1AL 2CR0A 4DF9A 1WE5A 2ADIA 1VACA 3B5TA 5C0GA 3RTQD 5CZVL 3K8LA 5D1XC 4MA3B 3G5ZA 3E1ZA 3POCA 5TDPB 1IFHH 1XCTA 2J1YA 1DQJB 2PR9A 4NC1E 1XMWA 1LO2H 1JTTA 1A7NL 1PD6A 4Y9EA 2W0PA 1F3DJ 2W5PA 1ZHNA 2OMBA 3LEYL 4OZHE 5DJ6B 3ULUD 2VLLB 2DI7A 4OJFL 4WI0B 1YPZA 3MNVA 5D7JC 3O3BB 1NC4B 3FCSB 3ASOB 4YDIH 4ANXA 3QG7H 3TZVD 1CN4A 1HQRB 2J57A 3GJFA 2JJTA 1DBML 1TJHL 1MSPA 5INCB 3T8XB 4GMTL 4X6EA 1DSWA 1FNLA 1DQQA 4LVOB 4PS4H 3QJFA 4U1MA 4RH4A 3FTGA 2CR3A 4ZSOA 3SD2A 4X5RA 4WJG3 1FG9C 3IB4A 4CSSA 4YSSA 4R2GC 4LSVL 3MV7B 4NCDA 3TA3C 4KKQA 3SDCC 4AYID 3RWCA 1Q8MA 1CMOA 3BAEH 4WF7A 3LZRA 2W60A 2XV0A 3EGXA 5E5LA 3OTTA 2QSTA 3ORJA 5CGYD 1M42A 1QFPA 2HJKA 4H8HA 5DMIH 4OZFB 4WUUE 4XCEB 1J0ZA 4UIKL 3MRRB 1U3HA 3FF7A 1WEJL 4I8DA 3QIBB 5EBMA 5SWQB 2VSDA 5I5RA 1VGKA 4YVNA 4XPAL 1P4LB 1EIBA 2D7QA 2JKXA 4M3KB 1FYHB 5EBMB 5SWQA 3IDGB 3KM2A 2G2PA 2UVEA 3Q2LA 1VRSA 2B4CH 1ORSB 2FT7A 2Q7AA 2AXGB 4K8RH 1TYJA 2XWTB 3G3LA 2CM6A 1HTYA 3TBYB 3OWEA 1WGOA 3GBMH 4FDWA 1KXVC 3DX4A 4LIQH 3QEQA 2ZPKL 2FQEA 2NXYB 3X17A 4QD2E 3EGSB 2E8ZA 4WW2B 1KBBA 1U8KB 2OR7A 4UDTA 4ZOAA 4NZUH 2EKJA 3IJSB 4BH7A 2W38A 1RUQL 1TJGH 1UKTA 1K4DA 1J9CT 1JCKA 4AGNA 5C0RL 1VZHA 2YQGA 3DX8A 1MCPL 1HK6A 4NLHA