2A7QA

Crystal structure of human dck complexed with clofarabine and adp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
229
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
molecule tags Transferase
source organism Homo sapiens
publication title The structure of human deoxycytidine kinase in complex with clofarabine reveals key interactions for prodrug activation.
pubmed doi rcsb
total genus 90
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a7qA00
1P62B 3CRVA 4PR0A 4AG6A 3K9LA 4L4UA 4DDWA 1OPXA 2MMCA 2C9YA 3SYNA 2VA8A 1E1RA 2WJVA 4LYAA 4Q4HA 4NCIA 4MH0R 4LBZA 1GUAA 4GZMA 3HU2A 4ZDIA 2ZJZA 1F2UA 3Q8XB 5A0FA 3U6KA 3GLHB 4JYBA 4XOIA 5LPNA 4PC7A 5DH9A 4CRWB 1VYTA 4IHQA 1RYFA 3RS4A 2OFXA 3KFXA 1SVSA 4XTRA 5JSZA 3MUFA 1XXHB 3WP1B 1ZCBA 2FFBA 2WOOA 1AS2A 2PLFA 2WJYA 2GF9A 1IN4A 2WZQA 2QP3A 3W34A 2PEZA 1CXZA 4POAA 2ZI3A 1NBME 3QXJA 3SHFA 3MWLA 1ZM9A 2DWOA 2ZSEA 3RC3A 4QOSA 3LLUA 4W5HA 4NL4H 1KAGA 3LFUA 3V00A 4JYCA 4PHHA 1X86B 1XTRA 3EZFA 4NU0A 4IXMA 2FZLA 5DI3A 2GJ8A 1TU3A 1Z2AA 1Z8FA 3KTAA 4WBSA 2CLSA 3X1XA 5DNYB 2IF0A 4PSAA 2VH5R 5FPKA 4P31A 2C5LA 3NEJA 4CIDA 2ZU0C 3OIUA 4ZCMA 5M04A 2ZJ5A 4D0LB 1DAKA 1FQKA 3THOA 5K8LA 1HE1C 2XAUA 1XEWY 1XTQA 4GZLA 4NP6A 3QXHA 4NZYA 4OK3A 5C4MA 2WPDA 4KFSA 3THWA 1G21E 4QXAA 4MYHA 3B1XA 2D3WA 2IS2A 4OL0A 3HU1A 4Q7MB 1BYUA 2C8VA 1DAGA 3AKCA 1NLZA 2OG2A 1ZC3A 1KSJA 3TAHA 1BO6A 3B60A 3MWJA 3GLGB 4YMVA 5JHGB 5J4LA 3IO5A 2WWGA 2OBLA 2W0SA 1WA5A 3QE0A 4RZUA 2QSZA 1OXTA 2EU8A 3NKVA 5BN5A 2JDIA 3KFVA 2AHOA 1KI6A 1RRPA 2IEYA 2QE7A 3UG7A 4TSFA 1CR4A 2VHUA 2F43B 4IDPA 5JS7A 4QM7A 3DMNA 2W6JD 5L3VA 1GOTA 2N46A 3GJ3A 4MGKR 1Q20A 1IXZA 3TQCA 3C5HA 3QOFA 2BVNA 5FR2A 1A1VA 1KNXA 1I4TD 2OBNA 2OEPA 3NHBA 2CEAA 2RGGA 2FSGA 1H8EA 2WJHA 3I1FA 1U9IC 2BCGY 4AYXA 1S1CA 1XBTA 2ZUDA 1OYWA 2NO0A 2KJQA 2OZEA 2ZAOA 2QP9X 3QI2A 2F55A 3C15C 2JIZA 1Q1QA 2J46A 2O8DA 4XD7D 2QM8A 5AJXA 1J70A 2R6DA 2RGDA 4A8JA 1TEXA 3M0EA 3HPQA 2I1VB 4B34A 4JLKA 1UKVY 1IONA 3VU9A 4PHGA 1ZC4A 4MKIA 3EA0A 1UM8A 2JLQA 3Q3JB 1HURA 4JT2A 1TAGA 4Q9LA 2FX3A 1S96A 3GCGA 5JZVA 5JJKA 2YOHA 1MO4A 1LFDB 1ZNZA 4G5GA 4OI4A 2GCOB 5CB6A 5KSPA 4DVGA 1SKYE 4JJKA 4JL6A 1KI3A 1KZ7B 3OFNA 3BIFA 2IL1A 1KDPA 1KSGA 2C04A 3BH7A 4M1SA 1GNQA 3JVUA 3UMFA 1DAIA 2CCGA 4KCGA 1HA3A 4QHSA 5JRZA 2RGNC 4XSGA 1P2TA 2CNWA 1XEFA 2AL7A 2R6FA 3REFA 2W83A 4F4IA 3LBIA 1ESNA 3IHLA 1HQYE 2B6HA 3AH8A 4IFBA 2F1HA 2G0TA 3T15A 1P60A 4BGDA 3RABA 2VP0A 5F2EA 3CWZA 4Q1FA 4CEJB 4IXNA 3TR5A 1QHNA 4LY6A 3DL0A 4V03A 1IJEA 4GMXA 2F6RA 3I8SA 3WNBA 4BFVA 1TNDA 1G8FA 1M7BA 1GP2A 4BFYA 4J0QA 4LHZA 4ASUA 1DG3A 2GTPA 1OFUX 3A36A 1KK3A 3QG1A 5EZ6B 5FL7A 1IAQA 3QKSA 1VKJA 4I4LA 4PSKA 3EAQA 3U3RA 4DCVA 2REOA 3MD0A 5KPJA 1G64A 3CBQA 1R8SA 4Q9IA 4TTRA 4FMCF 2L0XA 1GRNA 1OYYA 4JVSB 1AZTA 1U0HC 3J81k 4I1UA 3FE2A 4E03A 4OKSA 4A92A 1UBFA 4RFSA 4YDHB 5TB5A 4OHZA 2IA5A 1IQPA 1UEJA 4D4KA 5IF9A 2MSEB 3QF4B 4LI0A 1XNJA 4YXWD 3Q85A 3T06B 4DWJA 4UQOA 2KBFA 1SHZA 2AR7A 4B35A 3FMIA 3T35A 3HPRA 4BFZA 4I1OA 1J2JA 4Q1BA 5AJZA 3UANA 3VAAA 5KHOC 1WB9A 4PPQA 5KSYA 4Q4AB 5FTNA 1XTJA 3SE0A 2ZETA 5P21A 3U7HB 2WKQA 4GSYA 2OLKA 4JKYA 2JASA 2V4ZA 1SGWA 1NVVQ 2XTMA 4OQMA 3ZZ0A 3LH5A 3BFKA 1OIXA 3CH5A 1NN0A 4H1UA 1MT0A 5DISB 3RS7A 4FCTA 1U8YA 2WKPA 3PXGA 3ZIAA 3N5CA 5DLQC 5EP4A 4KO8A 1XJCA 4BLSA 3TKLA 4Q7JB 2QPAA 3DZDA 2QP4A 2D2EA 1GIAA 1E69A 2H92A 3BBPA 5BYJA 1KMHA 1MABB 1PJRA 5L3SB 3IILA 2BV3A 2BJVA 1XRJA 4DEYA 1VIYA 2REXB 3RWOA 4A6XA 2WWIA 2PX3A 2N1BA 1II8B 5EE1A 5GVRA 2BJWA 2QMHA 4CGZA 4OK5A 1G18A 1NP6A 1B23P 1F60A 1OF1A 4LBYA 1E9DA 1ZVQA 1JAIA 1FFHA 4ZO4A 5FR1A 2FE4A 4QKQA 2YWEA 2ZJBA 1XPRA 2ZS9A 2ORVA 3VR1A 5J47A 2P6NA 1EX6A 2WSMA 3A4LA 1AQUA 2HCBA 4TLBA 3S1AA 3U7EB 5FTLA 4YC7A 2W2TA 1TMKA 3AVYA 3U44A 1PUJA 1Z3IX 2HJGA 3NH9A 5CDFA 2XSZA 1J8MF 2HUPA 2ASEA 1AJEA 1UF9A 4B6FA 4PC2A 1Z6YA 4M9SA 4C7OB 1QHYA 5HKKD 3TSWA 1KO4A 5FBQB 3TNFA 2MMGA 1AKEA 1ZIPA 1E9BA 3RS3A 3W6NA 2X8AA 3HJNA 3B1ZA 3SHWA 2GILA 4M4SA 5L3QA 4ABYA 3X1YA 2B8TA 1PVOA 2IYUA 3VHLB 5ANRB 2VSXA 5HE9A 1G1MA 2D62A 4B3XA 3HR7A 1W4BA 1KY2A 1JECA 1PZNA 1XU4A 4RVCA 5C4GB 1WDTA 4ESHA 2BMJA 3W6PA 4TQ9A 1NY6A 1RPZA 4FCWA 2DFNA 4Q48A 1CULC 2FGKA 4RCYA 5JJIA 1TPZA 4EDHA 5E3HA 1BS1A 2G0NA 2ZYTX 5JWOA 1VECA 1YZGA 3ECCA 5J4KA 1MR3F 1NY5A 2NZJA 3EPLA 2O52A 2VHJA 3BFVA 1OE0A 3A4MA 3TH5A 4CZ2A 2P2LA 2Q9BA 1ZCAA 1ZIOA 5FPHA 2DYKA 4B44A 3EIHA 1W0JA 3MJRA 1ZBDA 2GJSA 2D7DA 4W5WA 2OSBA 3EG5A 3U4QA 4BASA 1GL6A 1US8B 5FTKA 3L0PA 1EG7A 3A8TA 3U2QA 1G17A 2P65A 4IVRA 4HB3A 3CPHA 2J0UA 2CHQA 4PHTA 5EE5B 3T1QA 4M1WA 3UMSA 4TYWA 5FPTA 1OSNA 1G8GA 3OEHD 2PBRA 2VYFA 3SU8A 2WWYA 3THWB 4QGHA 3NG1A 4DCTA 5LD2B 1FW6A 4UKDA 2RHMA 3KQLA 1VHLA 2VLIA 3MCAA 4IOLA 3X1ZA 3K70C 1IXRC 4MDFA 1SXJD 2WWXA 5DYGA 4B48A 2ZRBA 1KHTA 1XEXA 2ZI9A 4D4MA 1EGAA 4HI0E 2G83A 4PC3A 4C0LA 3KQHA 3K9HA 2OAQ1 3AF1A 3CX7A 5EE3A 5EUMA 2ZRHA 2AX4A 3LA6A 4TWZA 3CB4A 4JZKA 1NVWQ 4AYWA 2CCKA 5SZJA 1E2EA 2QTVB 4N0EA 2QM7A 3GQBA 1I2DA 1AGRA 3CX8A 2O8CA 3F8TA 1GTVA 2GEVA 1Q0UA 4PQFA 1T91A 1Z83A 1Z08A 1E9AA 1G3QA 3ZVRA 3BJIC 1NVUQ 1TX4B 4OJKA 1UPTA 4C0KA 3GP8A 2VP9A 5FBWB 1S2MA 4EPXA 1HEIA 4TMZA 5F9HA 1W4RA 4LC1A 3EWSA 3UMRA 1N6KA 3FTQA 3ZQJA 3PFIA 2XITA 5HE8A 3TVDA 1KKLA 3EW9A 1U0LA 1RIFA 3KUCA 4D4JA 2A30A 4NCKA 1Z29A 3E5HA 4PZZA 1Q12A 1CR0A 2CK3A 2VP5A 1MRNA 2ZE6A 2JLRA 1IOZA 1Y63A 4XVQA 1LS1A 3IGFA 4WZBE 1F2TB 1NBMD 3CNNA 4TLEA 1NSFA 5BQ5A 3W6OA 2NMVA 1QHGA 4R7ZA 3UWKA 3WXMA 2QAJA 4TT3D 4MUBA 3T61A 1NI3A 3W8NA 2PMKA 3KB1A 3RS0A 2R2AA 2JLSA 2DHRA 4M9ZA 3SFZA 3FKSD 1TQ6A 1JXMA 5DIFA 1UDWA 2W2XA 3UKDA 3I62A 4M9QA 3ICEA 4PZLA 1JNYA 3W3ZB 2P6RA 3WHLA 3ZGXA 5FL3A 3F5FA 3HU3A 4KBFA 3X1WA 4LJ5A 3SC3A 4DJTA 2C2HA 4Q4JA 1E1QD 1WP9A 3JVVA 1LS6A 3QBTA 5HTKA 2WM9B 4AD8A 4Z54A 2CL7X 5BYKA 2WSSA 1IXSB 5EP3A 3P20A 3KJHA 4FCVA 3A1WA 2PJRA 3SN6A 1E99A 4KHZA 1FOEB 3QKTA 4G0NA 2QORA 4FINA 3MWKA 3TMKA 3K0SA 3U7GA 2GRJA 4KLZA 4MGYR 3KKNA 2HLDD 2R6GA 4GFDA 4RZXA 2MSDB 4OHWA 1P75A 3MLEA 4PHFA 1Q44A 5K8TA 3FGNA 3PEUA 4XIGS 2P5SA 2IW3A 4DHEA 3QSYA 3RC8A 4KV9A 4BLQA 2QNRA 1JR3D 4NONA 5FUWA 4GDFA 1GILA 4GI7A 5TY0A 2O8FA 1F5NA 4WXPA 5JWRA 4C3ZA 2UZ3A 3N70A 2ZAMA 4A8JB 2V54A 1RFLA 4GOXA 1ZNXA 3T34A 2O8FB 5AJWA 5B2ZA 1CLUA 4TMKA 4C0QC 4JKIA 1DAHA 2ERYA 1ZMXA 2BEKA 1DVRA 3ZD6A 2ZRJA 4KFRA 1G7TA 4AI6A 1VCOA 1U81A 3GJ8A 4IJMA 3THYA 5AUQA 1NJFA 1G3IA 2JJ1A 5F98A 3BB3A 2YWGA 2FFHA 1OXUA 3OAAA 5EE0A 3TAUA 3K1JA 2X77A 2QU8A 4X8MA 4V0OA 4OYHA 4O2RA 3V9PA 1M8PA 4OBEA 4B2IA 5FOXA 3QJYA 3L2OB 1EFCA 4PC6A 2QAGC 4LSGA 4XWOA 2GXSA 1Q1ZA 3E70C 2Z43A 2KI5A 2DY1A 2QAGA 1GNPA 521PA 2WWFA 4QBHA 3ZZUA 4AC9A 2RHDA 3SI7A 2OXCA 1A2BA 3U3JA 2DFLA 4YQFA 3PG5A 4E07A 3GLFE 1CRPA 3SS8A 4Q4HB 5E95A 1CS4C 3NH6A 4RD3A 4C0SA 1G4AE 1KJZA 1QRAA 2AD1A 2PZFA 1DELA 1MV5A 1NVVR 2QPTA 2ZANA 4IDHA 5EJEA 4X8OA 2A5YB 4F7WA 2QBYA 5JI2E 1NG1A 1BMFA 3U3OA 2ZVPX 5EP2A 2AFHE 4JVNA 5TDHA 2OCBA 5KNBA 1NKSA 1E9EA 4G01B 4O0MA 3OEED 4ZI3A 4F93B 2QMOA 3AVOA 3I4LA 2G3YA 4A0RA 3CNOA 2BWJA 2FPMA 1CR1A 1A82A 3ZLJA 1R5NA 4DKXA 1U98A 3KKPA 1RZ3A 3TE6A 5CB8A 2PMDA 3QG5A 1TL7C 5KNDA 4BEJA 3WMFA 4URXR 1WQ1R 3LRPA 5KU1A 4L16A 4D6PA 3GJ7A 2W6IA 2XTZA 4KBGA 2Z6VA 2QRNA 2GHIA 3GPLA 3ZJYA 3AB3A 2GCNA 1J99A 3CR8A 4WIAA 4EQ6A 4HLUC 1CF4A 1DAMA 2CCJA 3QF7A 3BXZA 1RVDA 4ZV4A 5KDLA 2Q3MA 2YV5A 2EFHB 3EPJA 5C18A 2CMKA 3ND8A 5IHPA 2VP2A 5HPYB 3H84A 1YR6A 2CK3D 4HAXA 4PO8A 5IK2D 2VP6A 1CEEA 4D26A 4IDNA 2IEZA 1CRQA 4TTQA 1TQ2A 4AY2A 1HE8B 4B2LA 3GD7A 5JJLA 4MRVA 4Q4LA 1FP7A 3LW7A 1GAJA 4JBWA 3KKQA 2WOJA 1OB2A 1G7CA 2H16A 2QG6A 3SZRA 1ZU4A 2G1JA 3QPVA 2REBA 4BZQA 2FNAA 5AK0A 5EXPA 3SYLA 3QXSA 2WKRA 5G40A 4OQNA 4IDOA 2IYLD 2ZPTX 2A5DA 4QBFA 3TUIC 4LJ9A 2VSOA 3NBFA 1QBKC 4BFXA 2ZRPA 1E2GA 2FEMA 3R9XA 3LAWA 4PO9A 4IVQA 5GJVC 5H68A 2AK2A 2O8EA 3T5GA 1ZUNB 1MH1A 3CPEA 1ZM2A 3B2EA 3QXXA 1W5TA 4DDTA 2QROA 1TTTA 4MYTA 2JLWA 3BH6A 3RS2A 4U5XA 1S3GA 2HT6A 2J7PA 2JA1A 1A2KC 4QGGA 4KXFB 3P27A 2OT3B 2JJ2D 1R10A 1XD2B 3LVRE 4DZZA 1D9XA 1QVAA 1X1SA 2CJWB 3F3YA 3L82B 1TEVA 3EIQA 4BRWA 4YMUA 1OT3A 1N6PA 2QY9A 1J7KA 3AUXA 4FXPA 4GT1A 4QG7A 2G88A 2OFOA 2HYIC 4C30A 1E2LA 5FI0B 5TMPA 1VCMA 3LBNA 4ZIRA 3CF0A 2JJ2A 1WMSA 4KLNA 4ILEA 3IHWA 4BQSA 3K70B 3A6PC 1Z06A 1KO8A 4DT1A 2X2EA 3ZYCA 1JPNA 3C16C 3CZQA 5DSZA 4CEIB 3H1TA 1J8YF 4AKHA 1ZUIA 1VIAA 4LYJA 1U94A 4BZXA 4PXAA 2GEUA 3G0HA 1XFAA 1KY3A 2CHGA 2R65A 2F3RA 2DR3A 2QGNA 4H1VA 3UG6A 3OZXA 2H57A 3MAAC 3TVTA 1AQYA 4Q4AA 5D3MB 3KJEA 1ZM7A 5JEDA 1MO3A 1NMZA 1OV4A 2A78A 3AP3A 1NL3A 3FKSA 5KDOA 1G9XA 1P7CA 3DVLA 2ERXA 3FHOA 4OHYA 1WCV1 5FUVA 4AKEA 4R71A 4RKEA 4ZDJA 2ZEJA 2ZE5A 1W2GA 2ORIA 3LX8A 1RRFA 4YDSA 3I72A 1EWQA 1DBSA 3CO5A 1XTKA 3EPKA 3CF2A 4V02A 2FWRA 1BIFA 3LXRA 1HT2E 5IRCD 1XMIA 4Q1EA 3RRNA 1KI8A 2OCPA 3MRSA 4QHTA 1KI1A 4QNMA 5SZIA 3UK6A 4ZCIA 3I5XA 1ZM3A 1DTSA 1E2QA 1L4UA 2OLJA 2GXUA 4UXIA 4C2TA 1JQJC 3DPUA 1UBEA 2ODBA 3FVQA 1XTIA 1NJGA 4QFMA 4XD7A 4NKRA 3RHFA 2BHRA 3Q5DA 1XEXB 3FB4A 3FHTA 4XWKA 3CIOA 3GLIB 2O8BB 1F2TA 2W6ID 4EPTA 1TUIA 5J4YA 1UFQA 3FYHA 4HAUA 2VBCA 1T5LA 1MO5A 1P61B 3OIVA 1EX7A 1GG2A 4AIIA 5C1BA 3MJHA 3O8BA 1Z6AA 1R4AA 3G5UA 5EXSA 4L8GA 4MKFA 3WYGA 5HCNA 1AS0A 4C7OA 1LV7A 3P32A 4BZPA 4ZI2A 3EXAA 1G5TA 3RLFA 4D81A 1XB2A 3QF4A 4DIEA 4TYQA 2O0HA 1KK0A 1HY3A 1O3YA 1GKIA 2BMEA 4ZDWA 4KSCA 2JDID 1BYIA 1G3RA 1I4DD 2ONKA 4Y0AA 1F6BA 1YR7A 3SBEA 2XB4A 1U9IA 3D6TB 4D80A 2ZSAA 4KFTA 4QBIA 3GLFA 3K0EA 4LJAA 2RGAA 4U00A 2WJJA 5EUQB 1WXQA 3BS4A 3WBKA 2O0JA 1XJ0A 3KKMA 4B32A 2DPXA 2IUTA 2ODWA 2RB4A 4P4TA 3QKSB 3DKPA 2WPDD 2CE7A 1E2FA 3LNCA 5AWFC 4DSTA 2QRZA 1QHSA 3LLMA 1Z0IA 3REGA 2F1JA 3H86A 4ARZA 1M2OB 3NEYA 1C1YA 1W0JD 4FIDA 4KU4A 1L4YA 1XPOA 3P26A 1RRGA 2GK7A 4PTLA 2V3CC 5KTYA 1CR2A 2QTFA 1E2JA 4GNKA 2RGCA 1I4LD 5CIWA 1M7HA 2JJ1D 5KNCA 2D74A 3LWNA 1XZPA 1OW3B 4JT4A 3AVXA 1KKMA 4OJQA 4YXWA 3Q9LA 2J0VA 3B8HA 1ZD8A 4TZ0A 2IX3A 3K70D 3SYKA 4B3CA 1AA9A 5DHFA 1KDRA 1US8A 2LCFA 4KYUA 2G9NA 3VR2A 1VYUA 4YMSA 5CIQA 3CWQA 5FOTA 4CEJA 1QG4A 1B0UA 2WWWA 5KSOA 3RRMA 3RYTC 5GJCA 1Y3AA 5HCIA 1N6HA 3QPUA 4M1KA 2GF0A 3QUSA 2V6JA 5K8UA 2R9VA 5JRJA 2ODEA 3QXCA 1DE0A 4PQYA 3FMPB 1QF9A 2AKYA 5FI1B 1VG0B 2HLDA 4B33A 4JBXA 4HEJA 1FZQA 1QG2A 2WAYA 1GWNA 2PT5A 5KOYA 5DI9A 4M8NE 4AG5A 1FQJA 3NDPA 2Z0MA 2F9LA 1YZTA 2J7PD 1AZSC 2Y8EA 4HAVA 1AM4D 3MWYW 3KXIA 4LJ7A 2JGNA 2Q3HA 3PCRB 4WXRA 1ZUHA 1MABA 2ZE7A 3T1VA 4DEXA 1XD9A 2ODNA 2J7KA 1KDTA 4BLRA 5JWHA 2FG5A 4PC1A 2AD5A 3QEOA 4ON9A 5BWMA 3OAAD 1E9RA 2NO7A 1KGDA 5G53C 1X1RA 4S2EA 4RY2A 2BBSA 2IWHA 2JAQA 1IJFA 4IDQA 4ZDKA 3ADBA 5F3WB 1E9SA 1G8YA 3AM1A 4RJLA 4P3YA 3Q7QA 1NRJB 3HDTA 5DI3B 3VKWA 1U99A 4BFSA 4DLRA 4E22A 1BH2A 3NIBA 3THXA 3U44B 2RKOA 3ZQ6A 2P6UA 1FTSA 1MRSA 3R8FA 4OQLA 5FBLB 1NBMA 2HT1A 3TSOA 5AUPB 2H18A 2OESA 4NDZA 1S4QA 2ZIAA 5J4HA 5KDDA 4G5QA 3ZIAD 2LKCA 2ZQ5A 2YVUA 1OXSC 2ZYWX 3D31A 1IY2A 4R2HA 3SQWA 4LUCA 2IYZA 3EPHA 4BFWA 2YOFA 4DB4A 1KI7A 1T9HA 2EFDB 2BIFA 3H4MA 4DC9A 1E98A 2N42A 1R0XA 2EYQA 3CPJB 4LV5B 1X3SA 4UJ3A 2WTUA 1T0JB 2XZLA 4B76A 4R98A 2JLZA 4B73A 1G41A 2OCYC 5B58C 3FDIA 3SFVA 3L0OA 1YKSA 2QBYB 3BWDD 4GRAA 3AF3A 4Q1AA 4M9XA 5AR1A 4TTPA 4AURA 1G6HA 1E1QA 2RAPA 1SXJE 1KOFA 3U6BA 3CKLA 1KZGB 3E2IA 4LK2A 1KI2A 1AGPA 3I5YA 3RRYA 1Z2CA 4KI0A 5UKDA 3GFTA 4WW0A 2VPPA 3IQXA 4UNRA 1FL9A 2DWPA 2ZI6A 3OEEA 1IN5A 3TUJC 4NMMA 4QNRA 2QGZA 5SZKB 2GXQA 2YYZA 3DMDA 1TF5A 4XJXA 2RGEA 1W44A 1N2CE 4CDGA 5FOWA 4W5JA 1SXJA 5FFMA 4Y0VA 1FMLA 3TLXA 121PA 2J59A 3SEAA 2CBZA 1S9HA 4UJ5A 3K53A 3AKEA 1R6BX 2BMFA 3M1IA 3CRW1 2WHXA 3CZPA 3OEHA 4JVMA 2ZJOA 3IEUA 3W9YA 1NSTA 1RKBA 221PA 3U3KA 1YZQA 3BB1A 2ZR7A 3TJZA 3WYFA 2FN4A 1E6CA 1RC8A 2UVQA 4CF7A 1XP8A 1EFHA 3BE4A 3RANA 1NLYA 4JLMA 3V4RA 3TK1A 2FV8A 1HT1E 1GITA 2CNWD 3C7KA 2RGXA 2IYVA 4MKHA 4UXJA 3TIFA 4F38A 1MOZA 2QPOA 3LX5A 3ZDQA 4KSBA 2E1RA 2W2VA 2FDCA 4BUJA 3EC1A 3IIKA 3O8CA 4CEHB 3PVSA 3TR0A 1IBRA 1ZM4A 2BC9A 4IOKA 4NYMR 2ANBA 2QAGB 2ORWA 4IEIA 1WF3A 3GFOA 3CW2A 2GXAA 2R6CA 1N6RA 1VDZA 2ZE8A 2V55B 3FFAA 1CBUA 4EUNA 4DDVA 1W4CA 2BM1A 3PUYA 1SULA 1CU1A 3CNLA 4URZR 2HXSA 4A0GA 3PR1A 2VIIA 4UXHA 4C0JA 4DDUA 4PSVA 2C99A 3GJ6A 4P4UA 2IHYA 1GFIA 4QJ3A 5E7IA 5FL7D 1RW4A 3QBVA 4PPGA 1E2IA 2ZR9A 4HSEA 5K8IA 1JJVA 4Z51A 4Q9HA 3KL4A 1GSIA 1XF9A 3P4XA 1BOFA 1AN0A 4LPSA 4US0R 4M1TA 4P4SB 4MGIR 4HDQB 1T0HB 2XSZD 3NXSA 1A4RA 3BERA 2PEYA 4GBMA 4LYHA 3TUZC 4TYYA 2PLRA 3R7WB 2P5TB 1FX0A 2YJTD 2WSSD 3GJXC 1JEEA 3EZ7A 4HLDA 3H0KA 4LRWA 3K0FA 2FFAA 2GK6A 3VU9B 1JAHA 2R6AA 4DCSA 1ZJ6A 4II7A 1N6NA 3B1YA 2R44A 5CM9C 5FOSA 1P72A 4M21A 2W6JA 3P4YA 2AFIE 1YHNA 2XZOA 1G291 2J9RA 2Q3FA 4D2IA 5GJWC 3LO5A 4BRUA 3B9QA 1EFTA 2YHSA 2WVJA 3CRMA 3EA5A 2G6BA 1XX6A 4BFUA 1CJUC 2A9KA 4US1R 1D2NA 2VL7A 1EXMA 3IPXA 4NCHA 2J41A 2IYRA 4QC2A 5L3RA 1VPLA 4BLPA 1E2KA 1CJKC 1PUIA 1Z07A 3KTAB 2C9CA 2ZITA 4HB4A 4LDJA 4LJ8A 1PLJA 2EWWA 1LY1A 2J5XA 4DLTA 3CRRA 3CX6A 2O8CB 4D4LA 5FOVA 2GAOA 2ZI7A 3CM0A 1G3MA 5IK2A 1V43A 2BBTA 3X2SA 4EQ6B 3WNDA 4TLAA 3U4QB 3THXB 2C77A 1CJTC 1N0UA 4LV6A 2KBEA 4M1MA 4M1OA 3GLFB 1RJ9B 1QHHB 1KI6B 2GAAA 2EYUA 1K5GA 2K5UA 4WOPA 4TN1A 4A4DA 2AN9A 4NE2A 3THYB 3LQQA 2OBMA 5BN3A 1G8PA 3BOSA 3IO3A 3U60B 4HDOB 3KUDA 1E0SA 1Q1EA 2IYYA 1XD8A 1DO0A 4HDCA 3SJAA 5JCPA 3L8ZA 3X1DA 5J4VA 4ZPXA 1KO7A 2BBOA 4KVGA 1U90A 4TQUS 1TF7A 4HZUB 4YLGA 3G82C 5GVSA 4KFUA 5JLJA 4Q18A 5KO2A 1TUEA 4JL8A 1FP6A 3BC1A 1W48A 1M7GA 3QKRA 3O47A 4P0TA 4Q1DA 4X8LA 1MKYA 3DEFA 2ZRMA 5DE3A 1E0JA 2FFQA 2J0UB 4V0KA 4TMTA 8OHMA 2F3TA 5CK4A 1WBDA 1Z0AA 3ZS9A 2YZ2A 1JQLB 3QKUA 2R8RA 4NHOA 1OH5A 1BMFD 2BEJA 2D2FA 2NGRA 1KYIA 3PIRA 3GEHA 4HAYA 2ZRAA 5L3QB 4BPBA 1XTSA 1YRBA 2A5FA 2WMOB 2J87A 2QTHA 5B64A 2NIPA 4IEEA 5DYIA 1PLKA 3U7FB 3MG9A 4LPKA 2NG1A 2FPKA 1G5PA 5BXQC 4DSUA 4R2IA 4UNQA 1SVOA 5ELXA 4HB2A 1KK2A 1N5KA 2QT0A 4EPVA 4URYR 2GDJA 4KVAA 4HUQA 2FSIA 2KE5A 2KB0A 3B13B 3ZZTA 4XVUA 1Z47A 2CL6X 4G5RA 3IPYA 1ZW6A 3KZ1E 3AVUA 2J0QA 2XOKA 3AEZA 1OH8A 3Q72A 5L3SA 5EE9A 4DLXA 3AKDA 2IT1A 5LD2C 3FMFA 3CF6R 4PO1A 5FPSA 4B75A 1OHHD 2ZRCA 1HV8A 2OV2A 3B9PA 5CITA 4Q47A 1E9FA 1ZRHA 4F4JA 1YZUA 5GADl 5CJ2A 2BKUA 3NBZC 5DGXA 421PA 1P5ZB 4A8JC 1RRCA 4QRHA 1GKUB 4MYCA 2J1LA 1XMSA 4NYJQ 2FSHA 3R20A 1LF0A 4JLJA 2UKDA 2FF7A 2ZXUA 2GVDC 5JI3E 4BWYA 3BAFA 3T12A 4M2LA 1OFIA 3ADCA 4LV8B 4HLQB 2ZRGA 3RSOA 3BFXA 2C9OA 2RH5A 4LJYA 4TLDA 1LW7A 4UNNA 3QPWA 2YC2C 1OIVA 3A37A 4NYIR 1Q3TA 5EXXA 3RAPR 1GKYA 2C78A 4C0AC 2GVZC 1X8LA 4C4PA 3D7MA 2EFEB 3A4NA 3LBHA 4V0LA 1JR3A 3R8CA 1COWD 1ZP6A 2LWIA 1K6MA 2GBLA 3EZ9A 3AVQA 4A6PA 4NCNA 1W1WA 1SVLA 2WV9A 3OESA 2IS4A 4OQXA 3L0SA 2VHCA 4BEBA 4QJ5A 2XEXA 4YMWA 4TL7A 3WRYC 2NO6A 3PEWA 2FPLA 4LCBA 4DXAA 4ASUD 4DIDA 2OAP1 2AKAB 4L9WA 4RCZA 1E2NA 1KDOA 3SJBA 4FWIB 4ACAA 1ZYUA 3B1WA 2JIZD 3ZH9B 3AVPA 4Q19A 4LOAA 3W8RA 2X2FA 2I3BA 1YR8A 3WRXC 4Q9KA 5D3MA 3FKQA 3KQNA 3DKVA 1N5JA 1JJ7A 2OILA 1YVDA 3T1TA 1IHUA 4UNPA 4JLDA 4Q7LA 4CEHA 5D3QA 3GLIA 1UKZA 1MO6A 3HR8A 4I1SA 2GJAA 3QKRB 2FA9A 4JLNA 5HR5A 3A1TA 1N5IA 4WZ6A 1JEDA 4AKIA 4B2PA 4V0MA 3EC2A 4QGAA 1YRAA 4M0LA 1W47A 5GJBA 3GFPA 1E96A 4HLUA 2AXNA 3TGPA 1T8TA 3HYTA 1TQDA 4DBLC 4TT3A 1UBCA 1YZLA 1SVWA 1P73A 1I2MA 5E7MA 4L15A 5G41A 4IVPA 3S1AB 2GCPA 1J90A 4WAUA 5JCZA 2JLUA 3SQXA 4LJ6A 5IT5A 2ATXA 3EARA 4HAZA 3UIEA 1JI0A 3AVTA 4TZ6A 1L2TA 3C8UA 1T3LA 2NO9A 3B78A 5SZHB 4E09A 2HF8A 3KQUA 2IYXA 2ZSBA 4I81A 1UKYA 1VHTA 4FW9A 3EZ2A 2QI9C 2H8KA 2OFWA 1JR3E 5FTJA 2CE2X 1Z6XA 1V5WA 4DUGA 3LY5A 4B47A 3AP1A 5H8WA 1DADA 5EP1A 4E5UA 1ZD1A 2GJ9A 1G20E 2GZHA 1IN7A 1W46A 3BORA 2IWRA 2CHVA 1II8A 1CIPA 1NIJA 1H8ED 2QMEA 4L5BA 2PCLA 2HCJB 1P2SA 2RCNA 3TSZA 4D25A 4C9BA 2O8BA 3PUVA 4DT1B 3HWSA 1N6OA 4MRRA 2VHQA 4TSFD 2TMKA 2QE7D 1N3BA 4OQFA 1E94E 4TYNA 4W9MC 1KI9A 1JALA 1U8AA 5C46F 4O25A 3TW8B 1S0UA 3QIAA 3D8BA 4EKDA 4L9SA 2RGNA 2JLVA 4MRSA 3MFYA 2EW1A 3SDZA 4ZIRB 4P33A 3AVVA 4FWTA 3E1SA 2JCSA 2ECKA 4URUR 3DOFA 1T3HA 3LVQE 1P9NA 2ZU6A 2BM0A 4PAOA 4TL6A 5CDFE 4NPHA 3WNCA 1DS6A 1P4SA 5HZHA 5BN4A 2G1KA 1EFRA 4CT4B 4JBYA 4RD4A 4MRPA 3IDQA 2HEIA 2A5GA 3ASZA 4HB0A 2QUZA 4RFSB 3D3QA 1KTVA 1P6XA 2QL6A 2H7VA 4UNSA 3FFBA 3VQTA 2IC5A 2W00A 3B5JA 1WE2A 2GKSA 3GLHA 1N6IA 4C2UA 4M22A 1ESMA 5AJYA 1LF5A 2NOAA 3K0CA 3NC0C 4A1FA 3KKOA 3KJIA 2PX0A 3OIWA 4NBSA 1CKEA 2FJUA 4EPWA 2Q0HA 3OFND 1XCGB 2XX3A 4NYJR 3GJ4A 1E2HA 1ZNWA 1F3OA 1X8KA 4RSGA 5G3ZA 721PA 1Q57A 1E9CA 1W0KA 2ZVQX 3R9IA 1M34E 5JS8A 2JLYA 2QMUA 4WVFA 4RD0A 3Q7PA 4TLCA 4Q9JA 4TMWA 3GLGE 3I61A 2NZ8A 1Z0DA 1KSHA 4NTZA 1SZPA 2YKGA 1N0VC 4DRZA 3WYAA 1QHHA 2IS1A 1SVIA 1G4UR 1ANKA 1YR9A 4IOMA 4AK9A 1Z6TA 4RD2A 3U5ZB 1EK0A 2WBLC 1LTQA 1IY0A 3OE7D 2P0EA 3OE7A 4W7SA 2ZS7A 1KIMA 5HKKA 2MSCB 1E1RD 1XWIA 3OIYA 5C2JB 4G3XA 3ZD7A 3K8YA 1VG1A 3W5IA 2XNSA 3VR6A 1P9RA 1ZINA 2EVWX 3UPUA 5A4JA 1D2EA 5J40A 5E7JA 1DO2A 1NN1A 1FNMA 5BW8A 3VKHA 1D2MA 3I3SR 3F0TA 1S3SA 2FU5C 4KYIB 1GNRA 3C14C 1A7JA 5TXGA 1DOAA 1VYVA 1T3SA 2ANCA 2PT7A 1F48A 2IXGA 1X8JA 3AQ4A 4ZKEA 3VR4A 2ZJ2A 1TU4A 5FUXA 4DCUA 1KO5A 4PX9A 1UAAA 1NN5A 3IEVA 1OIWA 3IIMA 1XEWX 1YJ5A 1NMXA 2IUSA 2Z4RA 3QNUA 3K0FB 2J0SA 5CLQA 4JIMA 1ODFA 1QVRA 4ZCLA 4LZZA 2GBLC 4Q1CA 4XH9B 1OXVA 2X1VA 4MDEA 2Q6TA 3AP2A 3KXLA 2DWQA 2FZ4A 4MRNA 1HUQA 1KAOA 4F92B 3DM5A 3WMEA 3NVAA 1QDEA 2H17A 4R9UC 1R8QA 2Z83A 4HAWA 4I1VA 2HV8A 2I1QA 1G19A 1W5SA 2OM2A 4JLVA 3MSXA 3QEJA 2ZJYA 3PV0A 4Q03A 3N2IA 1UBGA 2YOGA 4DSOA 2DFKB 3V4FA 2PZEA 2HJVA 4CVNA 2GWHA 2XJ4A 2ZUBA 2B7CA 2DCUA 3DO6A 3I73A 1IY1A 2CVHA 1E32A 4NH0A 5H70A 2OCAA 2ZROA 3IIJA 1OFHA 3GLGA 1R0ZA 2JJ8A 1UADA 1VMAA 4OHXA 1N0WA 1U8ZA 2AK3A 3AGQA 3GJ5A 2VEDA 2FMXA 2CL0X 2RGBA 4BLTA 4F91B 2HXYA 2FGJA 4ACBA 4Q01A 3RS5A 1XZQA 4PPNA 1M74A 4LHYA 2DFTA 4IRUB 2J3EA 4MYUA 1HQCA 1Z5ZA 1RE0A 1CTQA 4JLOA 5L8VA 1XDBA 4GP6A 3UWOA 1DAEA 3LD9A 4Q02A 3TBKA 4A0FA 2NQ2C 3QQ5A 4XWAA 5EZ5A 1G16A 1SKYB 1VTKA 5TV2A 2IYWA 1W4AA 4MGZR 2Z4SA 3TQFA 3QENA 4I99A 2A3RA 5FOUA 1P3JA 4LHXA 3QVVA 1OXXK 3VX3A 3BRWD 3KQKA 4OHVA 4K81B 3AF2A 1LB1B 3PQCA 821PA 4YMTA 4TMXA 2Z5FA 2AWNA 3W3AA 4URWR 4K8OA 2ONJA 1NNEA 4EFLA 3AUYA 4GP7A 2A5JA 3CUEF 4S35A 5LB2A 2Q21A 3CONA 1N5LA 1OH7A 1R0WA 1M6NA 3W90A 3NDBB 6Q21A 1U2RA 4MKGA 1H65A 1YZKA 2FEOA 3JZMA 1YE8A 1AIPA 4LGMA 4KJZA 1OJLA 2F7SA 5CM8B 4US2R 3CLVA 3LQRA 1OFTA 3ASYA 4XSHA 1E4YA 5KUTA 2PH1A 2EFCB 3B1VA 1KI4A 1GL7A 4NYIQ 3ADKA 3M6AA 5FTMA 1DEKA 4ESVA 4PFSA 1S8FA 4AKGA 3WBJA 1Z0FA 1R5OA 5TVKA 3FHCB 3VTKA 3L8YA 3I92A 4Q00A 1PLLA 1Z6GA 2C98A 1T6NA 4IKEA 1LVGA 3CH4B 1C4OA 4B71A 1G3UA 3K0AA 2ATVA 3TRFA 2D7CA 2XGJA 2WIAA 3EWAA 2PZGA 3KB2A 4RD6A 4EFMA 2V7QA 4KODA 1G8HA 4EAQA 4LYFA 4A2QA 1ZNYA 2WWHA 3ICQB 3SOPA 5DN6D 2B8WA 1SHKA 1PV4A 2H5EA 3I8XA 2GZAA 2IUUA 1R0YA 2QZ4A 1N25A 3AF0A 4G5SA 2JEOA 3FOZA 2OE2A 5JMTA 2F1RA 1D5CA 4QBGB 5CJPA 5DO9A 1XMJA 1HTWA 4KAXA 1G5RA 2FH5B 1XD2A 3WMGA 2I4IA 2Q9CA 2QENA 1COWA 3VX4A 1W49A 1XMVA 3NHAA 5JHHB 1OH6A 2ZREA 1E3MA 2GEDA 3TW4A 1UKEA 1E2MA 1Q1BA 4FI3C 4WZAE 2ZSDA 5JFGA 1BKDR 3PUZA 4Z8YA 2WICA 1DG1G 4F4CA 2ZJ8A 2R62A 2W0MA 3M4YA 2O8EB 4DLZA 1II0A 4DLWA 4RZ2A 4CYMA 4M53A 2GA8A 3ND9A 1FUUA 4EPYA 5JSZB 3VMFA 1R7RA 4DCNA 4YONB 3K09A 3OF5A 3GLHE 2YNMA 4QGFA 4O2LA 3H2YA 1HH4A 5AJVB 1E79A 4AYTA 3AV0B 4FMDB 4JSTA 4FD2A 4IW3B 3SNHA 1XXHE 1ZAKA 1E2DA 4MA4A 2BBWA 1XCMA 5EQTA 4DSNA 2CVFA 2A2ZA 2VTKA 4N1AA 2GJKA 1GL9B 4LWZA 5F9FA 1JB1A 1EFRD 4A82A 3A1UA 3BB4A 2XZPA 3NWJA 3PUXA 1EFUA 2FOLA 3ZS8A 2OXRA 2VQSA 1G6OA 2BCJQ 2XJ9A 2V8OA 4GL2A 1VG9B 4GMDA 3W5JA 3MMPA 1A5TA 2HDNB 2C95A 2BMDA 4P4SA 4HZIA 2YC4C 4URVR 1NIPA 3PEYA 2IK8A 4V0ME 5AUNB 3WP0A 1YZNA 2B7BA 1NKTA 3GMTA 3O8RA 2P67A 4FMDF 1M1YE 4RKFA 4ERNA 4ZKDA 3I32A 3NTUA 5FBRB 5FBVB 1T8UA 2V1XA 5A5GA 1ETUA 4FMCB 2ZS8A 4Q7KA 2O5VA 4JMPA 2ZYVX 1W7AA 2ZM5A 3KXKA 4PAMA 4D0NA 2JATA 1KMHB 2DBYA 4JLPA 4DLYA 1QHXA 1Z0JA 4C0BA 4GPTA 1NG9A 1G7RA 2WJGA 1ZD9A 3FPAA 1OB5A 4PANA 3B6EA 2YWHA 2EWVA 3OHMA 621PA 2ZRKA 1YU9A 3L0IB 1YQTA 1FNNA 3BGWA 5IDVA 3KDSE 1SKQA 2NO1A 4MQBA 1E2PA 4RZ3A 5FH9A 2ZRLA 1Q22A 1IM2A 2ZYUX 2GETA 3EASA 3RWMB 4DLSA 2O8DB 4BFTA 4EJSC 3NC1C 3U61B 4Z1MD 4A36A 4OI1A 4LC0A 4G5OA 5EXTA 2VF7A 5G3YA 2ZTSA 1Z22A 2CDNA 2CJWA 4IFEA 4QJ4A 4ARZB 4PQRA 5B57C 4B3FX 4TMVA 2V7QD 1Q3HA 3UXMA 1HYQA 5CK5A 1RJ9A 2WMNB 4PZYA 2IYQA 2PJZA 2W58A 2PL3A 4K46A 1H8HD 2V1UA 1W0KD 1OKKD 5KPDA 3UATA 1AKYA 1AK2A 2JLXA 2QQEA 4MITA 3PUWA 1D9ZA 1P2VA 1P9WA 3B7GA 1KMQA 2UZIR 1WRBA 4TL8A 2QN6A 4B6EA 4WA7A 1E79D 5FUYA 1CJVC 1EWRA 3AVWA 2ZJAA 1R2QA 1NF3A 1L8QA 1TADA 1VCIA 2ZRNA 1SXJB 2PCJA 3IQWA 3PENA 2AWOA 4NYMQ 4Q5IA 1Z63A 1FPMA 1KSFX 1W36D 3LXXA 2XXAA 1JXOA 1OLOA 1VG8A 2XNDA 5J5CA 2OO7A 1WBBA 4HYYA 2ZRIA 1K8RA 1S9DA 1NN3A 2H1LA 4LBVA 4A15A 5KSZA 2FSFA 4XTCS 2O0KA 1S1MA 1DAFA 1NMYA 1EESA 4LHWA 1OKKA 1ELOA 1GDDA 3GJ0A 2VF8A 1T4GA 1IN6A 3IBYA 3VKGA 4B43A 3SBDA 1GZSA 5KYKA 1UDXA 4FMBB 2VO1A 3DZ8A 2D4HA 1P2UA 1JBKA 2QEQA 4D0GA 4QM6A 4HUTA 4CEIA 4Z1MA 4B3BA 4ITRC 3R7WA 4C0HA 2SHKA 4A0HA 1Q21A 4LHVA 4TQAA 3DDCA 3MGCA 1R5BA 4JLAA 4B3DA 4TYPA 1NVXQ 3B85A 3WY9A 5B30A 5JBQA 5DN6A 2IS6A 1U0JA 4JVLA 4DB2A 3VNVA 1CJMA 2BOVA 3AF4A 3NBXX 2CLDX 3RNLA 2GNOA 2XXAB 1VCNA 2Q9AA 4BE7B 1SQ5A 3L43A 3QY0A 3GEIA 3RDPA 2GZDA 4KITB 3T5DA 2CXXA 4DLUA 2QA5A 4LBWA 4IOJA 5TARA 2ZI4A 3VR5A 3HYRA 3KX2A 1G7SA 2YINC 5H1YA 3BK7A 1KJWA 4Q66C 3GEEA 1QZXA 5E4FA 4O3MA 2OHFA 2F43A 4U7DA 4HATA 1DARA 4OI0A 1DPFA 2X19A 5LB4A 2VRWA 2QQ0A 3C41J 2WAXA 1JR6A 5JECA 1JPJA 1KK1A 3LDAA 4EPRA 4PAQA 1Z28A 3EIEA 3CRQA 2V6IA 3U3MA 3BD9A 4JJZA 2IYSA 2DB3A 1II9A 4HZUA 2B21A 1GRQA 2IBMA 2NPIA 3DHWC 3K09C 2VSFA 1FUKA 4BECA 2XOKD 4B74A 1X6VA 4Q21A 4LX0A 2C96A 3JZAA 1O87A 2ZRFA 4FN5A 2IXFA 5CYPA 2C03A 2QSYA 1GVNB 3FWYA 4RFVA 2XB2A 1ONBA 1KO1A 4N3NA 2E9SA 3R9WA 1FX0B 3VNUA 2ZUCA 3EZ6A 4RD1A 4DLVA 3K0CC 4JS0A 3IUYA 2YWFA 4X8HA 3ONWA 1TQ4A 3O8DA 1L7VC 3AKYA 3QVUA 4JL5A 4M1YA 1C9KA 4LJ4A 3ZVNA 3T1OA 4EJSB 3ZVLA 3FMOB 4QL3A 1W36B 1D8TA 1QHIA 3BH0A 4JSYA 2GCOA 1KJYA 3PEVA 2A7QA 4XVRA 3KJGA 2IXEA 1E0KA 4TL9A 1FTNA 1SVKA 1XJQA 2EQBA 3K9GA 3PITA 4N0DA 3HP1A 2NPFA 1GRRA 5CLLA 3A1VA 2LKDA 4NCJA 1AS3A 2VHTA 2V9PA 2BKEA 2HYDA 2B92A 3N2EA 2XTNA 3IBGA 4MUAA 4QHYA 2D06A 1FMJA 3RVBA 1LNZA 2VP4A 4DUGD 2IYTA 1E4VA 1D6JA 3RSLA 3ETLA 3CR7A 2F9MA 4JLBA 3DM9B 4CT5A 3SJCA 1SXJC 2E87A 4P32A 3Q5EA 4A2WA 2HF9A 5HZKA 1SVMA 4CW7A 1F2UB 3ADDA 2WJIA 1Z0KA 1ZU5A 1IN8A 2ZR0A 3NBYC 3RRZA 3VR3A 2IHBA 4GOJA 1W36C 1N6LA 2CLCX 3VFDA 2P3SA 4AWXA 4D82A 4V0NA 3A1SA 4OK6A 4EFNA 3C5CA 1K5DA 1T5IA 3PJRA 4HUQB 5LBIA 1UEIA 1UJ2A 2BDTA 2F1IA 5CYOA 4BLOA 1KNQA 2GESA 2QT1A 4H9GA 4Z8XA 3ZVMA 1W2HA 3EX7C 1CP2A 5JEEA 4G1UC 1XPUA 2XNDD 2WIBA 3AGPA 3LV8A 4Q4JB 3A58B 3WHKA 1E0AA 2ZI5A 3SJZA 2G77B 4EJSA 3IKJA 1RYHA 2AXPA 2KWIA 3LW8A 4U02A 2RMKA 4OI2A 3SR0A 5AUOB 3P1JA 4A2PA 4PPFA 2J45A 3DOEA 2OUKA 1XXHA 4A9AA 3VHXA 1GM5A 3GLIE 1OHHA 2IF2A 3K9NA 4EIWA 3B82A 2ZSFA 5FPYA 2NTYC 1NLFA 4B3GA 3K0AB 1XCPA 5LDDC 3C4JA 1H8HA 2KSQA 5DHAA 2ZRDA 1TF2A 4HLCA 2EFGA 4GOKA
chains in the Genus database with same CATH superfamily
1Z7EA 1YRHA 3HK2A 5A4AA 1P62B 3CRVA 4KN5A 4RVFA 5ITVA 4AG6A 4QDUA 1E20A 3BJZA 1NXPA 3K9LA 4ZI7F 2C5AA 1OPXA 5CEJA 2MMCA 3LYHA 3SYNA 4ZN6A 4PLFA 1LNSA 4LYAA 4CNBA 4M38A 4NCIA 4FB5A 3DEYX 3D2AA 4LBZA 3FPCA 3UV6A 3N59A 4DY4A 4E3ZA 5L95A 4GZMA 4MI6A 4W5TA 2MJLA 2DERA 2ZJZA 4JI4B 5A0FA 3QPAA 3U6KA 3GLHB 4JYBA 4XOIA 5LA6B 3UV7A 4RPGA 1VYTA 4IHQA 1QUFA 4UMVA 3ESYA 1Z35A 2OXTA 3RS4A 2VHEA 3KFXA 2B4RO 5SY4A 3WP1B 1XXHB 1A2OA 1ZCBA 1JHYA 4IEFB 2WOOA 4RWEA 4QYMA 4XWGA 2CNBA 2WJYA 4DR1B 5EERA 4U7GA 2WZQA 4AX4A 4EHJA 1CXZA 2GNAA 5JZBA 4H7IA 4HC4A 4JT9A 1QX4A 2XCRB 3EQ7A 1DL5A 1EQUA 3PVZA 3SHFA 4BNTA 1BA2A 4FGSA 4QOSA 4N5NA 3CUTA 1W87A 4W5HA 4NL4H 2YWJA 4NMLA 3LFUA 2IZOA 3KP1A 1XVIA 1CW2B 5A71A 4X61A 4B85A 2UAGA 2Q5IA 1X86B 3GRUA 3NYWA 4DJJA 1U0SY 4DCGA 3LY9A 2CUZA 2H4FA 2FZLA 4RHXA 4AMVA 1QTIA 4WBSA 3JRNA 2CLSA 3R7FA 1CZNA 4XJTA 1YI1A 2GX6A 4CN8A 4P31A 4YCSA 2NU7B 2ZTUA 2H08A 4HNAB 1IVSA 1G0OA 3R6LA 1V3QE 2ZJ5A 2GQ0A 1DAKA 1FQKA 1FDOA 3JQGA 4ZPJA 5TQ2B 1HE1C 1BROA 1XEWY 5K8LA 1GQ2A 2YWRA 3MBKA 3NHSA 4IG4A 2MTBA 4LAFA 1FYFA 4RZQA 4TTIA 4TSRA 1ZXXA 5J1TB 4Z1OA 2QD1A 2HPVA 2ZULA 4Q3AA 2GPAA 5DNEA 1G21E 4QXAA 4JXZA 1DJPA 1R9MA 3B1XA 1Y1SA 3U16A 2VF4X 4L50A 2CLLB 4D6XA 5ALVA 2J3JA 3RCBA 1BYUA 3WJAA 3WYCA 5ADWA 1HDOA 4ND1A 1T2NA 5A05A 3F9RA 3TXAA 2YJNA 1BO6A 2P2NA 1IK4A 3B60A 4FDAA 2QWXA 3ONDA 4BQFA 5CXXA 4YV7A 3QE0A 4G0XA 1WA5A 3GLVA 1TAUA 2QG9A 4O5OA 2QSZA 2TSYB 2EU8A 1VA4A 1Q0RA 3NKVA 3WNZA 5BN5A 2CY0A 4K9QA 1SURA 3O4JA 1UWVA 4K05A 4BO8A 1O8CA 3A6KA 1PTJA 4YJKA 2Z08A 4TSFA 1NJ6A 2VHUA 1IOLA 1O96B 4GG1A 2Y93A 2YN4A 2BN4A 5CXUA 2GZRA 4RBNA 4YAWA 3MGBA 1EYZA 2I80A 4O2AB 1A1VA 5DWQA 4YWHA 3K6RA 1BRMA 2VAXA 2CVPA 2RGGA 3CZCA 3HKEB 3KZVA 5EXDA 4AP9A 1P80A 2FKAA 1M2NA 1U9IC 5BNTA 1B4DA 1TXGA 2C84A 1D2HA 1ACMA 2ADFA 4GPAA 5FHQA 2ZUDA 3SEQA 4AYXA 1NQXA 2DF8A 2ZLBA 4PSUA 1MTOA 2OZEA 2ZAOA 3GLUA 4WOJA 4LWOA 3E1KA 2F55A 9MHTA 4YJGB 1UK7A 4EKEA 4RK0A 1WOMA 1ZUD1 2ID8A 1WCIA 2AH5A 4MV5A 3ZIUA 5C7YA 3Q8KA 5AJXA 3O3MB 3VVBA 1HL7A 1F0YA 1B26A 1TEXA 3G9TA 4I9UA 1QSGA 2QE6A 1MFPA 1PDVA 1UKVY 3T3NA 4HZGA 4C01A 1IONA 1K4MA 1RHKA 2QRGA 2VF2A 2W4QA 2YRWA 2ZWPA 2A8YA 3EA0A 3F47A 4MRMA 4TWRA 4JT2A 2PVSA 1TAGA 1UZMA 2FX3A 1JB9A 1CS0A 2X1HA 2FDXA 4PY2A 3N53A 1DTWB 1SCUA 1EDZA 4RESA 4WGGA 4UOZA 3AL3A 1GYRA 2W2LD 4NAHA 2O5CA 4EBBA 2XZTA 1HQDA 3WJ2A 5KJ6A 2IHTA 5CB6A 5KSPA 2J30A 3SXJA 2PWYA 1YKGA 1ICIA 4DVGA 5JVDB 4GWKA 1Y1QA 2NT4A 1KI3A 3DZCA 2SECE 2JGFA 1P6UA 3OQ1A 1B2RA 1E6UA 3KQMA 1QQ6A 4AF8A 1PQPA 3CLUC 4H60A 4IZIA 2XVXA 2EEPA 1PKXA 1DAIA 2AR0A 4NAVA 3S44A 5JRZA 1FDTA 4DJAA 1FFBA 1O89A 1YVRA 4K6FA 2IFTA 4XSGA 5K0GA 2CNWA 5B6JA 5BR7A 2PSSA 5JZOA 1H0SA 1NI4A 1XEFA 2R6FA 3LC7O 4UPEA 2GPNA 2AMJA 5JIBA 3NJ8A 4MINA 1XEAA 3WWYA 4D46A 1RS0A 1HQYE 2B6HA 2RK3A 3AH8A 3HKCA 1RRVA 4KUHA 4EENA 2YWDA 5LXTF 1XK7A 1JU3A 1QE0A 1WVMA 4NU6A 2D5AA 3D5QA 2X3UA 4F60A 4ADSG 1BU8A 2IU6A 3CWZA 2BH2A 5GINE 2C4HA 1KP2A 2R5FA 4IXNA 2R11A 4ETMA 5AQEA 1I4OA 3WNBA 1A96A 3BHMA 2OGWA 3BJEA 1XYGA 5M3BA 1X9IA 4BFVA 4HD8A 4DDMA 1XNRB 4AZ0A 3H5OA 5FUQA 4ASUA 2WHYA 2GTPA 1OFUX 4DRXA 4X1IB 1KVSA 2YDYA 3VC3A 1CEXA 1U2DA 1WXFA 2I8CA 3KOMA 3QG1A 4UFNA 2NU8B 3EXEA 4C6RA 4DUZB 1IAQA 3WLNA 1VKJA 2CBGA 4I4LA 4PSKA 1W93A 4E6EA 2REOA 1DIOB 3S3TA 2QD5A 4ZO6A 5KPJA 2BFNA 4HQ6A 3CBQA 2EATA 4MJXA 3VR4H 3DDNA 4DR4B 4YUWA 3ZE7A 3BL6A 4HWSA 4OLJA 5HQJA 1GRNA 4JJEA 3KELA 4JVSB 2BTQB 1FIUA 3QU5A 2LDBA 1BOOA 1VA5A 2E89A 2PRKA 3UJ6A 4RFSA 3DLPX 4YDHB 3C1UA 4JLUA 3EEYA 3K5PA 1IQPA 1UEJA 3KWMA 4D4KA 3FPFA 4FUQA 2MSEB 2P9CA 4KNWA 3SXUA 3V7WA 2E4ZA 2QRJA 2HZBA 4C14A 4LI0A 2UYGA 3B5EA 2Y6UA 1ESCA 2Q3BA 3ETEA 1NA5A 4MW0A 4Z2YA 1EZ4A 3C7DB 4IHAA 4UQOA 2KBFA 3DC7A 3IAS1 3U9LA 4BNLA 2FW0A 3T5AA 3CE6A 3EWIA 2C5FA 5MN6A 1NKVA 3JQ7B 3WL7A 4BFZA 4I1OA 1J2JA 4Q1BA 5AJZA 2X0FA 4PG8A 4FQ5A 5HIAA 4PPQA 4BTLA 5HIJA 4EF6A 3RJTA 3D3EA 5FTNA 2VQDA 1NWHA 3MRXA 4IXTA 2GB4A 1BE8A 3HYNA 2ZETA 3P0IA 1JHOA 4JR1A 4PNZA 3TLBA 4AS3A 2ZT7A 4FGKA 3TAXA 4DMGA 2HNKA 5K0EA 3HE3A 3AZOA 4GSYA 1N78A 2V4ZA 3HRHA 3P0FA 1KC3A 1TVCA 2VBFA 3CIFA 2YIJA 3K6JA 4QJBA 3T9EA 3TXYA 1NVVQ 2Q6VA 2XE8A 4OQMA 4KRYA 2Z1MA 1S8OA 4DFDA 2DX7A 2ZW9A 3CH5A 1NN0A 3EMKA 1L4NA 1SA0B 2HU5A 3RS7A 3TZ6A 3WO0A 4RTNA 1PJSA 2G4VA 4JHLA 3PXGA 4BBZA 5ED0A 2INGX 4K9MA 2XI4A 3QU7A 5IT4A 2QPAA 2HMAA 1JAYA 2D2EA 1GGHA 2H92A 3SM3A 3TD6A 3TDNA 4HY3A 1ILWA 3WMRA 3CUUA 3IE1A 2LIVA 1Y37A 3O2QB 1PJRA 2V5VA 3DDHA 5AVVA 1VHJA 2BV3A 1ZOIA 4EMBA 4A6XA 1N77A 1II8B 3L8FA 5EE1A 4AUMA 2A6PA 2XTAA 1IHYA 1VL1A 4P83A 4RDHA 2C0PA 4FK8A 1OI3A 5LZ8A 4I7EA 2GTHA 5DXJA 4X7RA 1OC4A 3ZX4A 1QZTA 5FR1A 4Y3UA 5JTUA 2P9FA 3ONEA 3IPCA 3T5BA 2IVFA 2C7BA 4R41A 1SXIA 5KTRA 5EJ8A 3BTVA 1EX6A 1RQRA 3A4LA 4V1CB 2JNWA 1AQUA 2EL9A 1CDOA 3CN7A 3U7EB 4CCWA 4IGKA 4R1QA 3ZLBA 1TK3A 4GICA 2OBYA 5I9BA 1TMKA 3AVYA 3S7ZA 1PUJA 1Z3IX 2Z2YA 3WKBA 3HJCA 1PR9A 2GZ3A 5KX5F 1B74A 4TKVB 5E6RB 1Z6YA 1W6RA 1LDGA 4C7OB 2XQGA 4V38A 3WB1A 4EY4A 4ZOBA 4KQEA 4FYKA 3TSWA 4BMVA 3LPAA 3TNFA 4M0FA 2EX1A 3IUEA 4P2GA 3VTAA 2OVBA 3MB5A 4DR2B 3HJNA 3IOBA 1QRUA 3FTCA 1VJGA 6AT1A 4OAOA 1B00A 4F1WA 3ZVKA 4ABYA 4UBIA 3A31A 3X1YA 3OCWA 4IKOA 5EWJA 2O6LA 3VHLB 3DL7A 5AP9A 1EP9A 3HDVA 1G1MA 4HJRA 1LCIA 3EUWA 4ALKA 1A9XA 4GS5A 1DUSA 4B3XA 3ZOZA 3I39X 3TB4A 1H23A 1SRQA 1Y9AA 1UZUA 1Z88A 2JA2A 2X5KO 5E8JA 3QVJA 1IEVA 4ESHA 3LPCA 3WSVA 1YO6A 1HE2A 3FTPA 3W6PA 3PXDA 4TQ9A 4XQGA 5DPMA 4Q48A 4WZAA 3ZXXA 1CULC 4IQGA 3B53X 5GM2A 2FGKA 5MDHA 1V6SA 2ZDHA 4WLFA 1KIAA 4EDHA 3W1EA 3OCUA 2G0NA 3DKIA 4OHCA 2JEZA 5BSRA 3ZCRA 1ORVA 1ZH4A 2PKCA 5GV8A 4C04A 1NY5A 4WLNA 3ZDZB 5JAMA 5JYEA 2X9GA 3GRZA 2VHJA 3EPLA 2DE0X 3DYIA 2PKEA 3L41A 3PX2A 3TH5A 5JMWA 1U0GA 1ZOSA 2P2LA 2QN3A 3LI2A 4IDFA 4KSYA 5FPHA 2AE1A 2DYKA 3IJRA 2QDXA 3TGWA 1FS6A 2OSBA 2FPGB 5DM70 4LOLA 2PVCA 1US8B 3O83A 5DXAA 5KQMA 1F8GA 4BY9E 1P0CA 4YUYA 3INYA 1FUEA 2W37A 3L0PA 2C7PA 5FBHA 4IVRA 1PQ4A 1VLHA 2H06A 2CHQA 3KB6A 1UPUA 1GU1A 4HB3A 1PU2A 4JJ7A 4PHTA 5EE5B 4M1WA 5HUQA 2GM9A 3UMSA 1J49A 1NMQA 3HV0A 3RK1A 2FZKA 1Z13A 4B82A 1PZFA 2D5LA 2PBRA 2VYFA 3ZHRA 5LD2B 3UJ3X 1GCOA 2C31A 3FUXA 4MJ3A 4PCUA 3AW9A 2HWUA 4DMLA 5I9LA 4AJIA 1UXIA 1IXRC 3R9KA 1JKFA 3C6BA 1SEVA 1CQJB 1L5SA 2QX7A 2WWXA 2ZATA 5G2OA 2G40A 3OZEA 2ZRBA 3WQRA 3QKWA 1XEXA 1O95C 2ZI9A 5AHWA 2BFEB 1UC9A 5EXEA 4B8WA 1AXRA 2JZOA 1MB9A 1P91A 1VIMA 1Y82A 3N0WA 4HH4A 4LA4A 1IBKB 3EWNA 4PC3A 4IJKA 1M2GA 2SICE 3RFVA 3FWPA 3DHNA 4YVFA 4E4RA 1ACLA 1FB5A 3AM5A 3HNPA 4RSRA 4E1VA 1KFKB 2AX4A 4E15A 4TWZA 1QIMA 3S8YA 1CYEA 1MAWA 1NVWQ 1YJ8A 2ENWA 5SZJA 2VDVE 2BT4A 1JWBB 3GQBA 5CFOA 1NBAA 4CTKA 1SBZA 4KQ1A 3GLKA 1PG5A 1KAQA 3BE6A 5G0UA 5CPFA 2Y1OA 1XJWA 4IQ8A 5T67A 2BFBA 2JFZA 3EY9A 3OMWA 1UMBB 3RYFB 3BJIC 1KAMA 5F1YA 1H6AA 1TX4B 3CSSA 2HI0A 4EPXA 3QYJA 5JYDA 1QIJA 2OZLB 3PPXA 4TMZA 1CS0B 5F9HA 3OIDA 1NC3A 2NZXA 3EWSA 3SHTA 3UMRA 1WV1A 1J8QA 1N6KA 2ZP1A 3FTQA 3ZQJA 5K0SA 3EQ6A 5DGIA 5EQFA 2XITA 2TECE 2W2QA 3A0UA 1KKLA 2CF6A 2VXBA 4YWJA 3NYIA 1C1XB 4NCKA 4PZZA 3CZ5A 2I9KA 1L5RA 1N2GA 3RYHB 4O02B 2HPZA 1ODJA 4P1ZA 5CJJA 3JAKA 4DA6A 2IH5A 1MRNA 4M36A 2ACWA 3F2IA 1T0IA 4QYXA 1T8YA 5TNXA 3UCFA 2VDKB 1QV7A 1RNLA 1GTJ1 2JBWA 4JUBA 3WRXA 2NMVA 1Y5NA 4F0JA 1GV0A 4R7ZA 3R5KA 3E35A 2COUA 3HH8A 3LBYA 2QAJA 3UWKA 1X7ZA 2QVZX 3W8NA 2WUVA 2PMKA 3E3OA 3QLUA 3GA0A 4OQEA 3H87A 2WYUA 4M9ZA 3FKSD 1JEYB 3SZLA 5DIFA 1UDWA 1C50A 4E11A 4HQ0A 3UKDA 3I62A 4GWLA 3ICEA 4XJSA 4K9DA 4LMBA 5ESRA 2DSNA 5H5JA 2XHEA 2ECQA 5FL3A 3WHLA 3ZGXA 3KOUA 1E3LA 1IZ9A 2G9VA 3PDHA 5HKLA 4YT2A 3IL2A 5B53A 4DCCA 1X1CA 4QDXA 4DJTA 1WP9A 3GUZA 5HTKA 1MOPA 3P2MA 3B6JA 3RQSA 2I66A 3WWDA 3HKEA 5BYKA 5EP3A 5ESXA 1J23A 5AM5A 3P20A 2OHVA 3A1WA 3SN6A 1ZIDA 5BQXA 3EH2A 3QKTA 2QORA 1DWPA 1LNQA 4PLVA 1V7CA 4RFLA 3ESBA 4BS9A 3TMKA 2YFQA 3TCKA 4D8XA 3U7GA 3GL9A 4BN4A 3TRKA 2DQSA 3GH1A 1QQ5A 2MHCA 3I42A 5HWSA 2I99A 2HLDD 3H5AA 4DA8A 4GFDA 4B6PA 3EFBA 1QF6A 4EG8A 3RFTA 3QNWA 3G0BA 2MSDB 4NESA 2PV0A 1YGPA 2AUTA 1P75A 1RR6A 3M83A 3MLEA 5AJTA 4JZYA 4FC7A 1V45E 1Q44A 4V0RA 5E9JA 4BRZA 3PEUA 4DHEA 2P5SA 1JDBB 1R6TA 4GH5A 2J31A 4KGVA 5JC8A 3QSYA 1ACJA 1W30A 3NM4A 5TQ2A 4GDFA 4GI7A 3AB8A 4YYEA 3FA2A 2YZMA 2B34A 4ALJA 3FCYA 3MAGA 3OLVA 3A4YA 4QU0A 3UENA 3VR2D 3IAXA 4GMFA 2G4CA 5DH9A 3EDYA 3IKTA 1E92A 2O8FB 4M8IA 5B2ZA 2HQSA 4QRDA 1LLQA 4L5AA 4HN9A 2ERYA 4Y18A 3H2BA 8LDHA 4TRJA 1AQJA 1Q2UA 5D84A 2ZRJA 3BFJA 2P7HA 4I1IA 1VCOA 7ABPA 5DCWA 1AF7A 2RB5A 5GZ6A 3IV9A 4R83A 1G3IA 2LW7A 1Y5MA 4BNWA 2H85A 5EE0A 2Q1XA 2L2QA 3OAAA 5A4FS 3TECE 1XE3A 3AO0B 3TAUA 1PR6A 3K1JA 1XTPA 2H7YA 1Y1RA 3O4VA 3OOSA 4B2IA 4IRMA 1XF1A 5LIPA 3W5DA 5CVTA 2I7CA 2QAGC 1QFZA 3GJSA 3RJZA 1THZA 2QZSA 3DPSA 3GRFA 4I5GA 2QRUA 2VDRB 4CKYA 2KI5A 5I8ZA 4AULA 4F2WA 3GGPA 5IVPA 2VPXA 1BXKA 3MMXA 1IAVA 3M4ZA 2MINA 2WWFA 5JASA 3CUVA 2RHDA 3SI7A 4GIBA 1KPGA 1RQNA 3PI7A 3KYJB 2OXCA 1A2BA 3UJPA 4HP8A 4DANA 1JQEA 3JWGA 4YQFA 3O0DA 3O3OB 2MOKA 3NH6A 3T3EA 4PNHA 1KJZA 1WLSA 3AR6A 1EDEA 5IAKA 4P86A 4PS0A 3HDGA 4C88A 1UBLS 4WZBB 1JU4A 1OBHA 2G5CA 2WTMA 4IDHA 3KM0A 5HCUA 5LA6A 4WNYA 3WGOA 1MPXA 5CEFA 5AVUA 3IP8A 2A5YB 1FVOA 1NFRA 4P54A 2H7CA 2HREA 2UZAA 3DKRA 2AFHE 3BA1A 2MSWA 3GFRA 1NKSA 2P9YA 4XYMA 1T6YA 4G01B 5KNBA 3E5RA 4FLFA 5EKUA 4QYIB 5FFNA 4MQ6A 2BWJA 2I2WA 1CR1A 1A82A 4UTPA 2V45A 5KYUA 5JR3A 3Q1LA 4QD3A 3TOVA 2ZIZA 1TL7C 2ODAA 3I45A 4BEJA 5AVYA 4RW0A 3EGOA 1WMBA 2OD9A 3PPWA 1Q11A 2HD4A 3F7MA 4D6PA 3GJ7A 1N0IA 2MINB 3NC4A 3GAFA 3R0XA 1I9GA 1MDFA 2JFFA 2PT6A 3D7SA 3H9JA 4JGIA 1RIIA 3GPLA 2R79A 3RBVA 3AB3A 2GCNA 3CR8A 4EQZA 2IRWA 4RM2A 1I5OA 3HJTA 4ARAA 5JNTA 4K9SA 2UYQA 3SJ7A 2QKYA 2Q3MA 4G4JA 2EFHB 4ANFA 5KX5B 1DMSA 3EPJA 2B82A 2CMKA 3UO8B 2Z6AA 1WEHA 3CR3C 1YFJA 4FB4A 1TCVA 2Y1FA 4EUKA 2CK3D 3OKAA 4HAXA 1OWLA 4LXXA 4PO8A 4XB6B 5CNIA 2OXIA 4ER7A 4OEHA 4EB0A 1CRQA 4BEWA 4EBFA 3I01M 2CD7A 4OHOA 1XKTA 3LUKA 2P75A 3ORQA 4Q4LA 4XB2A 2A59A 5LIRA 5GGXA 1O58A 1GAJA 4JBWA 5K6AC 4EI2A 4UEKA 2ONYA 4FR2A 1N1MA 4ZEOA 1QR6A 1VJCA 2PS9A 3ELYA 4HEA6 3QPVA 3WS7A 1NW3A 4FKMA 2X9QA 3KB8A 3O92A 4BZQA 2QLBA 4KOEC 3MBIA 4J6EA 1D1QA 1M34A 2PBFA 4HNRA 1YE5A 1F4PA 3IXMA 4CKEB 4IDOA 2IYLD 2ZPTX 3NHFA 1WZIA 2E21A 3TUIC 3COJA 1U7ZA 3D0QA 3EVFA 3HUEA 1AKNA 5FLEX 4AICA 4CKWB 2FEMA 3R9XA 1V2GA 2JBHA 2CWDA 2H1OA 3KU1A 3TGLA 3A6LA 5GJVC 3OETA 4LCJA 4HWGA 4YRSA 4YCLA 1ZUNB 3CSDA 3CPEA 1ZQ1A 3GG9A 3FWNA 2Q4RA 2WA2A 5K0JA 2WNHA 5KQPA 1ISGA 1KQPA 3MOIA 2B5WA 3LUHA 3F5QA 2BFPA 4KDFA 5JANA 2HT6A 5HJ7A 3TDMA 2JA1A 5D85A 3TG8A 2XLBA 4X1KB 4KXFB 2BFBB 3DE6X 1C9JA 1QKKA 5B3KA 3QRWA 2JJ2D 3VZRA 1QO9A 3QITA 4CQLB 3LLCA 3QWBA 4RY9A 2ES4A 3F3YA 3ZLVA 3HDHA 3EIQA 3EQ8A 2IP2A 4I9NA 1PKEA 3IB6A 2G28A 3AUXA 4BRWA 1XTTA 2GEKA 4FXPA 3T4UA 2W7TA 3R0IA 4DLPA 4GT1A 2G88A 2VJDA 4FGZA 2R7NA 4UCXA 3IVMA 4C30A 3UAYA 1TM1E 1VCMA 4MW7A 4ZIRA 4XGNA 5CTJA 4YJHA 3RSFA 3V3KA 2WJWA 3A6PC 1U1FA 4F5DA 5H81A 3ZHUA 1KO8A 3B36A 2R8XA 1LBEA 2VZ0A 3L1HA 2X15A 4XPZA 2EKQA 4XIJA 3ZYCA 3CNQS 4OMUA 1JPNA 1M1ZA 1NP7A 1J0AA 2ZJ4A 4Y98A 4ZVQA 4AJJA 5IWAB 3CZQA 3PRKE 4EZBA 1J8YF 4AKHA 4DA7A 4EY3A 3F7OA 3CVVA 4ARSA 4YRQA 4RA9A 4X24A 4ER3A 2GEUA 1XFAA 2CHGA 5FEUA 2GTIA 3MJTA 4J0JA 1MJGA 1ZBQA 2H57A 3WVNA 2R5WA 2XDWA 3MAAC 1ILEA 1Y3CE 1AQYA 3TVTA 5D3MB 1EK2A 4ZRDA 5C7LO 3FSEA 3FDZA 3ZGYA 5JEDA 1V9LA 5DIZA 2A78A 4I50A 3AP3A 5T41A 1NL3A 4KQMA 4YEDA 4K28A 5F4ZA 5KDOA 2OQ2A 2FN9A 4B0PA 5C51B 2QQGA 2ERXA 2ZQZA 1WCV1 1ATZA 4IUYA 2GASA 2NSJA 2HK8A 5F7ZA 5FUVA 4WLVA 2M9MA 2ORIA 2P4UA 1RRFA 2YMPA 3GGDA 4QDJA 1N9ZA 3WWOA 1BJTA 4JN6B 1GU7A 3C1AA 1C29B 1W19A 4PLYA 1DBSA 4I5IA 5T4HA 3B3QA 3LXRA 1N9GA 2GN4A 1YHZA 4ZQEA 3EVNA 4Q1EA 4TS4A 3UK6A 2IXAA 4ZCIA 3I5XA 4R1PA 3NOQA 1ZM3A 4B6JA 1DTSA 1E2QA 1NPYA 2XWSA 1L4UA 1GQFA 3AHFA 4LIPD 4YAGA 2P11A 3DPUA 3LUGA 1NJGA 3DWEX 4RPIA 2X7XA 3EDMA 3HVIA 4C22A 2NVBA 2PGXA 1XEXB 1CY8A 3UWMA 4HDNA 4LJLA 4AMGA 3IAM1 1T9GS 3OX1A 4EMTA 1Z5GA 2C3PA 1Y8CA 5GV7A 3SXPA 1TO1E 3GLIB 1F2TA 5C9ZA 1SCJA 1C7JA 2GBFA 4D0RA 5IM4A 3FYHA 3TLKA 4HAUA 1BKSB 2VBCA 4KGZA 4L2IA 3T7SA 4M9UA 1GG2A 4EY6A 2MT9A 4H1WA 2AI1A 5C1BA 5FYDA 4DREA 3O8BA 4M98A 3CURA 2WKWA 2P4EA 2FPUA 4C29A 1JFLA 4MKFA 3WYGA 5CH3A 7GPBA 1NQOA 5HPYB 2HAEA 4Z0HO 1Z4MA 2RG1A 4DYVA 4C7OA 1T1SA 1LV7A 4GI5A 3AERA 3H4VA 3ND7A 4OJYA 2PRYA 3EQ9A 5BOSA 4HEQA 3UTDA 5C81A 1B6SA 4TYQA 1GTSA 1KK0A 1O3YA 4IDGA 3ZCSA 2BMEA 3FF4A 4N5HX 4X97A 4FXOA 1LQUA 2BLNA 1X0VA 1YR7A 3BMXA 3SBEA 1U7WA 5CB4F 4BNVA 2H1CA 3IP9A 3PQ6A 5T3YA 1D4OA 4BGEA 4M54A 3ERCA 4LJAA 2OFPA 2WJJA 3BS4A 3DVQX 2BM9A 4OJTA 2WHQA 3BXEA 4NNPA 4PWYA 5A9SA 1KYXA 2DPXA 2RB4A 3JTEA 3OZGA 1IZYA 2ZSHA 1N5OX 2RI0A 4KL8S 3N6XA 3FM9A 3LT4A 3O4RA 1QHSA 1Z0IA 3REGA 3NEYA 1W0JD 3PZRA 4FIDA 4YRMA 2BGWA 2WAAA 4G9EA 4IV8A 2P5UA 3K15A 2V3CC 2DECA 5ALWA 3PUIA 1VCHA 4NZOA 3OLWA 4UOQA 1OI2A 3WE7A 1V6AA 1B0ZA 3ID6C 2QTFA 3NHWA 1ZSYA 1X8XA 3M6UA 5CIWA 2A57A 2NVUA 3AVXA 1XZPA 1OW3B 1V95A 4FHGA 4IIUA 4BX9A 1DO8A 2X22A 4ERXA 1KKMA 2AVDA 3IQEA 3Q9LA 4P3NA 3WWEA 1RBQA 5I51A 1GADO 3K70D 4OGKA 3SYKA 4UUOA 1UK8A 2WPNA 3H16A 4MUNA 2MDTA 5F2KA 1YZYA 2VAVA 4C7BA 1KDRA 5HXAA 4C7VA 4KYUA 4F4FA 1A71A 2RGWA 1AGYA 3ZW8A 4R1SA 4CM1A 5CEEA 5L6MB 1YVPA 1B0UA 2BW0A 1N6HA 4PZUA 4YJFB 4XLZA 3L6OO 3N74A 4XUCA 1Q19A 1XYVA 5EPEA 1T2AA 2V6JA 2HWYA 3ROZA 1RWWA 4AS2A 2YJ5A 3JZDA 3L7AA 4BC0A 4EM6A 5JRJA 4NECA 4Y9UA 3HSKA 1EDDA 3AIOA 1KEEB 2HA5A 3OCXA 1PJAA 4AN0A 2YY5A 5FI1B 5JDIA 1G2OA 4GZ6A 2PIDA 5CVJA 4LMRA 4JBXA 4HEJA 4O59O 2QRKA 3TIXB 1U1GA 4YFYA 3PUHA 4RVOA 5SY9A 1Z2EA 1ECGA 4RO0A 2JIOA 1QO7A 1E7YA 3UN1A 5C5CA 4EKNB 4K0RA 3OJWA 1I30A 3AUFA 1NT4A 2PE5A 1GA6A 2PD6A 4W1QA 4B3IA 3MWYW 2N75A 3KXIA 4LJ7A 4WXRA 2YY6A 1VSVA 3PCRB 4DEXA 3KOYA 5K6AA 2WQ7A 4P0PB 1L8LA 4GLLA 4YRIA 1N7JA 3ZZMA 4A27A 3HNRA 3BGSA 3STXA 2J9YB 3MWEB 1ZCJA 4AQ7A 3QEOA 3BTUA 4RANA 4P35A 1E9RA 5KNCH 3WIEA 1SHJA 4S2EA 1ZGBA 2CVOA 2IWHA 3PICA 4AJ9A 2JAQA 5KNLA 3AI1A 1BCRB 1CUBA 1V35A 5AI4A 2VP3A 4OREX 3ROFA 3V1KA 2CLMB 3BK2A 3IP1A 4KN6A 2ZGVA 4RJLA 3DV2A 3HDTA 1R8JA 5DI3B 4BNUA 2NXJA 3PJDA 4HADA 3VKWA 1U99A 3V7YA 4BFSA 2W22A 1QE3A 3AU9A 3O3CA 4P3XA 1M6YA 2AG8A 4B6QA 2BEWA 3R8FA 1MRSA 1PJQA 1I80A 3HBAA 1NBMA 1G21A 3HEMA 3OCYA 4ZI7B 2HT1A 1QH1B 3U5TA 4RIFA 2AQ8A 3PF8A 1J8VA 3ZUGA 5J4HA 2ZT8A 4WDRA 4G5QA 2DEUA 2LKCA 4XLTA 2XMPA 2ZQ5A 1FLNA 1GPKA 3B6ZA 5LMZA 1IY2A 1LSSA 4BO3A 4B4DA 2Q5EA 1DQPA 4DQLA 2K2QB 4BFWA 4MUYA 1NZJA 2C4NA 2EFDB 2ZYDA 5JYCA 3EJWA 3DNPA 4DC9A 1E98A 3CPJB 1TKAA 1YDMA 1HDGO 4KVFA 1RABA 2ZTHA 5DB4A 3CEJA 4I9GA 4R98A 4QO8A 2Z6QA 2HSJA 4AZ0B 4UM9D 3WK8A 3FD8A 2VYVD 3PXCX 3L0OA 1YKSA 4GXQA 2ZK7A 2QBYB 1RM3A 4Q1AA 2CHFA 3CVXA 1VP3A 3RT7A 2PX8A 3EPRA 3SOZA 4B09A 2B2NA 1P9OA 1SXJE 1KOFA 3JQDA 1Z4PX 1M2KA 1KI2A 1AGPA 4GKVA 4PEVA 3KSBC 3I9OA 4J9VA 5CBPA 1UC8A 3M6MD 5IWCA 4XD2A 4QYTA 3HN2A 1TT7A 1PWXA 1USVA 1V16B 2XIJA 3OEEA 4FS3A 2XT9A 1DOZA 3WSTA 4GC5A 1O77A 2C2MA 1UEXC 4NMMA 2QGZA 5SZKB 3IHTA 2GXQA 3GOHA 1M2VA 3Q41A 3WYEA 1ZR2A 1QBGA 1UJCA 4W5RA 3BCHA 4CDGA 1I1OA 1FMLA 2WTBA 1VJ0A 4PPYA 2X1MA 3OX4A 121PA 2H4ZA 4D92A 4ZP1A 3OLXA 1S9HA 3H2GA 4TTJA 1PAUA 4O4LB 4IIFA 3QMWA 3C3JA 3PVCA 1CT9A 3CZPA 3DO8A 4R1OA 3OEHA 3ORHA 4AJ2A 4HCJA 2ZJOA 1OX4A 1TW3A 4BJ5A 3W9YA 1D2CA 2DQYA 2QN8A 2R86A 221PA 4PX5A 4AMUA 1YZQA 3FVVA 1OT5A 1RHQA 3LSYA 5IAOA 5KYTA 2HLHA 4S1WA 1EFKA 4RETA 4I36A 2Q2VA 1E6CA 3LRTA 2UVQA 4I2VA 5TF4A 4CF7A 1RC8A 1XP8A 4MWZA 2PMCA 1PT6A 2ZYHA 1X70A 3OU7A 4NBLA 1MEEA 3JY6A 4ENSA 5C8YB 4KPFC 3OCCA 3WQSB 4FJ0A 3CLRC 1XVVA 2FV8A 3KWLA 2XYRA 4NMXB 1HT1E 3C7KA 3G8YA 2RGXA 4MKHA 2DUMA 1A1SA 1U3DA 2F67A 3EVCA 3X1JA 3QX8A 5CB0A 4KSBA 3NB0A 3IUQA 2W2VA 4RKYA 2FDCA 4R9NA 4AUNA 4ECAA 5AW4A 1PJ3A 3LC1O 4CEHB 1HZZA 3PVSA 4NC9A 1IBRA 4JI1B 1ZVVA 4BU0A 2EQAA 4IOKA 2BFDB 1JJFA 4AXXA 2QAGB 5KQGA 1WF3A 3GFOA 4M1QA 5DCUA 2ISSD 1Y3HA 2PBLA 3GK3A 2BR5A 3E81A 4BX0A 2B1IA 4AKSA 1W4CA 1TU0A 4I6JA 1BNCA 5F51A 3BRCA 7MHTA 1FMTA 1YCFA 3KHKA 3PUYA 1SULA 1ND5A 1CU1A 3CNLA 3D4OA 2Q4DA 4WECA 3O1IC 5L7TA 2FZWA 2HXSA 2FW8A 4KO3S 1L3IA 4C0JA 4U39A 1DCMA 2C99A 1UDCA 1YBMA 4P4UA 2IHYA 4WJZA 5A3VA 3U40A 2PXAA 4KWCA 4CLOA 4Z4QA 5FL7D 3QBVA 4PPGA 4CR6A 2ZR9A 1BWRA 5LU8A 4Q34A 2CLOB 4UHFA 1H94A 4Q9HA 2HRBA 3U26A 1XF9A 5JPIA 3SHQA 1F7VA 4F5YA 2YZKA 3I2KA 5ALJA 3LVBA 3OZSA 3EE6A 4P4SB 1CUXA 1UBNA 2XSZD 4K03A 1E58A 2IDKA 4XWTA 4CKBA 1QGED 2ISQA 4LYHA 1XLUA 4TYYA 2CLFB 3O74A 1VGRA 1EK5A 3CNBA 1FFSA 1RZUA 3FDXA 4BMCA 1TM2A 2RGUA 7AT1A 3GPDG 1JEEA 4QEKA 1L7BA 1IHXA 4X45A 5E2AA 1WL8A 8ADHA 4JBGA 1SBYA 4G36A 1G0NA 4QQNA 2RH8A 5AHRA 5A1TA 1M5UA 4DCSA 3HHEA 1O8BA 2PFGA 3ZLUA 3W5HA 4RE6A 2LIPA 2P2YA 3GB9A 2ATCA 5CM9C 1U1DA 3UY4A 4C2BA 2YQ4A 1G42A 2DETA 4XXHA 1FRQA 3GEDA 4DZRA 1G291 3R3UA 2XZOA 5D3KA 4D2IA 1RHRA 3ZU3A 2LNDA 2VDUE 4KX5A 4MUXA 4PFQA 4RA6A 2DAPA 1EFTA 4J1NA 4NBTA 4BCDA 3Q10A 2B98A 1ZLXA 2K2WA 2G5TA 2WLSA 3STYA 2GKGA 4ATNA 4YRRA 4KP7A 3LE8A 1EXMA 1FDVA 5KCMA 2IYRA 1A97A 4QC2A 4RMNA 3WLFA 3COPA 1VPLA 4NX2A 4IUBS 1FYEA 3MRTA 5CLJA 2IPLA 3HVKA 4BO4A 1FMCA 2J5BA 4A3SA 2RBKA 5AD1A 1LY1A 4POOA 5JXIA 4DLTA 1VZ3A 2ZI7A 1F1JA 1WDLA 1V43A 2BBTA 1MD9A 2ILVA 1V6CA 3KRTA 4TLAA 3X2SA 5HRCA 5LP1A 3DZFA 2V03A 3LGXA 3RSHA 4J29A 5JISA 1AE1A 3QELB 2VQ3A 4LV6A 2CFRA 2IGBA 4M1OA 1RJ9B 3UFXA 1XTBA 3N2ZB 4R8RA 4XASA 2ERCA 2ZG6A 5F35A 4A10A 4C6SA 1K5GA 2K5UA 4UUNA 2XYHA 2C2ZA 3M89A 4NE2A 2R60A 4XYEA 3PEEA 4A4DA 4FGWA 1JG6A 5IJ0B 1PBTA 1PJ2A 4ISCA 3S8EA 1G8PA 2DLCX 5BW6B 1IHOA 3UJ8A 3UM9A 3KUDA 4J0HA 1E0SA 3J81A 1V25A 3LX4A 3SJAA 3I04A 3CLSD 3X1DA 4DQXA 4GBED 4CKZA 2RJ3A 2VS1A 2UVPA 2D2IA 2VWPA 4KQCA 1Y98A 4Q18A 1DRKA 1J97A 2C92A 4HX9A 2QJOA 5ENVA 1W48A 3IQDB 1ENYA 1MKYA 1ZA1A 1VDMA 3N6VA 2J0UB 4V0KA 5ALLA 3JAWB 5GIPE 2COKA 4FZ5A 3QKUA 1GLGA 5LXTA 1PV2A 4NHOA 4RQUA 1DC7A 3MOSA 3W8DA 1BMFD 2BEJA 3PIRA 1P1FA 4LDNA 4J16A 4XQCA 1P1JA 3FROA 1QHEA 1U7HA 4BTVA 3RBXA 3WI7A 4ITUA 2WMOB 2NIPA 4FI3F 1Z25A 3W5VA