2A7HA

On the routine use of soft x-rays in macromolecular crystallography, part iii- the optimal data collection wavelength
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a7hA02
2M5TA 2VIVA 2BLQA 2QN5T 4CBOA 3ZZDA 2FOHA 3RXEA 5BPEA 1GHBF 3GCHC 2A2XH 3VGCC 3BG8A 1T8LA 1BTUA 2ALPA 1GWAA 2C3SA 4CHAB 1DLKB 1EASA 1O2XA 2SGPE 4WMEA 5F8ZA 3ZZ7A 4SGBE 2BLOA 3BTDE 1RXPA 4Y7AA 1O3MA 1C5YB 3RC4A 2SFAA 2Y5FA 3IITA 4K3JA 3T62A 4INKA 1HAIH 1W12U 4WJG2 1O3OA 1DITH 3GY3A 2ZNKH 1MKXK 1P09A 4I8KA 1JIRA 3SW2B 1C2DA 4KTSA 3FZZA 5FCKA 3OY6U 1EAWA 5CMXH 1TMTH 4BNRA 5DPAA 2QF0A 2Y7XA 2GV7A 3BIVH 5JBAS 1ZZZA 3TLOA 4A5TS 1GBMA 2QV1A 1MH0A 3O8DA 4NWLA 2P93A 1GBTA 3SUDA 1ZTLA 1GBFA 6GCHG 3BTEE 1LQDB 4JYUH 2GP9B 5AF9H 5TCCA 2Q6FA 2QAAA 1QA7A 2G5NA 1VGCB 3Q3XA 2Z9GA 3KQCA 1EPTB 1EATA 3SHCH 1CHOF 5ETXA 1UTKA 2R3UA 2ZGJA 4YO9A 1MKXH 1SOTA 1OWKA 2PR3A 3PTBA 3MH6A 1LTOA 3ZZ9A 2PKAA 1Y3UA 1XUIA 4F49A 1P12E 2Z9IA 1O3EA 1E35B 4X8UH 5F8XA 1T4UH 5J4SA 3NK8A 4YT7H 2NU0E 2F91A 1Z6EA 7GCHF 1SHYA 1XXFA 3QGNB 3VB7A 1C2HA 1ZRKA 5J4QA 4VGCC 2VGCC 1T8NA 4AG2A 3RUOA 1OP2A 1P05A 2ZPRA 3BEIB 5FX5A 4X2YA 5E0HA 1Z7KA 5DGJA 4AX9H 2CXVA 1BBRK 1TNJA 1QA0A 1UCYK 4Y0YE 4OS2A 1YKTA 3SBKA 1MUEB 3EDXB 1G2LA 1A5HA 4WVPE 4TY6A 1NESE 2RG3A 4CH2B 2Q6GA 3PWCA 2ZDNA 1THSH 4AGKA 1EZSC 3F9GA 3P8GA 2P3FH 1GVKB 1W10U 1YPKH 1QJ1B 1UJ1A 4CHAC 2TBSA 3FP6E 2FI4E 2A31A 1BBRH 3SI4H 5LPRA 2QY0B 2TGTA 3SU3A 1UCYH 1SGDE 3RXHA 4ABDA 1TNHA 4ABHA 3TK9A 2ZU4A 2VIDA 4I8JA 5DP8A 1GJ7B 2A4QA 4DG4A 4B75A 1TQ7B 2FESH 1ABIH 3MH4A 5E2OA 1FI8A 3HGPA 2SGQE 4DIHH 1O2ZA 3LGUA 1LVYA 2W5EA 1DWEH 2PLXA 4GHTA 4XOJA 3DHKH 3PMBB 2B9LA 3VPKA 1CVWH 3GY4A 1Y3XA 1TGNA 2TRMA 3GDUA 1AKSB 1DX5M 4BAMB 3K9XB 1F0UA 1KDQB 3GCNA 1DT2A 1T32A 4Z0KA 2BD2A 1S5SA 1QGFA 1N6XA 3PLPA 4B76A 2FPZA 1BTYA 3F6UH 2SNWA 1YC0A 1Z8GA 2PWXA 3FVFB 1PPGE 1NRSH 1C1WH 2ANWA 1BTZA 1Y59T 2IOTA 1B0FA 3RU4E 2AIPA 4NGAH 1C5VA 2C4FH 2HRVA 1Q3XA 3SNBA 1ETRH 1OWJA 2OC1A 1KY9A 1DLEA 5DG6A 2CN0H 2K1QA 4AB8A 1EB1H 1EZXC 1NRRH 1O3FA 2BDHA 1GL0E 3TNSA 4B2BA 2FIRH 3STIA 1O3BA 3GCTG 1WCZA 3BIUH 1GMDF 5F8TA 1O2NA 4U30A 1JMOH 2NWNA 4IN1A 1J15A 1NZQH 5EODA 1DFPA 2WPKS 1GL1A 4UONA 3V0XA 1VCWA 2A7CA 1FIWA 3BEUA 1S85A 1UTNA 1QB1A 1GCTC 2HNTC 3RXSA 3A84A 2KAIA 4HZHA 2HLCA 1GDNA 3M7UA 1C2JA 4K5ZA 5PTPA 3U1JB 4Y10E 4BOHA 2F9PA 1SGYE 1QHRB 5C1YA 1YLCA 1OWDA 3RXBA 1BHXB 2F9VA 1DXPA 3W94A 2PGBB 1SGFA 1PQ7A 2ZTXA 3HK3B 4WWYA 3D49H 1OOKB 1C1UH 3I77A 2SGDE 1LCYA 2AERH 1RGQA 1SQTA 5DP7A 2GD4B 5FCRA 1UTJA 1GJ9B 1SLWB 2GCHF 1JIMA 1E0FD 3VFEA 3TIUA 1AZ8A 1CBWB 3FZDA 5G4BA 2P3UB 1XM1A 4DIIH 5A0CA 1FZZA 3EYDA 2P8OB 2V6NA 1ZLRA 4R0IA 3DUXH 1BDAA 1L4DA 4GCHG 2ZGCA 2FEQH 2HWLB 4H4FA 4CRFA 1V2VT 5EQSA 1LHDH 3U1IB 2CV3A 2VNTA 4BAKB 2GCTC 3QTVH 1UHBA 4OS6A 3A80A 4ZHAA 5GJ4B 1VJ9U 1U6QA 2ZTZA 1NPMA 1FIZA 2GZ7A 1BOQA 1O3IA 1EP6A 4X8SH 2Q6DA 2VWOA 1V2TT 1CO7E 1ETTH 1WTHD 2AS9A 2QXHA 2VVCA 3MU1A 1QQUA 4U32A 2H9EH 1YPGH 1EB2A 2QGRA 3SJOA 1A46H 2NU4E 1LHCH 1TAWA 4X6MA 4ISNA 2RA0A 2A45B 3D65E 4DGJA 3Q77A 4WMDA 1KLIH 1FY3A 1F5RA 1YCPK 1C5PA 3A7XA 3BV9B 3STJA 1ZGIA 1SGCA 1EP5A 4JK6A 4Y11E 1OWEA 4IC6A 1LMWB 1C2FA 2Y80A 1QL9A 1VJAU 3A87A 1HJAB 3ESTA 1TQ0B 5AVDA 1V2UT 3M5NA 3SUGA 1P2JA 4DY7B 4ZROA 2YNBA 4AGJA 2A2QH 1TNGA 2W3IA 1CT4E 3SJKA 3F68H 3PWBA 1TABE 5T3HA 3SV6A 1FQ3A 1P03A 1YCPH 3KCGH 3Q76A 4XBBA 2LNCA 3UWJH 1EAXA 1XUGA 2A7HA 1F0TA 3M5MA 5LH8A 1XMNB 4ZKOU 3TK5A 5CHAC 4ABGA 4R8TB 4ABIA 1P04A 4WXIA 1HXEH 4WH6A 2XYAA 3T2NA 2Y81A 1H1BA 3CP7A 2XBWA 2TIOA 6LPRA 3M3SA 1MBMA 4I32A 1LKAA 2ZHWH 1EAIA 1XUJA 1ELEE 5C2ZA 1UK4A 3RXGA 2AMDA 4JYTA 1O2MA 4AZ2B 1XKAC 4B2CA 4KP0A 1C2IA 1MTVA 3P8FA 5JBBS 2PUXB 3VXEH 3SUEA 2FWWA 4DVAU 1CBWC 3SGBE 1YM0A 2BYAX 1DY8A 5EXMA 3U9AH 2FP7B 4Y79A 1MZAA 4ZHLU 2XWAA 3AW1A 3NPSA 2F9UA 3M35A 8GCHG 3RXUA 2D8WA 2OD3B 1NU7B 3KQBA 2GMTC 2GZ9A 1GI4A 2D26C 1ELFA 1C1SA 4NIXA 1NRPH 2GX4A 4FVDA 1EOJA 1S0QA 1GMCG 3SORA 1NROH 3L33A 3UR6A 1SLUB 2A5AA 4A1VA 1GBEA 4H6SB 3EA9A 4Y8ZA 1O3GA 3SJIA 5EPNA 2I6SA 1C5TA 2C8XB 1O2WA 2FI5E 2XBXA 2CMYA 2Z9LA 1HAVA 1XVMA 3QTOH 2AGEX 3BTQE 3RP2A 3ENSB 1P8VC 1BRUP 9ESTA 5HXFA 2VIPA 4YT6H 1QFKH 3E0NB 1D6WA 1MQ6A 4B71A 1UTMA 1VITF 2J95A 2DE9A 2PTCE 2XCNA 1YP9A 1K1PA 1Z6JH 3MNXA 4ZXYH 1Q2WA 2ZCHP 4CRBA 1FDPA 3M3VA 3QDZB 1DUAA 2ZGHA 4CBNA 1ZHPA 1ZR0A 5EGMA 4E06H 3VB6A 2HPQH 2H9TH 3SHAH 2IJOB 5T6GA 1P02A 2GGVB 1BIOA 3PTNA 2R2MB 4NCYA 4J2YB 1P2OA 4WF8A 3T25A 4KTUA 3SU5A 4MVNA 1ACBE 4RSPA 3D62A 1HBTH 3FFGA 1AMHA 1NRNH 3P6ZB 1RTKA 3DA9B 4CRGA 1PYTD 3KF2A 1C5MD 2BQWB 1GG6C 2BQ7B 1V2JT 2WINI 3TGKE 3U69H 4HI3A 2BTCE 1H9LB 1OS8A 1GJBB 1DWCH 1ANEA 1KYNA 1G9IE 4LZ4B 4WMFA 3N7OA 1EZUC 5FX6A 3M36A 3MU8A 2PFEA 3GYMA 1M9UA 2BX4A 2XNIA 2PKAB 4BTIB 3F9FA 1GHBG 2AEIH 1QCPA 2PV9B 3SU2A 4FUHA 1V3XA 2JH0D 1AFQC 1IQHA 3BG4B 2A5IA 1L1GA 2Z3CA 3ATKA 1AUTC 4AFQA 3EE0B 4AN7A 1AD8H 1YPMH 3A85A 5A8YA 2AMQA 4FVBA 1MCTA 4WXVA 3ZV8A 1E37B 1JBUH 2ZF0H 4D76A 1WSSH 2FZZA 1Z1JA 3B9FH 3BEFB 4Y6DA 3SQHE 4PROA 1MKWK 1PQ8A 2UWLA 1A3EH 4NA8A 1SG8B 2BY7X 2ZKSA 3SNEA 5FXLA 3GDVA 1JWTA 2BQ6B 3OU0A 5GXPA 1SFIA 1C1PA 1QQ4A 1OYTH 1IQLA 1LPGB 1AO5A 1BHXF 3RXQA 1GBHA 1GI6A 1O34A 3ZVEA 1S83A 2V3HH 5LPEA 4X6NA 2NU1E 4A1TA 2BY9X 4Q7ZA 4OS7A 1CHOG 2VINA 1BTWA 2ZCLP 1AE5A 1O3LA 4B1TA 4ZKRU 1MKWH 3SN8A 3Q3KA 3RXJA 2QYIA 1O2YA 1D3DB 4UEHH 1FUJA 2FI3E 1W8BH 2EI7A 2ZTYA 1QBOA 1LDTT 3NUMA 5L30H 3SGQE 2O8UA 1MTNC 2P59A 1OXGA 4UD9H 2FOBA 2PUQH 7GCHG 1P2IA 4Q7XA 1C4Y2 2BY8X 1FONA 1PPZA 1WQSA 1ELVA 1QB9A 1FY5A 3AAUA 2OBOA 4K8YA 2G8TA 4THNH 4YESB 2BB4A 1C5XB 1K2I1 2ZC9H 2A7JA 2XC0A 3HATH 1NFYA 3ZZBA 2SGEE 1O2IA 1O0DH 2J92A 1KTTB 3IWMA 1C1QA 1GHYH 2BY6X 5DO4H 1C2GA 5DKMA 4D9RA 2OCVB 5HGGA 4K69A 3PLBA 1UO6A 1EX3A 1SMFE 5T6FA 1F0RA 4Y7BA 1MAXA 4JZFH 1B7XB 2AIQA 1HIAA 3R0FA 1B0EA 1EQ9A 1INCA 1P9SA 1Z8RA 3M61U 3PB1E 4NFFA 1O31A 5EXNA 2Z7FE 3UNSA 3CS0A 1O2JA 4MNVA 1NM6A 2BD7A 1ZRBA 1C5LH 3W95A 3M7TA 4D7GA 1ID5H 3MTYA 3RXPA 1HAOH 4MDSA 3E3TA 6ESTA 2VB0A 1C5NH 1PFXC 2QIQA 5E0GA 4X8VH 3RC6A 1SOZA 2H9HA 2XCFA 2JH5D 3PROA 6CHAB 5FPSA 1FLEE 1TGSZ 4AFSA 1HB0B 1ANCA 4NFEA 2KAIB 3ZVFA 1ZMLA 4O9VA 3SNCA 5F6MA 1GI8B 1HAZB 3K65B 1K1IA 3E1XB 2FYRA 3NKKA 5AFZH 1MTWA 3RXLA 5JB9S 3SI3H 1JOUB 2JETC 1PJPA 1KLTA 1ZTKA 1W0ZU 1OPHB 4X1RU 1LPKB 2WYJA 2H2ZA 1CGHA 1V2LT 3OX7U 2G81E 2A4OA 4QT8C 5EW2H 1MTUA 4I8LA 3MU5A 2RCEA 1FPHH 3UPEA 1KXBA 3AVZA 1C5UA 3P70B 1HUTH 1N8OB 4ABFA 1EJMA 4LXBH 4GAWA 1E34B 1TBRH 2ZI2H 4TYDA 2FOGA 4XE4A 2BD3A 1HGTH 4XBCA 1MCVA 2VIQA 1YPJH 1AE8H 2BMGB 2A0QB 1Z8IB 2BHGA 4I8HA 3UNQA 2PSXA 1ELCA 1N1LA 4AOQA 3RXMA 4FXGH 5DK1A 1GMDG 2AGIX 4RN6A 3PYHA 3A7VA 1P3EA 4XDEA 3OTJE 1ZMNA 4I33A 1IAUA 1N6YA 3UNRA 1UHBB 2SNVA 3UY9A 3ATIA 3M5OA 1EAUA 3RXFA 1O2UA 4FUBA 2ZU1A 5SGAE 2F83A 2JH6D 3LC5A 1AZZA 3ZVBA 1NFXA 1J16A 2ULLA 2XWBI 2YOLA 1KTSB 1GJDB 4KELA 1AWFH 4MPVA 1VGCC 1C4V2 3P17H 1L4ZA 2Y7ZA 1EPTC 3V7TA 3JZ2B 2B7DH 1SC8U 4ZMAH 1TNKA 2C8YB 3RU4T 1S84A 2BDCA 1O3CA 2J4IA 1GI0A 3S7KB 4D9QA 1D3TB 1TYNA 1K21H 1DANH 1XUHA 2ZDAH 5JPMH 2XC5A 2ZG0H 2GCHG 4IMZA 3RM0H 2FXRA 1V6DA 1O2RA 1G3DA 3E16B 4JMYA 1AB9B 4ASHA 4BAHB 2OBQA 2ODPA 2PW8H 1O30A 1MU6B 3AASA 1H8IH 2BVSH 4FUGA 1QTFA 1TRYA 1BCUH 2FMJA 2ZZUH 1D4PB 5A2MH 2PGQB 2WUCA 3RXKA 1T31A 1C9TA 2A32A 1GHZA 1L1JA 1D9IA 1O2SA 4E7RG 1SHHB 1L2EA 2RA3A 3L3TA 1ANDA 3LIWA 1G32B 5H4IB 2W3KA 4AG1A 2G4TA 2HALA 1FPCH 3QN7A 4FUDA 2EA3A 1ARCA 1O3JA 5A8XA 3I78A 2ZCKP 4XFQA 1BT7A 2AH4X 2TGAA 1O2KA 2STBE 4JZEH 1A1RA 2VU8E 1AIXH 1HLTH 3ZV9A 4B73A 3JZ1B 1N8OC 2I6QA 2XW9A 1ESAA 5C20A 3RU4D 4IW4E 1J17T 3NWUA 4D7FA 2OINA 4O3TA 1LQEA 1TPSA 2THFB 4INLA 1Z71A 4BAQB 1V2RT 1ELGA 2FLRH 4Y71A 1V2QT 5JBTA 2WPJS 1P06A 4HTCH 1T7CA 1GHVH 1C1TA 2PKSB 5EU8A 1DSUA 3V13A 3G01A 3GY6A 1BMNH 1QNJA 4FU8A 4X2WA 1DSTA 1DY9A 4E7NA 2STAE 1AGJA 5EG4A 1WQVH 5FAHA 1AQ7A 2ZU3A 3C1KA 3ODFA 1CT2E 1PQAA 2O8TA 4Y8YA 4CREA 2ODYB 2R9PA 1RTFB 1YPLH 1K1MA 3BN9A 1O2GH 1IQMA 4IS5A 4YLUA 1H9HE 3SZNA 5JBCS 4CRAA 1MAYA 4YM9A 1A2CH 1HAVB 2CHAB 2WYGA 4GLYA 1L1NA 2O8MA 4A6LA 2NU3E 4FUJA 3SNAA 4NIYA 1Y5BT 1ZOMA 1H9IE 4I31A 1YBWA 2FOEA 2UWPA 1QRZA 1SGIB 1TGCA 1IQJA 1VCPA 5ESTE 4X2VA 4IC5A 1TNLA 1FMGA 2C8WB 3QGJA 1TOMH 2XBYA 2XXLA 3A8DA 1UTOA 3KEEA 4K1EA 5C1UA 2R0KA 3CENA 2XRCA 1ZPCA 5GCHF 1HV7A 3ZZ4A 3ELAH 4YOIA 1GCDA 1O2QA 3TJUA 1AB9C 4AORA 1OP0A 1ZTJA 4FUFA 1TRNA 3D23A 1HAYB 4U2WA 5FPTA 4CH8B 4IGDA 1TFXA 5JYIA 2ZEBA 1DUEA 3BTGE 1DPOA 4OGXA 3PO1B 1ZMJA 3RXOA 4NA7A 4YOJA 1HAPH 1QY6A 2Z9KA 3BTTE 3HPTB 4TWYA 3RLYH 1IOEA 1NN6A 3KL6A 1SLXB 3RC5A 1TGBA 4OS1A 1WBGB 1FY1A 2ZPQA 1WOFA 3BTWE 3P8OA 1BRBE 2SGAA 3TH3H 2LPRA 1C1NA 4XBDA 4E05H 3QZRA 1GBKA 1IQNA 4BAOB 4UFGH 1FY4A 1THRH 1YPHC 1O2VA 1GGDB 3BTME 3E0PB 4BTUB 5C5NA 1EJNA 1SGFG 1C5QA 1GHAF 4AYVB 3ZVGA 4LZ1H 1TALA 1OSSA 5IYTA 1Y3WA 2GT8A 1RJXB 2FOCA 1A0HB 1QRXA 2H5DA 3A82A 3DFLA 1O5DH 3HGNA 1O32A 1TBQH 4MPWA 1GMHF 1VITG 2P8OC 3TITA 2ZFPH 3BTHE 1O3KA 2Z94A 3SUFA 1CA0B 1F2SE 2EI6A 1BBRE 1HXFH 3MH7A 2BDGA 4MNWA 1BUIA 1UCYE 3OSYA 1BJVA 1O3PB 3DD2H 1MQ5A 4MLFB 1DVAH 2DUCA 1QB6A 5BRRE 2FTLE 4JYVH 1A7SA 2J9NA 2BD4A 4Y0ZE 2PHBA 1UMAH 1XXDA 1O35A 3MYWA 3V3MA 1F0SA 2ZPSA 3PM3A 4OS4A 3A89A 1TX7A 3VXFH 3P8NA 2CHAC 1PPFE 1GJCB 1RTLA 3QZQA 3A8BA 1TMBH 3F9EA 3UR9A 5AHGH 3MH5A 1A4WH 2GT7A 3AAVA 4IN2A 2ZQ1A 2H1UA 1OWHA 2F9NA 1GBDA 1AVGH 1MD8A 2P16A 1VCQA 3GCHB 3TJNA 1BRAA 1CU1A 3VGCB 2QXGA 1ZJDA 1GDQA 1HJAC 2BLWA 2NU2E 3GDSA 2B0FA 2Y82A 1W11U 2BOKA 2CF9H 1C1VH 5DP3A 3KQEA 3TH2H 2ZHQH 5I46H 3RXDA 3ATWA 3SU4A 2EC9H 1VITH 1QBVH 1UVUH 4CRCA 1HAGE 1NTPA 1SGTA 3PO1C 3GY5A 1H8DH 4MG3A 1MMJN 2ZU2A 2WPMS 3I29A 1UVPA 1GJ4H 4CR9A 2FODA 1RRKA 1C5OH 4FUEA 4Z6AH 1JXPA 3MO6A 4X1QU 1EZQA 3F9HA 2GV6A 1HYLA 4HFPB 2Q1JA 1TA2A 3KHVA 5L2YH 5AFYH 1SL3A 3A7YA 3RXVA 3LGVA 1AFEH 3OYPA 2ZDLA 4RKJB 1HIAB 2OUAA 2VH0A 1TIOA 3RMLH 2PTNA 5GDSH 3RXIA 4ZKNU 1YYY1 1J14A 1TNIA 5FHTA 3UFAA 3QO6A 1DXWA 4BXSA 1FAXA 1F92A 4IBLH 1FJSA 3SU0A 3SQEE 1AUJA 1O2LA 3A7TA 4GSOA 1AN1E 3EQ0H 3HKIB 4UDWH 3BF6H 1GJ5H 2O8LA 1QR3E 1S0RA 4X1PU 4K2YA 3QWCH 3UREA 1UTQA 1XUFA 3KIDU 2QF3A 3ODDA 1DE7H 3SNDA 5GWZA 2OTVA 1C2MA 1LVBA 1IQEA 2D1JA 3PV4A 4M7GA 1P2MA 3EAJA 4ABEA 1L0ZA 2ZFSA 1LVMA 3T27A 1LVOA 3MNBA 2FYQA 2AGGX 3S9AA 3RMNH 4DT7B 5C5OA 2OC0A 4TPYA 3P92A 4DCDA 2HGTH 3ZZ6A 2ZO3H 1W2KH 4Q80A 3UQVA 5L6NH 2VIWA 2BD9A 3C27B 2A4GA 4Q2KA 1Y3VA 1WAYB 1NT1A 2FDAA 3HKJB 3T26A 4O3UA 2ILNA 2EEKA 3SGAE 2J34A 1TONA 4ZXXH 2G51A 5GIBA 2ZIQH 1CQQA 2R2WU 1E38B 2ZHDA 2VWLA 4KKDA 1TX8A 1C9PA 2G4UA 2G00A 1DM4B 4A1XA 2BVXH 1P10A 5EQQA 3FP7E 2VWNA 4Y76A 4AB9A 1AU8A 3NXPA 1NC6A 1BJUA 1O3AA 1D6RA 1NFWA 3M5LA 2DE8A 1ESBA 2BDBA 1SGQE 1ZPBA 3PMAB 2ZDMA 4IMQA 4OS5A 3RMOH 4AFUA 3S9BA 3LH3A 3GCOA 2ESTE 3QX5H 1HJ8A 1BITA 2BD8A 3MO9A 1S6HA 1ZGVA 1UK3A 1GJ8B 1HFDA 3MOCA 3U8OH 1MBQA 1EJAA 3MO3A 1CGIE 1NU9A 1T4VH 3AW0A 4Q7YA 3B8JA 3UOUA 5ABWA 3KNXA 1J9CH 3T28A 1NRQH 1ARBA 3M7QA 2G55A 1C5SA 2ALVA 5GPIB 1SGNE 4JK5A 1FV9A 1P2KA 4WH8A 1SI5H 3BTKE 4YLQH 3LGYA 1GI5A 2BDAA 2W7UA 1CT0E 1OP8A 1SBWA 4X8TH 1HRTH 1AVXA 2WPLS 3P95A 1UVOA 3BG4C 1TMUH 4J1YA 4MNXA 4XSKU 3QLPH 2BXUH 2G5VA 1PPEE 3LT3A 3ZZAA 1JRSA 2ZFQH 1W3CA 4LK4A 1GVZA 1SFQB 1YCPM 2ZA5A 3R3GB 1AHTH 3SJ8A 1A5GH 2SGFE 4ZAEA 1IHSH 1AVWA 1WV7H 4D8NA 3T29A 1KSNA 2IN2A 3ZVDA 5JDUB 2BD5A 3F1SB 1Y8TA 1SQOA 1GHWH 1MU8B 5L2ZH 2ZGXH 1LHFH 2UWOA 2GKVE 1FN8A 3VB3A 3UOPA 4KGAA 5HMAA 1A0JA 2BY5X 1GBBA 1IHTH 1GCTB 2A5KA 5A0BA 1TRMA 1GI1A 4GVUA 6GCHF 5FBIA 1O5EH 5F03A 2V3OH 4ZH8A 4GHQA 1J8AA 4BTTB 3VEQB 1C1OA 4H42U 3L6PA 3EGKH 4I8GA 1Y5AT 3MMGA 1MTSA 1TA6A 1VZQH 1GBLA 3TH4H 2ZP0H 3SO3A 5K7RA 1UTPA 3MI4A 1K22H 5T6DA 5TCAA 2P3TB 1YLDA 3OY5U 1TBZH 4MNYA 3LKWA 3BSQA 1V2MT 8LPRA 3PMJA 2CGAA 2ANKH 2HNTE 1BA8B 1S6FA 2V35A 2Z6BD 1P9UA 4JZIA 3URCA 3E6PH 4NZLA 1TPAE 1CSOE 1C1RA 3ATLA 3DT0H 2C93B 3QUMP 4MTBA 1YF4A 3T5FH 1NY22 2ZDKA 5EQRA 3RXTA 1GI7B 1K9OE 3LGWA 4X6PA 2HOBA 2ZECA 3LONA 2WV5A 3LH1A 4ISIH 1V2PT 1DDJA 1O5CB 2FS8A 1QL7A 4MQAA 1ZSLA 5EXLA 1O2TA 4NZQA 3RM2H 4GPGA 4ESTE 3TU7H 2WUBA 2ZFFH 5B6OA 2WPHS 2FX4A 2OP9A 2GCTB 3FANA 4NSYA 1NO9H 3NZIA 1C1MA 1K28D 1TOCB 1WUNH 1YGCH 3CS7A 5HYOA 1P3CA 1TE0A 1W13U 1HAHH 2OLGA 1BQYA 4H6TA 1ELDE 2VVUA 1C4U2 1V2ST 3LGTA 3U8TH 1EPTA 3A7ZA 3PMHB 3K6ZA 1SR5C 3TVJB 3SOSA 1ZJKA 3UTUH 2A1DB 4FUCA 1MZDA 1O5AB 4Y8XA 1P2QA 3H7OA 2OQUA 1KXCA 1CA8B 5E8EH 1GDUA 2J94A 4UFEH 3SU1A 4YTAA 1O2HA 2ZWLH 3ZVAA 2BZAA 6CHAC 1GBIA 1EXFA 2OC8A 1CHGA 3A86A 4BXWA 1SPJA 5FBEA 4ABBA 2BVRH 1D3PB 4ZKSU 3TPIZ 2FOFA 4I7YH 1TX6A 5LPFA 3FP8E 1NFUA 1V2KT 4NIVA 1DICA 1HAXB 3RDZA 4TY7A 1FAKH 1TB6H 4ZHMU 5HM2A 3SV7A 5K0HA 1ELAA 1G37A 2VJ1A 1GPZA 1K1OA 4OGYA 3ZZ3A 1C5RA 4TPIZ 3GICB 2C8ZB 3UQOA 1IQFA 4NWKA 1W7XH 2UUKB 1ELTA 1ESTA 5EW1H 1KXDA 3GOVB 2TGPZ 2UUFB 1G3BA 1K1LA 1THPB 1DWDH 5CHAB 1RIWB 1CE5A 3S9CA 1Q31A 3LOXA 3MWIU 2FLBH 4KTCA 1W0YH 2BOHB 3TK6A 1D3QB 1DWBH 1QIXB 1UK2A 2IPHA 1CGJE 2J2UA 4X1NU 4A7IB 1DS2E 1GBJA 1TPPA 4YZUA 2FOAA 1TWXB 7LPRA 5A0AE 5E2PA 1OYQA 1EKBB 3S7HB 3LPRA 1FNIA 3GCTF 1QL8A 1QJ6B 1G30B 5GCHG 1BTXA 1A5IA 4ISHH 2ZQ2A 1TLDA 2ZHEH 1RFNA 4ABAA 1K1JA 1GI9B 1O39A 1EOLA 2C90B 1LO6A 2W26A 1O5FH 4A92A 1LPZB 2BM2A 3RLWH 3VB4A 3Q00A 1S82A 1WYKA 2F3CE 1A0LA 2V0BA 1YPHE 3EA7A 4MPUA 4UE7H 4B74A 5A09A 1E36B 2GMTB 3LU9B 1SLVB 3ATMA 2VIOA 1O2OA 1P11E 2TPIZ 2BZ6H 5C1XA 1QBNA 1F5KU 4HGCA 2CJIA 3S69A 3GY2A 2WPIS 2ANMH 1AKSA 3E91A 2FX6A 1ELBA 1KDQA 2QXIA 3FAOA 1HCGA 1HDTH 3NCLA 8ESTE 3Q3YA 5DP6A 1C2EA 1EUFA 1ZHMA 3S0NA 2ANYA 2XTTB 2A4RA 1OKXA 5TJXA 1O37A 3MNCA 4DURA 3H5CB 8KME2 3E90B 2OXSA 1GHAG 1SGRE 2CF8H 1GJAB 1G3EA 1WTGH 2BDYA 2F9BH 4DJZB 2YNAA 3O8BA 1BMMH 4RKOB 2BX3A 2BXTH 1GMHG 1O38A 3URDA 3B23B 2WV4A 4FUIA 1TPOA 3GISB 2XBVA 4JZDH 2FOMB 1G3CA 4GCHF 3TNTA 2VWMA 2RDLA 2ZFRH 1JRTA 1KLJH 1O33A 4X1SU 4DW2U 1HNEE 1SSXA 5HM9A 4JCNA 2BDIA 4UFDH 3V12A 7ESTE 3WY8A 3H7TA 1C2KA 2AFQB 1HJ9A 4DOQA 2EI8A 1V2OT 1UVSH 1KXEA 4ZUHA 4TWWA 1BZXE 2AMPA 2B8OH 3LJOA 2Y5HA 1NS3A 1SVPA 5DP5A 2GZ8A 1H4WA 1RIWC 3U8RH 1GG6B 1ZSKA 1GI3A 2R3YA 5A8ZA 3UUZA 1BMLA 3BTFE 7KMEH 4AYYB 4ISLA 5E0JA 1PPHE 4AFZA 1BTPA 3LDXH 3RXAA 4MPXA 1P0SH 3DFJA 2R0LA 4LOYH 2ODQA 3ZYDA 3SV2H 3KGPA 2QCYA 5IDKA 1ZSJA 4K8BA 3MHWU 2Z3EA 1YPEH 1G2MA 1C5ZB 2PKSC 2Z9JA 3RXRA 1AFQB 1O2PA 3LGIA 3QK1A 3SU6A 2P94A 2ZHFH 3A88A 3TJOA 2HVXA 4UFFH 3SJ9A 1Z1IA 3E8LA 4X6OA 1V2NT 5FPYA 5JB8S 5EPYA 2Z3DA 1PPCE 3A83A 3ZYEA 2B5TB 2OQ5A 4YOGA 5C67A 1F7ZA 2HNTF 3GYLB 3HK6B 3RMMH 3UIRA 2UUYA 5DP9A 5LGOA 3TGJE 2G52A 1O3HA 3PLKA 3K6YA 4SGAE 1DOJA 4B2AA 4O97A 1T8OA 1GBAA 1PPBH 1OWIA 1O36A 1BB0B 1ORFA 2ZDVH 4FU9A 1F5LA 4X2XA 2H5CA 1W14U 3TGIE 2HPPH 2FTMA 1BMAA 1LHEH 3UWIA 1GJ6A 2P95A 1Z8JB 2JKHA 2ZGBH 1KXAA 1AI8H 4JZ1A 3LC3A 4F4OC 3IG6B 1ETSH 2ZU5A 2PSYA 2VVVA 3A8CA 2GDEH 1O5BB 3ZVCA 3MFJA 1QJ7B 2ZFTA 2Y6TA 3ITIA 1AWHB 3M3TA 5DJ7A 3M37A 3VB5A 1LKBA 2FO9A 3O8CA 1ANBA 3K2UA 2J38A 4K1TA 3LJJA 1ABJH 3RXCA 8GCHF 4X0WU 1Y5UT 4CRDA 1MTNB 1Y3YA 5C3NA 1SGEE 3KQDA 2QC2A 4ISOA 2GDDA 2QXJA 1OX1A 1XX9A 4K60A 1FXYA 3GY7A 1IQGA 3SV9A 1O5GH 3O8RA 2BLVA 3A81A 1GMCF 2F9OA 2XC4A 2TGDA 4K1SA 1VR1H 1ZPZA 3MU4A 3ZZ8A 1GVLA 3U98H 1PQ5A 1O3NA 1P57B 1P01A 1IQKA 1RD3B 1G36A 1UVTH 2UUJB 1HPGA 1GGDC 2ASUB 2D2DA 4O03A 3EA8A 1KXFA 1SB1H 2GTBA 1C5WB 1A3BH 1SQAA 1ZHRA 1LHGH 1X7AC 4CR5A 3ZZCA 4INHA 3MNSA 1AY6H 1SGPE 1FY8E 1XKBC 3ZZ5A 1MD7A 4NA9H 1KIGH 2OC7A 4NSVA 1PYTC 1FN6A 1QRWA 1RS0A 2QA9E 4U01A 1CA0C 3GY8A 3TJVA 1TGTA 2FS9A 4FU7A 4NG9H 3SV8A 3KN2A 4GUXA 1XVOA 1C2LA 4VGCB 2VGCB 4BANB 1S81A 3A7WA 5DP4A 1V2WT 1BRCE 2O9QA 2GVFA 5ESBA 1BTHH 1UTLM 2Y5GA 5CE1A 3A8AA 2W7SA 2VH6A 9LPRA 1WU1A 3MU0A 2H6MA 1T8MA 1B5GH 1A61H 1W7GH 1XUKA 1K1NA 2AYWA 5EOKA 5I25A 2O8WA 1QURH 4ABJA 1P2NA 1GHXH 1ZYOA 1GI2A 2JETB 2FM2A 1O3DA 1GBCA 4NIWA 1IQIA 4WY3A
chains in the Genus database with same CATH superfamily
2M5TA 2VIVA 2BLQA 2QN5T 4CBOA 3ZZDA 2FOHA 3RXEA 5BPEA 1GHBF 3GCHC 3F0OA 2A2XH 3VGCC 3BG8A 1T8LA 1BTUA 2ALPA 1GWAA 2C3SA 4CHAB 1DLKB 1EASA 1O2XA 2SGPE 4WMEA 5F8ZA 3ZZ7A 4SGBE 2BLOA 3BTDE 1RXPA 4Y7AA 3KYFA 1O3MA 1C5YB 3RC4A 2SFAA 2Y5FA 3IITA 4K3JA 3T62A 4INKA 1HAIH 1W12U 4WJG2 4XRNA 1O3OA 1DITH 3GY3A 2ZNKH 1MKXK 1P09A 4I8KA 1JIRA 3SW2B 1C2DA 4KTSA 3FZZA 5HIZA 5FCKA 3OY6U 1EAWA 5CMXH 1TMTH 4BNRA 5DPAA 2QF0A 2Y7XA 2GV7A 3BIVH 5JBAS 1ZZZA 3TLOA 4A5TS 1GBMA 2QV1A 1MH0A 3O8DA 4NWLA 2P93A 1GBTA 3OAAD 1ZTLA 3SUDA 1GBFA 1OHHD 6GCHG 3BTEE 1LQDB 4JYUH 2GP9B 5AF9H 5TCCA 2Q6FA 2QAAA 1QA7A 2G5NA 1VGCB 3Q3XA 2Z9GA 3KQCA 1EPTB 1EATA 3SHCH 1CHOF 5ETXA 1UTKA 2R3UA 2ZGJA 4YO9A 1MKXH 1SOTA 1OWKA 2PR3A 3PTBA 3MH6A 1LTOA 3ZZ9A 2PKAA 1Y3UA 1XUIA 4F49A 1P12E 2Z9IA 1O3EA 1E35B 4X8UH 5F8XA 1T4UH 5J4SA 3NK8A 4YT7H 2NU0E 2F91A 1Z6EA 7GCHF 1SHYA 1XXFA 3QGNB 3VB7A 1C2HA 1ZRKA 5J4QA 4VGCC 2VGCC 1T8NA 4AG2A 3RUOA 1OP2A 1P05A 2ZPRA 3BEIB 5FX5A 4X2YA 5E0HA 1Z7KA 5DGJA 4AX9H 2CXVA 1BBRK 1TNJA 1QA0A 1UCYK 4Y0YE 4OS2A 1YKTA 3SBKA 1MUEB 3EDXB 1G2LA 1A5HA 4WVPE 3FKSD 4TY6A 1NESE 2RG3A 4CH2B 2Q6GA 3PWCA 2ZDNA 1THSH 4AGKA 1EZSC 3F9GA 3P8GA 2P3FH 1GVKB 1W10U 1YPKH 4Q4LA 1QJ1B 1UJ1A 4CHAC 2TBSA 3FP6E 4ACAA 2FI4E 2A31A 1BBRH 3SI4H 5LPRA 2QY0B 2TGTA 3SU3A 1UCYH 1SGDE 3RXHA 4ABDA 1TNHA 4ABHA 3TK9A 2ZU4A 2VIDA 4I8JA 5DP8A 1GJ7B 2A4QA 4DG4A 4B75A 1TQ7B 2FESH 5F53A 1ABIH 3MH4A 5E2OA 1FI8A 3HGPA 2SGQE 4DIHH 1O2ZA 3LGUA 1LVYA 2W5EA 1DWEH 2PLXA 4GHTA 4XOJA 3DHKH 1W0KD 3PMBB 2B9LA 3VPKA 1CVWH 3GY4A 1Y3XA 1TGNA 2TRMA 3GDUA 1AKSB 1DX5M 4BAMB 2IJD1 3K9XB 1F0UA 1KDQB 3GCNA 1DT2A 1T32A 4Z0KA 2BD2A 3F2GA 1S5SA 1QGFA 1N6XA 3PLPA 4B76A 2FPZA 1UW7A 1BTYA 3F6UH 2SNWA 1MABB 1YC0A 1Z8GA 2PWXA 3FVFB 1PPGE 3OEED 1NRSH 1C1WH 2ANWA 5B6LA 1BTZA 1Y59T 2IOTA 1B0FA 3RU4E 2AIPA 4NGAH 1C5VA 2C4FH 2HRVA 1Q3XA 3SNBA 1ETRH 2AHME 1OWJA 2OC1A 1KY9A 1DLEA 5DG6A 2CN0H 2K1QA 4AB8A 1EB1H 1EZXC 1NRRH 1O3FA 2BDHA 1GL0E 3TNSA 4B2BA 2FIRH 3STIA 1O3BA 3GCTG 1WCZA 3BIUH 1GMDF 5F8TA 1O2NA 4U30A 1JMOH 2NWNA 4IN1A 1J15A 1NZQH 5EODA 1DFPA 2WPKS 1GL1A 4UONA 4FOUC 3V0XA 1VCWA 2A7CA 1FIWA 3BEUA 1S85A 1UTNA 1QB1A 1GCTC 2HNTC 3RXSA 3A84A 2KAIA 4HZHA 2HLCA 1GDNA 3M7UA 1C2JA 4K5ZA 5PTPA 3U1JB 4Y10E 4BOHA 2F9PA 1SGYE 1QHRB 5C1YA 1YLCA 1OWDA 3RXBA 1BHXB 2F9VA 1DXPA 3W94A 2PGBB 1SGFA 1PQ7A 2ZTXA 3HK3B 4WWYA 3D49H 1OOKB 1C1UH 3UB0A 3I77A 2SGDE 1LCYA 2AERH 1RGQA 4B6EA 1SQTA 5DP7A 2WV9A 2GD4B 5FCRA 1UTJA 1GJ9B 1SLWB 2GCHF 1JIMA 1E0FD 3VFEA 3TIUA 1AZ8A 1CBWB 3FZDA 5G4BA 2P3UB 1XM1A 4DIIH 5A0CA 1FZZA 3EYDA 5C0UA 2P8OB 2V6NA 1ZLRA 4R0IA 3DUXH 1BDAA 1L4DA 4GCHG 2ZGCA 2FEQH 2HWLB 4H4FA 4CRFA 1V2VT 5EQSA 1LHDH 3U1IB 2CV3A 2VNTA 4BAKB 3OFND 2GCTC 3QTVH 1UHBA 4OS6A 3A80A 4ZHAA 5GJ4B 1VJ9U 1U6QA 2ZTZA 1NPMA 1FIZA 2GZ7A 1BOQA 1O3IA 1EP6A 4X8SH 2Q6DA 2VWOA 1V2TT 1CO7E 1ETTH 1WTHD 2AS9A 2QXHA 2VVCA 3MU1A 1QQUA 4U32A 5C0TA 2H9EH 1YPGH 1EB2A 2QGRA 1E1RD 3SJOA 1A46H 2NU4E 1LHCH 1TAWA 3CNRA 4X6MA 4ISNA 2RA0A 2A45B 3D65E 4DGJA 3Q77A 4WMDA 3DSGA 1KLIH 1FY3A 1F5RA 1YCPK 1C5PA 3A7XA 3BV9B 2WHXA 3STJA 1ZGIA 1SGCA 1EP5A 3PV2A 4JK6A 4Y11E 1OWEA 4IC6A 1LMWB 1C2FA 2Y80A 1QL9A 1VJAU 3A87A 1HJAB 3ESTA 1TQ0B 5AVDA 1V2UT 3M5NA 3SUGA 1P2JA 4DY7B 4ZROA 2YNBA 4AGJA 3EE7A 2A2QH 1TNGA 2W3IA 1CT4E 3SJKA 3F68H 3PWBA 1TABE 5T3HA 3SV6A 1FQ3A 1P03A 1YCPH 3KCGH 3Q76A 4XBBA 2LNCA 3UWJH 1EAXA 1XUGA 2A7HA 1F0TA 3M5MA 5LH8A 1XMNB 4ZKOU 3TK5A 5CHAC 4ABGA 4R8TB 4I86A 2L6OA 4ABIA 1P04A 4WXIA 1HXEH 4WH6A 2XYAA 4Q63A 2PP6A 3T2NA 2Y81A 1H1BA 3CP7A 2XBWA 2TIOA 6LPRA 3M3SA 1MBMA 4I32A 1E1QD 1LKAA 1EAIA 2ZHWH 1XUJA 1ELEE 2J5UA 5C2ZA 1UK4A 3RXGA 2AMDA 4JYTA 1O2MA 4AZ2B 2W6ID 1XKAC 4B2CA 4KP0A 1C2IA 1MTVA 3P8FA 5JBBS 2PUXB 3VXEH 3N7DA 3SUEA 2FWWA 4DVAU 1CBWC 3SGBE 3SYJA 1YM0A 2BYAX 1DY8A 5EXMA 3U9AH 2FP7B 4Y79A 1MZAA 4ZHLU 2XWAA 3AW1A 3NPSA 2F9UA 3M35A 8GCHG 3RXUA 2D8WA 2OD3B 1NU7B 3KQBA 2GMTC 2GZ9A 1GI4A 2D26C 1ELFA 4ZCNA 1C1SA 4NIXA 1NRPH 2GX4A 4FVDA 2JIZD 1EOJA 2M2AA 1S0QA 1GMCG 3SORA 1NROH 3L33A 3UR6A 1SLUB 2A5AA 4A1VA 1GBEA 1YWUA 4H6SB 4XD7D 3EA9A 4Y8ZA 1O3GA 3SJIA 5EPNA 2I6SA 1C5TA 2C8XB 1O2WA 2FI5E 2XBXA 2CMYA 2Z9LA 1HAVA 1XVMA 3QTOH 2AGEX 3BTQE 3PV5A 1KMHB 3RP2A 2KR7A 3ENSB 1P8VC 1BRUP 9ESTA 5HXFA 2VIPA 4YT6H 1QFKH 3E0NB 1D6WA 1MQ6A 4B71A 1UTMA 1VITF 2J95A 2DE9A 2PTCE 2XCNA 1YP9A 1K1PA 1Z6JH 3MNXA 4ZXYH 1Q2WA 2ZCHP 4CRBA 1FDPA 2K0QA 3M3VA 3QDZB 1DUAA 2ZGHA 4CBNA 1ZHPA 1ZR0A 5EGMA 4E06H 3VB6A 2HPQH 2H9TH 3SHAH 2IJOB 5T6GA 1P02A 2GGVB 1BIOA 3PTNA 2R2MB 4NCYA 4J2YB 1P2OA 4WF8A 3T25A 4KTUA 3SU5A 4MVNA 1ACBE 4RSPA 3D62A 1HBTH 3FFGA 1AMHA 1NRNH 3P6ZB 1RTKA 3DA9B 5HIYA 4CRGA 1PYTD 1S6LA 3KF2A 1C5MD 2BQWB 1GG6C 2BQ7B 1V2JT 2WINI 3TGKE 3U69H 4HI3A 2BTCE 1H9LB 1OS8A 1GJBB 1DWCH 1ANEA 4OM9A 1KYNA 1G9IE 4LZ4B 4WMFA 3N7OA 1EZUC 5FX6A 3M36A 3MU8A 2PFEA 4F48B 3GYMA 1M9UA 2BX4A 2XNIA 2PKAB 4BTIB 3F9FA 1GHBG 2AEIH 1QCPA 2PV9B 3SU2A 4FUHA 1V3XA 2JH0D 1AFQC 1IQHA 3BG4B 2A5IA 1L1GA 2Z3CA 3ATKA 1AUTC 4AFQA 3EE0B 4AN7A 1AD8H 1YPMH 3A85A 1WDIA 5A8YA 2AMQA 4FVBA 1MCTA 4WXVA 3ZV8A 1E37B 1JBUH 2ZF0H 1VKYA 1WSSH 2FZZA 4D76A 1Z1JA 3B9FH 3BEFB 4Y6DA 3SQHE 4PROA 1MKWK 1PQ8A 2UWLA 1A3EH 4NA8A 1SG8B 2BY7X 2ZKSA 3SNEA 5FXLA 3GDVA 1JWTA 2BQ6B 3OU0A 5GXPA 1SFIA 1C1PA 1QQ4A 1OYTH 1IQLA 1LPGB 1AO5A 1BHXF 3RXQA 1GBHA 1GI6A 4P02A 1O34A 3ZVEA 1S83A 2V3HH 5LPEA 4X6NA 2NU1E 4A1TA 2BY9X 3GS9A 4Q7ZA 4OS7A 1CHOG 2VINA 1BTWA 2ZCLP 1AE5A 1O3LA 4B1TA 4ZKRU 1MKWH 3SN8A 3Q3KA 3RXJA 5DN6D 2QYIA 1O2YA 1D3DB 4UEHH 1FUJA 2FI3E 1W8BH 2EI7A 2ZTYA 1QBOA 1LDTT 3NUMA 5L30H 3SGQE 2O8UA 1MTNC 2P59A 1OXGA 4UD9H 2VBCA 2FOBA 2PUQH 7GCHG 1P2IA 4Q7XA 1C4Y2 2BY8X 1FONA 1PPZA 1WQSA 1ELVA 1QB9A 1FY5A 3AAUA 2OBOA 4K8YA 2G8TA 4THNH 4YESB 2BB4A 1C5XB 1K2I1 2ZC9H 2A7JA 2XC0A 3HATH 1NFYA 3ZZBA 2SGEE 1O2IA 1O0DH 2J92A 1KTTB 2XOKD 3IWMA 1C1QA 1GHYH 2BY6X 5DO4H 1C2GA 5DKMA 4D9RA 2OCVB 5HGGA 4K69A 3PLBA 1UO6A 1EX3A 1SMFE 5T6FA 1F0RA 4Y7BA 1MAXA 4JZFH 1B7XB 2AIQA 2QF4A 1HIAA 3R0FA 3FN8A 1B0EA 1EQ9A 1INCA 1P9SA 1H8ED 1Z8RA 3M61U 3PB1E 1O31A 4NFFA 2Z7FE 5EXNA 3UNSA 3CS0A 2J98A 1O2JA 4MNVA 1NM6A 2BD7A 1ZRBA 1C5LH 3W95A 3M7TA 4D7GA 1ID5H 3MTYA 3RXPA 1HAOH 4MDSA 3E3TA 6ESTA 2VB0A 1C5NH 1PFXC 2QIQA 5E0GA 4X8VH 3RC6A 1SOZA 2H9HA 2XCFA 2JH5D 3PROA 6CHAB 3KYGA 5FPSA 1FLEE 1TGSZ 4AFSA 4RI0A 1HB0B 1ANCA 5EJLA 4NFEA 2KAIB 3ZVFA 1ZMLA 4O9VA 3SNCA 5F6MA 3F3BA 1COWD 1GI8B 1HAZB 3K65B 1K1IA 3E1XB 2FYRA 3NKKA 5AFZH 1MTWA 3RXLA 5JB9S 3SI3H 1JOUB 2JETC 1PJPA 1KLTA 1ZTKA 1W0ZU 1OPHB 4X1RU 1LPKB 2WYJA 2H2ZA 2GJGA 1CGHA 1V2LT 3OX7U 2G81E 2A4OA 4QT8C 5EW2H 1MTUA 4I8LA 3MU5A 2RCEA 1FPHH 3UPEA 1KXBA 3AVZA 1C5UA 3P70B 1HUTH 1N8OB 4ABFA 1EJMA 4LXBH 4GAWA 1E34B 1TBRH 2ZI2H 4TYDA 2FOGA 4XE4A 2BD3A 1HGTH 4XBCA 1MCVA 2VIQA 1YPJH 1AE8H 2BMGB 2A0QB 1Z8IB 2BHGA 4I8HA 3UNQA 3N99A 2PSXA 1EFRD 1ELCA 4RT1A 1N1LA 4AOQA 3RXMA 4FXGH 5DK1A 1GMDG 2AGIX 4RN6A 3PYHA 3A7VA 1P3EA 4XDEA 3OTJE 1ZMNA 4I33A 1IAUA 1N6YA 3UNRA 1UHBB 2SNVA 3UY9A 3ATIA 3M5OA 1EAUA 3RXFA 1O2UA 4FUBA 2ZU1A 5SGAE 2F83A 2JH6D 3LC5A 1AZZA 3ZVBA 1NFXA 1J16A 3UAIC 2ULLA 2XWBI 2YOLA 1KTSB 1GJDB 4KELA 1AWFH 5DSFA 4MPVA 1VGCC 1C4V2 3P17H 1L4ZA 2Y7ZA 1EPTC 3V7TA 3JZ2B 2B7DH 1SC8U 2KCPA 4ZMAH 1TNKA 2C8YB 3RU4T 1S84A 2F4LA 5GNDA 2BDCA 1O3CA 2J4IA 1GI0A 3S7KB 4D9QA 1D3TB 1TYNA 1K21H 1DANH 1XUHA 2ZDAH 5JPMH 2XC5A 2ZG0H 2GCHG 4IMZA 3RM0H 2WSSD 2FXRA 1V6DA 1O2RA 1G3DA 3E16B 4JMYA 1AB9B 4ASHA 4BAHB 2OBQA 2ODPA 2PW8H 1O30A 1MU6B 3AASA 1H8IH 2BVSH 4FUGA 1QTFA 1TRYA 1BCUH 2FMJA 2ZZUH 1D4PB 5A2MH 2PGQB 2WUCA 3RXKA 2LP6A 1T31A 2XNDD 1C9TA 2A32A 1GHZA 1L1JA 1D9IA 1O2SA 4E7RG 1SHHB 1L2EA 2RA3A 3L3TA 1ANDA 3LIWA 3WWFA 1G32B 5H4IB 2W3KA 4AG1A 2G4TA 2HALA 1FPCH 3QN7A 4FUDA 2EA3A 1ARCA 1O3JA 5A8XA 3I78A 2F43B 2ZCKP 4XFQA 1BT7A 2AH4X 2TGAA 1O2KA 2STBE 4JZEH 1A1RA 2VU8E 1AIXH 1HLTH 3ZV9A 4B73A 3JZ1B 1N8OC 2I6QA 2XW9A 1ESAA 5C20A 3RU4D 2KCOA 1J17T 3NWUA 4IW4E 4D7FA 2OINA 4O3TA 1LQEA 1TPSA 2THFB 4INLA 1Z71A 4BAQB 1V2RT 1ELGA 2FLRH 4Y71A 1V2QT 5JBTA 2WPJS 1P06A 4HTCH 1T7CA 1GHVH 1C1TA 2PKSB 5EU8A 1DSUA 3V13A 3G01A 3GY6A 2QE7D 1BMNH 1QNJA 4FU8A 4X2WA 1DSTA 1DY9A 4E7NA 2STAE 1AGJA 5EG4A 1WQVH 5FAHA 1AQ7A 2QF5A 2ZU3A 3C1KA 3ODFA 1CT2E 1PQAA 2O8TA 4Y8YA 4CREA 2ODYB 2R9PA 1RTFB 1YPLH 1K1MA 3BN9A 1O2GH 1IQMA 4IS5A 4YLUA 1H9HE 3SZNA 5JBCS 4CRAA 1MAYA 4YM9A 2K8IA 1A2CH 1HAVB 2CHAB 2WYGA 4GLYA 1L1NA 2O8MA 4A6LA 2NU3E 4FUJA 3SNAA 4NIYA 1Y5BT 1ZOMA 1H9IE 4I31A 1YBWA 2FOEA 2UWPA 1QRZA 1SGIB 1TGCA 3AK5A 1IQJA 1VCPA 1H8HD 5ESTE 4X2VA 4IC5A 1TNLA 1FMGA 2C8WB 3QGJA 1TOMH 2XBYA 2XXLA 3A8DA 1UTOA 3KEEA 4K1EA 5C1UA 2R0KA 3CENA 2XRCA 1ZPCA 5GCHF 4Z1MD 1HV7A 3ZZ4A 3ELAH 4YOIA 5CDFE 1GCDA 1O2QA 3TJUA 1AB9C 4AORA 1OP0A 1ZTJA 4FUFA 1TRNA 3D23A 1HAYB 4U2WA 5FPTA 4CH8B 4IGDA 1TFXA 5JYIA 2ZEBA 1DUEA 3BTGE 1DPOA 4OGXA 3PO1B 1ZMJA 3RXOA 4NA7A 4YOJA 1HAPH 1QY6A 2Z9KA 3BTTE 3HPTB 4TWYA 3RLYH 1IOEA 1NN6A 3KL6A 5EJ1A 2YMSB 1SLXB 3RC5A 1TGBA 4OS1A 1WBGB 1FY1A 2ZPQA 1WOFA 3BTWE 3P8OA 1BRBE 2SGAA 3TH3H 2LPRA 1C1NA 4XBDA 4TT3D 4E05H 3QZRA 1GBKA 1IQNA 4BAOB 4UFGH 1FY4A 1THRH 1YPHC 1O2VA 1GGDB 3BTME 3E0PB 4BTUB 5C5NA 1EJNA 1SGFG 1C5QA 1GHAF 4AYVB 3ZVGA 4LZ1H 1TALA 1OSSA 5IYTA 1Y3WA 2GT8A 1RJXB 2FOCA 1A0HB 1QRXA 2H5DA 3A82A 3DFLA 1O5DH 3HGNA 1O32A 1TBQH 4MPWA 1GMHF 1VITG 2P8OC 3TITA 2ZFPH 3BTHE 1O3KA 2Z94A 3SUFA 1CA0B 1F2SE 4AC9A 2EI6A 1BBRE 1HXFH 3MH7A 2BDGA 4MNWA 1BUIA 1UCYE 3OSYA 1BJVA 1O3PB 3DD2H 1MQ5A 2W6JD 4MLFB 1DVAH 2DUCA 1QB6A 5BRRE 2FTLE 4JYVH 1A7SA 2J9NA 2BD4A 4Y0ZE 2PHBA 2RDEA 1UMAH 1XXDA 1O35A 3MYWA 3V3MA 1F0SA 2ZPSA 3PM3A 4OS4A 3A89A 1TX7A 3VXFH 3P8NA 2CHAC 1E79D 1PPFE 1GJCB 1RTLA 3OTPA 3QZQA 2EQNA 3A8BA 1TMBH 3F9EA 3UR9A 5AHGH 3MH5A 1A4WH 2GT7A 3AAVA 4IN2A 2ZQ1A 2H1UA 1OWHA 2F9NA 1GBDA 3DSOA 1AVGH 1MD8A 2P16A 1VCQA 3GCHB 3TJNA 1BRAA 1CU1A 3VGCB 2QXGA 2WZQA 1ZJDA 1GDQA 1HJAC 2BLWA 2NU2E 3GDSA 2B0FA 2Y82A 1W11U 2BOKA 2CF9H 1C1VH 5DP3A 3KQEA 3TH2H 2ZHQH 5I46H 3RXDA 3ATWA 3SU4A 2EC9H 1VITH 1QBVH 1UVUH 4CRCA 1HAGE 1NTPA 1SGTA 3PO1C 3GY5A 1H8DH 4MG3A 1MMJN 2ZU2A 2WPMS 3I29A 1UVPA 1GJ4H 2YMSC 2FODA 4CR9A 1RRKA 5T1VA 1C5OH 4FUEA 4Z6AH 1JXPA 3MO6A 4X1QU 1EZQA 3F9HA 2GV6A 1HYLA 4HFPB 2Q1JA 1TA2A 1YY3A 3KHVA 5L2YH 5AFYH 1SL3A 3A7YA 3RXVA 3LGVA 1AFEH 3OYPA 2ZDLA 4RKJB 1HIAB 2OUAA 2VH0A 1TIOA 3RMLH 2PTNA 5GDSH 3RXIA 4ZKNU 1YYY1 1J14A 1TNIA 2J98B 5FHTA 3UFAA 3QO6A 1DXWA 4BXSA 1FAXA 1FX0B 1F92A 4IBLH 1FJSA 3SU0A 3SQEE 1AUJA 1O2LA 3A7TA 4GSOA 1AN1E 3EQ0H 3HKIB 4UDWH 3BF6H 1GJ5H 2O8LA 1QR3E 1S0RA 4X1PU 4K2YA 3QWCH 3UREA 1UTQA 1XUFA 3KIDU 5KEDA 2QF3A 3ODDA 1DE7H 3SNDA 5GWZA 2OTVA 1C2MA 1LVBA 1IQEA 2D1JA 3PV4A 4M7GA 1P2MA 3EAJA 4ABEA 1L0ZA 2IPQX 2ZFSA 1LVMA 3T27A 1LVOA 3F0PA 5IK2D 3MNBA 2FYQA 2AGGX 3S9AA 3RMNH 4DT7B 5C5OA 2OC0A 4TPYA 3P92A 4DCDA 2HGTH 3ZZ6A 2ZO3H 3N7EA 1W2KH 4Q80A 3UQVA 5L6NH 2VIWA 2BD9A 3C27B 2A4GA 4Q2KA 1Y3VA 1WAYB 1NT1A 2FDAA 3HKJB 3T26A 4O3UA 2ILNA 2EEKA 3SGAE 2J34A 1NBMD 1TONA 4ZXXH 3U28C 2G51A 5GIBA 2ZIQH 1CQQA 2R2WU 1E38B 2ZHDA 2VWLA 4KKDA 2RFKC 1TX8A 4TSFD 1C9PA 2G4UA 2G00A 1DM4B 4A1XA 2BVXH 1P10A 5EQQA 3FP7E 2VWNA 4Y76A 4AB9A 1AU8A 3NXPA 1NC6A 1BJUA 1O3AA 1D6RA 1NFWA 3M5LA 2DE8A 1ESBA 2BDBA 2KX4A 5CHBA 1SGQE 1ZPBA 3PMAB 2ZDMA 4IMQA 4OS5A 3RMOH 4AFUA 5HKKD 3ZIAD 3S9BA 3LH3A 3GCOA 2ESTE 3QX5H 1HJ8A 1BITA 2BD8A 3MO9A 1S6HA 1ZGVA 1UK3A 2L74A 1GJ8B 1HFDA 3MOCA 3U8OH 1MBQA 5KGOA 1EJAA 3MO3A 1CGIE 1NU9A 1T4VH 3AW0A 4Q7YA 3B8JA 3UOUA 5ABWA 3KNXA 1J9CH 3T28A 1NRQH 1ARBA 3M7QA 2G55A 1C5SA 2ALVA 5GPIB 1SGNE 5EIYA 4JK5A 3W1EA 1FV9A 1P2KA 4WH8A 1SI5H 3BTKE 4YLQH 3LGYA 1GI5A 1QZ8A 2BDAA 2W7UA 1CT0E 1OP8A 1SBWA 4X8TH 2J97A 1HRTH 1AVXA 2WPLS 3P95A 1UVOA 3BG4C 1TMUH 4FETA 4J1YA 4MNXA 4XSKU 3QLPH 2BXUH 2G5VA 1PPEE 3LT3A 3ZZAA 1JRSA 2ZFQH 1W3CA 4LK4A 1GVZA 4ASUD 1SFQB 1YCPM 2ZA5A 3R3GB 1AHTH 1SQRA 1A5GH 3SJ8A 2SGFE 4ZAEA 1IHSH 1AVWA 1WV7H 5FL7D 4D8NA 2JJ2D 3T29A 1KSNA 2IN2A 3ZVDA 5JDUB 2BD5A 3F1SB 1Y8TA 1SQOA 1GHWH 1MU8B 5L2ZH 2ZGXH 1LHFH 2UWOA 2GKVE 1FN8A 3VB3A 3UOPA 4KGAA 5HMAA 1A0JA 2BY5X 1GBBA 1IHTH 1GCTB 3PRDA 2A5KA 5A0BA 1TRMA 3WWBA 1GI1A 4GVUA 6GCHF 4P00A 5FBIA 1O5EH 5F03A 2V3OH 4ZH8A 4GHQA 1J8AA 4BTTB 3VEQB 1C1OA 4H42U 3L6PA 3EGKH 4I8GA 1Y5AT 3MMGA 1MTSA 1TA6A 1VZQH 1GBLA 3TH4H 2ZP0H 3SO3A 5K7RA 1UTPA 3MI4A 1K22H 5T6DA 5TCAA 2P3TB 1YLDA 3OY5U 1TBZH 4MNYA 3LKWA 3BSQA 1V2MT 8LPRA 3PMJA 2CGAA 2ANKH 2HNTE 1BA8B 1S6FA 2V35A 2Z6BD 1P9UA 4JZIA 3URCA 3E6PH 1SKYE 4NZLA 1TPAE 1CSOE 1C1RA 3ATLA 3DT0H 2C93B 3H09A 3QUMP 4MTBA 1YF4A 2JJ1D 3T5FH 1NY22 2ZDKA 5EQRA 3RXTA 1GI7B 1K9OE 3LGWA 4X6PA 4ACBA 2HOBA 2ZECA 3LONA 2WV5A 3LH1A 4ISIH 1V2PT 1DDJA 1O5CB 2FS8A 2KCYA 1QL7A 4MQAA 1ZSLA 5EXLA 4F55A 1O2TA 4NZQA 3RM2H 4GPGA 4ESTE 3TU7H 2WUBA 2ZFFH 5B6OA 2WPHS 2FX4A 2OP9A 2GCTB 3FANA 4NSYA 5KECA 1NO9H 3NZIA 1C1MA 1K28D 1TOCB 1WUNH 1YGCH 3CS7A 5HYOA 1P3CA 1TE0A 1W13U 1HAHH 2OLGA 1BQYA 4H6TA 1ELDE 2VVUA 1C4U2 1V2ST 2KFWA 3LGTA 3U8TH 1EPTA 3A7ZA 3PMHB 3K6ZA 3OEHD 1SR5C 3TVJB 3SOSA 1ZJKA 3UTUH 2A1DB 4FUCA 3DCLA 1MZDA 1O5AB 4Y8XA 1P2QA 3H7OA 2OQUA 1KXCA 1CA8B 5E8EH 1GDUA 2J94A 4UFEH 4YXWD 3SU1A 4YTAA 1O2HA 2ZWLH 3ZVAA 2BZAA 6CHAC 1GBIA 1EXFA 2OC8A 1CHGA 3A86A 2KCAA 4BXWA 1SPJA 5FBEA 4ABBA 2BVRH 1D3PB 4ZKSU 3TPIZ 2FOFA 4I7YH 1TX6A 5LPFA 3FP8E 1NFUA 1V2KT 4NIVA 1DICA 1HAXB 3RDZA 4TY7A 1FAKH 1TB6H 4ZHMU 5HM2A 3SV7A 5K0HA 2HLDD 1ELAA 1G37A 2VJ1A 1GPZA 1K1OA 4OGYA 3ZZ3A 3DSPA 1C5RA 4TPIZ 3GICB 4B6FA 2C8ZB 3UQOA 1IQFA 4NWKA 1W7XH 2KM0A 2UUKB 1ELTA 1ESTA 5EW1H 1KXDA 3GOVB 2TGPZ 2UUFB 1G3BA 1K1LA 1THPB 1DWDH 5CHAB 2JDID 1RIWB 1CE5A 3S9CA 3OE7D 1Q31A 2V3MA 2LELA 3LOXA 3MWIU 2FLBH 4KTCA 1W0YH 2BOHB 3TK6A 1D3QB 1DWBH 1QIXB 1UK2A 2IPHA 1CGJE 5C17A 2J2UA 4X1NU 4A7IB 1DS2E 1GBJA 1TPPA 4YZUA 2FOAA 1TWXB 7LPRA 5A0AE 1W0JD 5E2PA 1OYQA 1EKBB 3S7HB 3LPRA 1FNIA 3GCTF 1QL8A 1QJ6B 1WXRA 1G30B 5GCHG 1BTXA 1A5IA 4HG6A 4ISHH 2ZQ2A 1TLDA 2ZHEH 1RFNA 4ABAA 1K1JA 1GI9B 1O39A 1EOLA 2C90B 1LO6A 2W26A 1O5FH 4A92A 1LPZB 1K0HA 2BM2A 3RLWH 3VB4A 3Q00A 1S82A 1WYKA 2F3CE 1A0LA 2V0BA 1YPHE 3EA7A 4MPUA 4UE7H 4B74A 5A09A 1E36B 2GMTB 3LU9B 1SLVB 3SZEA 3ATMA 2VIOA 1O2OA 1P11E 2TPIZ 2BZ6H 5C1XA 1QBNA 1F5KU 4HGCA 2CJIA 3S69A 3GY2A 2WPIS 2ANMH 1AKSA 3E91A 2FX6A 1ELBA 1KDQA 2QXIA 3FAOA 1HCGA 1HDTH 3NCLA 2EY4C 8ESTE 3Q3YA 5DP6A 1C2EA 1EUFA 1ZHMA 3S0NA 2ANYA 2XTTB 2A4RA 1OKXA 5TJXA 1O37A 3MNCA 4DURA 3H5CB 8KME2 3E90B 2OXSA 1GHAG 1SGRE 2CF8H 1GJAB 1G3EA 1WTGH 2BDYA 2F9BH 4DJZB 2YNAA 3O8BA 1BMMH 4RKOB 2BX3A 2BXTH 1GMHG 1O38A 3URDA 3B23B 2WV4A 4FUIA 2WPDD 1TPOA 3GISB 2XBVA 4JZDH 2FOMB 1G3CA 4GCHF 3TNTA 2VWMA 2RDLA 2ZFRH 1JRTA 1KLJH 1O33A 4X1SU 4DW2U 1HNEE 1SSXA 5HM9A 4JCNA 2BDIA 4UFDH 3V12A 7ESTE 3WY8A 3MQKC 3H7TA 1C2KA 2AFQB 1HJ9A 4DOQA 2EI8A 1V2OT 1UVSH 3PRBA 1KXEA 4RT0A 4ZUHA 4TWWA 1BZXE 2AMPA 2B8OH 3LJOA 2Y5HA 1NS3A 3FOAA 1SVPA 5DP5A 2GZ8A 1H4WA 1RIWC 3U8RH 1GG6B 1ZSKA 1GI3A 2R3YA 5A8ZA 3UUZA 1BMLA 3BTFE 7KMEH 4AYYB 4ISLA 5E0JA 1PPHE 4AFZA 1BTPA 3LDXH 3RXAA 4MPXA 1P0SH 3DFJA 2R0LA 4LOYH 3NRLA 3FO8D 2ODQA 3ZYDA 3SV2H 3KGPA 2QCYA 5IDKA 1ZSJA 4K8BA 3MHWU 2Z3EA 1YPEH 1G2MA 1C5ZB 2PKSC 2Z9JA 3RXRA 1AFQB 1O2PA 3LGIA 3QK1A 3SU6A 2P94A 2ZHFH 3A88A 3TJOA 2HVXA 4UFFH 3SJ9A 1Z1IA 3E8LA 4X6OA 1V2NT 5FPYA 5JB8S 3F2HA 5EPYA 2Z3DA 1PPCE 3A83A 3ZYEA 2B5TB 2OQ5A 4YOGA 5C67A 1F7ZA 2HNTF 3GYLB 3HK6B 3RMMH 3UIRA 2UUYA 5DP9A 5LGOA 3TGJE 2G52A 1O3HA 3PLKA 3K6YA 4SGAE 1DOJA 4B2AA 4O97A 1T8OA 1GBAA 1PPBH 1OWIA 1O36A 1BB0B 1ORFA 2ZDVH 4FU9A 1F5LA 4X2XA 2H5CA 1W14U 3TGIE 2HPPH 2FTMA 1BMAA 1LHEH 3UWIA 1GJ6A 2P95A 1Z8JB 2HVYB 2JKHA 2ZGBH 1KXAA 1AI8H 2V7QD 5C94A 4JZ1A 3LC3A 4F4OC 3IG6B 1ETSH 2YMSD 2ZU5A 2PSYA 2VVVA 3A8CA 2GDEH 1O5BB 3ZVCA 2KZ4A 3MFJA 1QJ7B 2ZFTA 2Y6TA 2CK3D 1AWHB 3ITIA 3M3TA 3M37A 5DJ7A 3VG8A 3VB5A 1LKBA 2FO9A 3O8CA 3WW7A 1ANBA 3K2UA 2J38A 4K1TA 3LJJA 1ABJH 3RXCA 8GCHF 4X0WU 4DT4A 1Y5UT 4CRDA 1MTNB 1Y3YA 5C3NA 1BMFD 1SGEE 3KQDA 2QC2A 4ISOA 2GDDA 2QXJA 1OX1A 1XX9A 4K60A 1FXYA 3GY7A 1IQGA 3SV9A 1O5GH 3O8RA 2BLVA 3A81A 1GMCF 2F9OA 2XC4A 4M9FA 2TGDA 4K1SA 1VR1H 1ZPZA 3MU4A 3ZZ8A 1GVLA 3U98H 1PQ5A 1O3NA 1P57B 1P01A 1IQKA 1RD3B 1G36A 3F2FA 1UVTH 2UUJB 1HPGA 1GGDC 5EJZA 2ASUB 2D2DA 4O03A 3EA8A 1KXFA 1SB1H 2GTBA 1C5WB 1NBME 1A3BH 1SQAA 1ZHRA 1LHGH 1X7AC 4CR5A 3ZZCA 4INHA 3MNSA 1AY6H 1SGPE 1FY8E 1XKBC 3ZZ5A 1MD7A 4NA9H 1KIGH 2OC7A 4NSVA 1PYTC 1FN6A 1QRWA 1RS0A 2QA9E 4U01A 1CA0C 3GY8A 3TJVA 1TGTA 2FS9A 4FU7A 4NG9H 3SV8A 3KN2A 3KQ5A 4GUXA 1XVOA 1C2LA 4VGCB 2VGCB 2OK5A 4BANB 1S81A 3A7WA 5DP4A 1V2WT 1BRCE 2O9QA 2GVFA 5ESBA 1BTHH 1UTLM 2Y5GA 5CE1A 3A8AA 2W7SA 2VH6A 9LPRA 1WU1A 3MU0A 2H6MA 1T8MA 1B5GH 1A61H 1W7GH 1XUKA 1K1NA 2AYWA 5EOKA 5I25A 2O8WA 1QURH 4ABJA 1P2NA 1GHXH 1YLNA 1ZYOA 1GI2A 2JETB 2FM2A 1O3DA 1GBCA 4NIWA 1IQIA 4WY3A
chains in the Genus database with same CATH topology
2M5TA 2VIVA 2BLQA 2QN5T 4CBOA 3ZZDA 2FOHA 3RXEA 5BPEA 1GHBF 3GCHC 2A2XH 3VGCC 3BG8A 1T8LA 1BTUA 2ALPA 1GWAA 2C3SA 4CHAB 1DLKB 1EASA 1O2XA 2SGPE 4WMEA 5F8ZA 3ZZ7A 4SGBE 2BLOA 3BTDE 1RXPA 4Y7AA 1O3MA 1C5YB 3RC4A 2SFAA 2Y5FA 3IITA 4K3JA 3T62A 4INKA 1HAIH 1W12U 4WJG2 1O3OA 1DITH 3GY3A 2ZNKH 1MKXK 1P09A 4I8KA 1JIRA 3SW2B 1C2DA 4KTSA 3FZZA 5FCKA 3OY6U 1EAWA 5CMXH 1TMTH 4BNRA 5DPAA 2QF0A 2Y7XA 2GV7A 3BIVH 5JBAS 1ZZZA 3TLOA 4A5TS 1GBMA 2QV1A 1MH0A 3O8DA 4NWLA 2P93A 1GBTA 3SUDA 1ZTLA 1GBFA 6GCHG 3BTEE 1LQDB 4JYUH 2GP9B 5AF9H 5TCCA 2Q6FA 2QAAA 1QA7A 2G5NA 1VGCB 3Q3XA 2Z9GA 3KQCA 1EPTB 1EATA 3SHCH 1CHOF 5ETXA 1UTKA 2R3UA 2ZGJA 4YO9A 1MKXH 1SOTA 1OWKA 2PR3A 3PTBA 3MH6A 1LTOA 3ZZ9A 2PKAA 1Y3UA 1XUIA 4F49A 1P12E 2Z9IA 1O3EA 1E35B 4X8UH 5F8XA 1T4UH 5J4SA 3NK8A 4YT7H 2NU0E 2F91A 1Z6EA 7GCHF 1SHYA 1XXFA 3QGNB 3VB7A 1C2HA 1ZRKA 5J4QA 4VGCC 2VGCC 1T8NA 4AG2A 3RUOA 1OP2A 1P05A 2ZPRA 3BEIB 5FX5A 4X2YA 5E0HA 1Z7KA 5DGJA 4AX9H 2CXVA 1BBRK 1TNJA 1QA0A 1UCYK 4Y0YE 4OS2A 1YKTA 3SBKA 1MUEB 3EDXB 1G2LA 1A5HA 4WVPE 4TY6A 1NESE 2RG3A 4CH2B 2Q6GA 3PWCA 2ZDNA 1THSH 4AGKA 1EZSC 3F9GA 3P8GA 2P3FH 1GVKB 1W10U 1YPKH 1QJ1B 1UJ1A 4CHAC 2TBSA 3FP6E 2FI4E 2A31A 1BBRH 3SI4H 5LPRA 2QY0B 2TGTA 3SU3A 1UCYH 1SGDE 3RXHA 4ABDA 1TNHA 4ABHA 3TK9A 2ZU4A 2VIDA 4I8JA 5DP8A 1GJ7B 2A4QA 4DG4A 4B75A 1TQ7B 2FESH 1ABIH 3MH4A 5E2OA 1FI8A 3HGPA 2SGQE 4DIHH 1O2ZA 3LGUA 1LVYA 2W5EA 1DWEH 2PLXA 4GHTA 4XOJA 3DHKH 3PMBB 2B9LA 3VPKA 1CVWH 3GY4A 1Y3XA 1TGNA 2TRMA 3GDUA 1AKSB 1DX5M 4BAMB 3K9XB 1F0UA 1KDQB 3GCNA 1DT2A 1T32A 4Z0KA 2BD2A 1S5SA 1QGFA 1N6XA 3PLPA 4B76A 2FPZA 1BTYA 3F6UH 2SNWA 1YC0A 1Z8GA 2PWXA 3FVFB 1PPGE 1NRSH 1C1WH 2ANWA 1BTZA 1Y59T 2IOTA 1B0FA 3RU4E 2AIPA 4NGAH 1C5VA 2C4FH 2HRVA 1Q3XA 3SNBA 1ETRH 1OWJA 2OC1A 1KY9A 1DLEA 5DG6A 2CN0H 2K1QA 4AB8A 1EB1H 1EZXC 1NRRH 1O3FA 2BDHA 1GL0E 3TNSA 4B2BA 2FIRH 3STIA 1O3BA 3GCTG 1WCZA 3BIUH 1GMDF 5F8TA 1O2NA 4U30A 1JMOH 2NWNA 4IN1A 1J15A 1NZQH 5EODA 1DFPA 2WPKS 1GL1A 4UONA 3V0XA 1VCWA 2A7CA 1FIWA 3BEUA 1S85A 1UTNA 1QB1A 1GCTC 2HNTC 3RXSA 3A84A 2KAIA 4HZHA 2HLCA 1GDNA 3M7UA 1C2JA 4K5ZA 5PTPA 3U1JB 4Y10E 4BOHA 2F9PA 1SGYE 1QHRB 5C1YA 1YLCA 1OWDA 3RXBA 1BHXB 2F9VA 1DXPA 3W94A 2PGBB 1SGFA 1PQ7A 2ZTXA 3HK3B 4WWYA 3D49H 1OOKB 1C1UH 3I77A 2SGDE 1LCYA 2AERH 1RGQA 1SQTA 5DP7A 2GD4B 5FCRA 1UTJA 1GJ9B 1SLWB 2GCHF 1JIMA 1E0FD 3VFEA 3TIUA 1AZ8A 1CBWB 3FZDA 5G4BA 2P3UB 1XM1A 4DIIH 5A0CA 1FZZA 3EYDA 2P8OB 2V6NA 1ZLRA 4R0IA 3DUXH 1BDAA 1L4DA 4GCHG 2ZGCA 2FEQH 2HWLB 4H4FA 4CRFA 1V2VT 5EQSA 1LHDH 3U1IB 2CV3A 2VNTA 4BAKB 2GCTC 3QTVH 1UHBA 4OS6A 3A80A 4ZHAA 5GJ4B 1VJ9U 1U6QA 2ZTZA 1NPMA 1FIZA 2GZ7A 1BOQA 1O3IA 1EP6A 4X8SH 2Q6DA 2VWOA 1V2TT 1CO7E 1ETTH 1WTHD 2AS9A 2QXHA 2VVCA 3MU1A 1QQUA 4U32A 2H9EH 1YPGH 1EB2A 2QGRA 3SJOA 1A46H 2NU4E 1LHCH 1TAWA 4X6MA 4ISNA 2RA0A 2A45B 3D65E 4DGJA 3Q77A 4WMDA 1KLIH 1FY3A 1F5RA 1YCPK 1C5PA 3A7XA 3BV9B 3STJA 1ZGIA 1SGCA 1EP5A 4JK6A 4Y11E 1OWEA 4IC6A 1LMWB 1C2FA 2Y80A 1QL9A 1VJAU 3A87A 1HJAB 3ESTA 1TQ0B 5AVDA 1V2UT 3M5NA 3SUGA 1P2JA 4DY7B 4ZROA 2YNBA 4AGJA 2A2QH 1TNGA 2W3IA 1CT4E 3SJKA 3F68H 3PWBA 1TABE 5T3HA 3SV6A 1FQ3A 1P03A 1YCPH 3KCGH 3Q76A 4XBBA 2LNCA 3UWJH 1EAXA 1XUGA 2A7HA 1F0TA 3M5MA 5LH8A 1XMNB 4ZKOU 3TK5A 5CHAC 4ABGA 4R8TB 4ABIA 1P04A 4WXIA 1HXEH 4WH6A 2XYAA 3T2NA 2Y81A 1H1BA 3CP7A 2XBWA 2TIOA 6LPRA 3M3SA 1MBMA 4I32A 1LKAA 2ZHWH 1EAIA 1XUJA 1ELEE 5C2ZA 1UK4A 3RXGA 2AMDA 4JYTA 1O2MA 4AZ2B 1XKAC 4B2CA 4KP0A 1C2IA 1MTVA 3P8FA 5JBBS 2PUXB 3VXEH 3SUEA 2FWWA 4DVAU 1CBWC 3SGBE 1YM0A 2BYAX 1DY8A 5EXMA 3U9AH 2FP7B 4Y79A 1MZAA 4ZHLU 2XWAA 3AW1A 3NPSA 2F9UA 3M35A 8GCHG 3RXUA 2D8WA 2OD3B 1NU7B 3KQBA 2GMTC 2GZ9A 1GI4A 2D26C 1ELFA 1C1SA 4NIXA 1NRPH 2GX4A 4FVDA 1EOJA 1S0QA 1GMCG 3SORA 1NROH 3L33A 3UR6A 1SLUB 2A5AA 4A1VA 1GBEA 4H6SB 3EA9A 4Y8ZA 1O3GA 3SJIA 5EPNA 2I6SA 1C5TA 2C8XB 1O2WA 2FI5E 2XBXA 2CMYA 2Z9LA 1HAVA 1XVMA 3QTOH 2AGEX 3BTQE 3RP2A 3ENSB 1P8VC 1BRUP 9ESTA 5HXFA 2VIPA 4YT6H 1QFKH 3E0NB 1D6WA 1MQ6A 4B71A 1UTMA 1VITF 2J95A 2DE9A 2PTCE 2XCNA 1YP9A 1K1PA 1Z6JH 3MNXA 4ZXYH 1Q2WA 2ZCHP 4CRBA 1FDPA 3M3VA 3QDZB 1DUAA 2ZGHA 4CBNA 1ZHPA 1ZR0A 5EGMA 4E06H 3VB6A 2HPQH 2H9TH 3SHAH 2IJOB 5T6GA 1P02A 2GGVB 1BIOA 3PTNA 2R2MB 4NCYA 4J2YB 1P2OA 4WF8A 3T25A 4KTUA 3SU5A 4MVNA 1ACBE 4RSPA 3D62A 1HBTH 3FFGA 1AMHA 1NRNH 3P6ZB 1RTKA 3DA9B 4CRGA 1PYTD 3KF2A 1C5MD 2BQWB 1GG6C 2BQ7B 1V2JT 2WINI 3TGKE 3U69H 4HI3A 2BTCE 1H9LB 1OS8A 1GJBB 1DWCH 1ANEA 1KYNA 1G9IE 4LZ4B 4WMFA 3N7OA 1EZUC 5FX6A 3M36A 3MU8A 2PFEA 3GYMA 1M9UA 2BX4A 2XNIA 2PKAB 4BTIB 3F9FA 1GHBG 2AEIH 1QCPA 2PV9B 3SU2A 4FUHA 1V3XA 2JH0D 1AFQC 1IQHA 3BG4B 2A5IA 1L1GA 2Z3CA 3ATKA 1AUTC 4AFQA 3EE0B 4AN7A 1AD8H 1YPMH 3A85A 5A8YA 2AMQA 4FVBA 1MCTA 4WXVA 3ZV8A 1E37B 1JBUH 2ZF0H 4D76A 1WSSH 2FZZA 1Z1JA 3B9FH 3BEFB 4Y6DA 3SQHE 4PROA 1MKWK 1PQ8A 2UWLA 1A3EH 4NA8A 1SG8B 2BY7X 2ZKSA 3SNEA 5FXLA 3GDVA 1JWTA 2BQ6B 3OU0A 5GXPA 1SFIA 1C1PA 1QQ4A 1OYTH 1IQLA 1LPGB 1AO5A 1BHXF 3RXQA 1GBHA 1GI6A 1O34A 3ZVEA 1S83A 2V3HH 5LPEA 4X6NA 2NU1E 4A1TA 2BY9X 4Q7ZA 4OS7A 1CHOG 2VINA 1BTWA 2ZCLP 1AE5A 1O3LA 4B1TA 4ZKRU 1MKWH 3SN8A 3Q3KA 3RXJA 2QYIA 1O2YA 1D3DB 4UEHH 1FUJA 2FI3E 1W8BH 2EI7A 2ZTYA 1QBOA 1LDTT 3NUMA 5L30H 3SGQE 2O8UA 1MTNC 2P59A 1OXGA 4UD9H 2FOBA 2PUQH 7GCHG 1P2IA 4Q7XA 1C4Y2 2BY8X 1FONA 1PPZA 1WQSA 1ELVA 1QB9A 1FY5A 3AAUA 2OBOA 4K8YA 2G8TA 4THNH 4YESB 2BB4A 1C5XB 1K2I1 2ZC9H 2A7JA 2XC0A 3HATH 1NFYA 3ZZBA 2SGEE 1O2IA 1O0DH 2J92A 1KTTB 3IWMA 1C1QA 1GHYH 2BY6X 5DO4H 1C2GA 5DKMA 4D9RA 2OCVB 5HGGA 4K69A 3PLBA 1UO6A 1EX3A 1SMFE 5T6FA 1F0RA 4Y7BA 1MAXA 4JZFH 1B7XB 2AIQA 1HIAA 3R0FA 1B0EA 1EQ9A 1INCA 1P9SA 1Z8RA 3M61U 3PB1E 4NFFA 1O31A 5EXNA 2Z7FE 3UNSA 3CS0A 1O2JA 4MNVA 1NM6A 2BD7A 1ZRBA 1C5LH 3W95A 3M7TA 4D7GA 1ID5H 3MTYA 3RXPA 1HAOH 4MDSA 3E3TA 6ESTA 2VB0A 1C5NH 1PFXC 2QIQA 5E0GA 4X8VH 3RC6A 1SOZA 2H9HA 2XCFA 2JH5D 3PROA 6CHAB 5FPSA 1FLEE 1TGSZ 4AFSA 1HB0B 1ANCA 4NFEA 2KAIB 3ZVFA 1ZMLA 4O9VA 3SNCA 5F6MA 1GI8B 1HAZB 3K65B 1K1IA 3E1XB 2FYRA 3NKKA 5AFZH 1MTWA 3RXLA 5JB9S 3SI3H 1JOUB 2JETC 1PJPA 1KLTA 1ZTKA 1W0ZU 1OPHB 4X1RU 1LPKB 2WYJA 2H2ZA 1CGHA 1V2LT 3OX7U 2G81E 2A4OA 4QT8C 5EW2H 1MTUA 4I8LA 3MU5A 2RCEA 1FPHH 3UPEA 1KXBA 3AVZA 1C5UA 3P70B 1HUTH 1N8OB 4ABFA 1EJMA 4LXBH 4GAWA 1E34B 1TBRH 2ZI2H 4TYDA 2FOGA 4XE4A 2BD3A 1HGTH 4XBCA 1MCVA 2VIQA 1YPJH 1AE8H 2BMGB 2A0QB 1Z8IB 2BHGA 4I8HA 3UNQA 2PSXA 1ELCA 1N1LA 4AOQA 3RXMA 4FXGH 5DK1A 1GMDG 2AGIX 4RN6A 3PYHA 3A7VA 1P3EA 4XDEA 3OTJE 1ZMNA 4I33A 1IAUA 1N6YA 3UNRA 1UHBB 2SNVA 3UY9A 3ATIA 3M5OA 1EAUA 3RXFA 1O2UA 4FUBA 2ZU1A 5SGAE 2F83A 2JH6D 3LC5A 1AZZA 3ZVBA 1NFXA 1J16A 2ULLA 2XWBI 2YOLA 1KTSB 1GJDB 4KELA 1AWFH 4MPVA 1VGCC 1C4V2 3P17H 1L4ZA 2Y7ZA 1EPTC 3V7TA 3JZ2B 2B7DH 1SC8U 4ZMAH 1TNKA 2C8YB 3RU4T 1S84A 2BDCA 1O3CA 2J4IA 1GI0A 3S7KB 4D9QA 1D3TB 1TYNA 1K21H 1DANH 1XUHA 2ZDAH 5JPMH 2XC5A 2ZG0H 2GCHG 4IMZA 3RM0H 2FXRA 1V6DA 1O2RA 1G3DA 3E16B 4JMYA 1AB9B 4ASHA 4BAHB 2OBQA 2ODPA 2PW8H 1O30A 1MU6B 3AASA 1H8IH 2BVSH 4FUGA 1QTFA 1TRYA 1BCUH 2FMJA 2ZZUH 1D4PB 5A2MH 2PGQB 2WUCA 3RXKA 1T31A 1C9TA 2A32A 1GHZA 1L1JA 1D9IA 1O2SA 4E7RG 1SHHB 1L2EA 2RA3A 3L3TA 1ANDA 3LIWA 1G32B 5H4IB 2W3KA 4AG1A 2G4TA 2HALA 1FPCH 3QN7A 4FUDA 2EA3A 1ARCA 1O3JA 5A8XA 3I78A 2ZCKP 4XFQA 1BT7A 2AH4X 2TGAA 1O2KA 2STBE 4JZEH 1A1RA 2VU8E 1AIXH 1HLTH 3ZV9A 4B73A 3JZ1B 1N8OC 2I6QA 2XW9A 1ESAA 5C20A 3RU4D 4IW4E 1J17T 3NWUA 4D7FA 2OINA 4O3TA 1LQEA 1TPSA 2THFB 4INLA 1Z71A 4BAQB 1V2RT 1ELGA 2FLRH 4Y71A 1V2QT 5JBTA 2WPJS 1P06A 4HTCH 1T7CA 1GHVH 1C1TA 2PKSB 5EU8A 1DSUA 3V13A 3G01A 3GY6A 1BMNH 1QNJA 4FU8A 4X2WA 1DSTA 1DY9A 4E7NA 2STAE 1AGJA 5EG4A 1WQVH 5FAHA 1AQ7A 2ZU3A 3C1KA 3ODFA 1CT2E 1PQAA 2O8TA 4Y8YA 4CREA 2ODYB 2R9PA 1RTFB 1YPLH 1K1MA 3BN9A 1O2GH 1IQMA 4IS5A 4YLUA 1H9HE 3SZNA 5JBCS 4CRAA 1MAYA 4YM9A 1A2CH 1HAVB 2CHAB 2WYGA 4GLYA 1L1NA 2O8MA 4A6LA 2NU3E 4FUJA 3SNAA 4NIYA 1Y5BT 1ZOMA 1H9IE 4I31A 1YBWA 2FOEA 2UWPA 1QRZA 1SGIB 1TGCA 1IQJA 1VCPA 5ESTE 4X2VA