2A7QA

Crystal structure of human dck complexed with clofarabine and adp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
229
Chain Sequence
b'RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxycytidine kinase
publication title The structure of human deoxycytidine kinase in complex with clofarabine reveals key interactions for prodrug activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2005-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a7qA00
2GJAA 5K8TA 4Q4AA 5FPTA 4Z51A 4I99A 4KCGA 3VX4A 2J3EA 1E2QA 3NBXX 4BRWA 3THWB 2JDID 1NLYA 1JXOA 5GADl 4LJYA 3I1FA 5JECA 1E9EA 2F43A 4JT4A 3VTKA 4AKEA 1FMJA 3SYLA 1E2LA 1HYQA 3G0HA 3CZPA 3BFKA 2J59A 2VP9A 2QT0A 4DDTA 2UVQA 1GP2A 2VPPA 2RGAA 2ZS8A 1JEDA 2K5UA 5CJ2A 4PZLA 3THWA 1AS0A 4EFNA 3CF2A 4LSGA 2ZYWX 1E2PA 1ZC3A 3Q5DA 3O8DA 3OEHD 3QPVA 2CHVA 5FL3A 3ADDA 4DCUA 4A0RA 1TEXA 3ADBA 1R0ZA 4C0AC 2WIAA 4B3XA 4NZYA 4ZDIA 5AJZA 2UZ3A 3BH0A 4ZDWA 3GJXC 5JI2E 3TLXA 1JJ7A 2IC5A 4BEBA 3WMFA 2YINC 2B8WA 4BLPA 2IEZA 2D74A 2JASA 2IHYA 3ZIAD 2XTMA 3U7HB 1YZUA 3SBDA 3EZ2A 1U81A 1KAGA 2W6ID 1XCPA 3EAQA 3OIUA 1A4RA 1XXHB 1IN4A 1XXHE 1Z0DA 3FKQA 4PPNA 4NYMR 1GNQA 4KFUA 5CK5A 1Z2CA 1J2JA 1Q1BA 4WXRA 1LB1B 3AGQA 3U3JA 2HF8A 2CL7X 3GJ7A 5GJCA 3ZQJA 5IF9A 4QXAA 4DLSA 3UMSA 1U0JA 3SQWA 4JKYA 5KTYA 1IQPA 1M1YE 2YWHA 2O8FB 1ELOA 1Z6AA 1HT1E 1ZM3A 2R2AA 3I4LA 3MWYW 4HEJA 4LYFA 1E2IA 3WYAA 2QRNA 3CF6R 3T1VA 1NMZA 4D4JA 3I61A 5J4LA 2RGNC 2R6DA 5J4HA 4LJAA 2VTKA 4XIGS 2F3TA 4JMPA 3RC8A 1XXHA 2BJVA 3T1QA 3CM0A 5D3MB 1HH4A 2IYTA 3B6EA 1VIAA 4RVCA 2YWFA 4L15A 2W6JD 4TYWA 1UKVY 1NY6A 4LJ8A 4LDJA 4ESVA 4G5OA 5TXGA 1NY5A 1T3LA 2VP4A 3A4NA 3LVQE 4KO8A 1II8B 4A0FA 3Q72A 1KAOA 1T8UA 2IS1A 5G53C 1VG0B 2WOJA 2O8FA 3M4YA 5JSZB 4GRAA 1E1RA 3A1UA 4DLTA 3MUFA 1E79D 4DXAA 4Q66C 2BCJQ 5FUYA 1YR9A 3NHAA 1ZMXA 3TSOA 1IN7A 4L9WA 3GFTA 1CKEA 4CEIB 4C0BA 4AC9A 4HDQB 4IFEA 1J70A 5D3MA 2OCPA 1TMKA 3FOZA 2HLDD 5GVSA 3TRFA 1II8A 3QXJA 1P7CA 5EZ6B 3NWJA 2AWNA 4AKHA 1HE8B 4EJSC 5JSZA 4FXPA 1QG4A 4H1UA 2P65A 4IFBA 2AK2A 1ZD9A 4IDNA 2JLUA 1YR8A 4TTRA 4HAWA 2WZQA 3VKGA 2ANCA 4CEIA 1Q1QA 1E4VA 1Q12A 2XTZA 4HZUA 1E98A 4TSFD 2QP4A 1EWRA 2GJKA 4JLVA 3C41J 3PCRB 3QKRB 1T8TA 2QSYA 2FDCA 3VX3A 2RGNA 2HV8A 1KK0A 1SXJC 1AM4D 2KSQA 2XNSA 2HUPA 2JLZA 3Q5EA 1R5OA 4BLRA 3FFAA 3TBKA 3CRVA 5J4KA 4IW3B 3IDQA 1VHLA 1XMVA 1T3SA 5AK0A 5L3SB 1G16A 1SHZA 3NDBB 4TQAA 3ZYCA 1AQUA 4EJSB 1SGWA 1P5ZB 4KBFA 2VA8A 1TQ6A 4A4DA 1NVUQ 2HXYA 3QKRA 4OQFA 1W36C 4M1YA 1KJZA 3GP8A 1T4GA 4PC3A 2TMKA 3DOEA 1N0VC 4RD4A 2WWFA 1SVOA 3C14C 4JLAA 5AUOB 3WNDA 5LDDC 3THXA 2JDIA 1JNYA 3ZVNA 2ZRIA 1ZJ6A 1D2NA 4XWKA 1CJKC 3M6AA 5FOVA 3X1WA 5DYIA 2A5DA 5JCPA 1SXJB 2GESA 3IHLA 3LFUA 5EP2A 4B3BA 1SXJE 5L3SA 5D3QA 3QKSB 1YU9A 3GJ8A 2WSMA 4U00A 4EJSA 3C8UA 3A37A 2W00A 4F91B 2BV3A 3X1YA 4MDEA 3KUCA 2GILA 1OIWA 3H4MA 5C2JB 2QENA 1G8YA 3MG9A 4P31A 4XVQA 4AYWA 4ZKDA 2QPOA 2GZAA 1KNQA 3KZ1E 2YNMA 1W36B 1E96A 2HYIC 4B71A 1SXJA 4UNQA 1Q57A 1P3JA 2ZUBA 4LHVA 3SQXA 1E2FA 1F6BA 1FW6A 3QKSA 1NSTA 3FMOB 1U8YA 2JLYA 2IYZA 1G8PA 2AXNA 3FMIA 3X1XA 1AJEA 4OK5A 5DN6D 2ASEA 1IM2A 3QI2A 3AF4A 1IBRA 3NH6A 2PLRA 4DLRA 4QKQA 1CRQA 1CS4C 3NEJA 4KYIB 1NN1A 2DHRA 2DY1A 2ZVQX 5JWHA 4B6FA 2EFEB 1HURA 4Q48A 1G291 3EC1A 3P27A 2ZSDA 3RABA 5FPSA 1Q3HA 3O8BA 5EE9A 3HP1A 4A2PA 1KI8A 3SE0A 2ZETA 4L8GA 4AI6A 4RSGA 3LX8A 2QP9X 5FH9A 2OT3B 4TT3D 1KKMA 3AGPA 4DUGA 1G17A 2RGCA 1W0KA 1TEVA 4YXWD 4FCTA 4OK6A 1W4CA 2MMGA 3F5FA 4PFSA 4TMVA 5C46F 1TNDA 4FI3C 5IHPA 4ZI2A 2JIZD 2QUZA 3GJ3A 4Q9IA 5KSPA 4HB4A 1SVMA 5L3QA 5GVRA 4R2IA 3A4MA 2PMKA 4HDOB 4BECA 3P26A 4CZ2A 2XOKD 4Q4HB 1QDEA 1S9DA 3KX2A 1WP9A 2FEMA 1YE8A 1E6CA 3OZXA 2XSZD 4PC2A 4YONB 1HQYE 2CNWA 3UWOA 3DMNA 4P32A 1CULC 1ETUA 3L0OA 3CKLA 4GMDA 4PQRA 4Q18A 5BYJA 3ZS8A 1HT2E 1G7TA 1SVIA 3CRQA 3WP1B 1KMQA 1GL6A 1E0SA 3CX7A 1KDTA 1G9XA 1MO6A 2QRZA 3A1WA 521PA 3ZZ0A 1WBBA 4LYHA 4DIEA 4R7ZA 4V02A 2VH5R 2WJYA 3B2EA 3A1VA 3HU2A 5JWOA 5JJIA 3KL4A 5FR1A 3R7WA 1ZNZA 4Q4HA 4GDFA 2V1UA 2J0QA 3ETLA 2BMDA 4DSTA 4FWIB 2DYKA 3QXSA 4QJ3A 3NBZC 4LX0A 1E2DA 4DEXA 1E9SA 2ORVA 1KNXA 3I5YA 1FX0B 5FBWB 2B6HA 4TQ9A 2GK7A 4Z8XA 2OM2A 2ZJZA 1UDWA 4D4KA 1M8PA 5EE0A 2RGEA 5JS7A 3QBVA 3FMPB 2IBMA 2GXAA 1N5LA 4QGHA 3UWKA 2GXSA 3ZVRA 3SFVA 1VCMA 3WYFA 4PQFA 3OE7D 4GOKA 2DFNA 4TN1A 1EG7A 1D5CA 5E95A 3BORA 4HZIA 5P21A 2ZYUX 3EIEA 3KFXA 1QHSA 4M9SA 2OESA 3SJCA 4M8NE 2FE4A 4OQMA 4US0R 1GG2A 1S9HA 1FX0A 4DLZA 1JPJA 1G20E 3KQLA 1OB5A 2ORWA 3WXMA 3T1OA 4W7SA 5FTKA 1A2BA 5LPNA 2JCSA 5CM8B 2LKDA 2ZM5A 1N6HA 2FFBA 1MOZA 4RD1A 4RCZA 1GKUB 1QVAA 2QA5A 5BWMA 4XVRA 2RKOA 3LW7A 2ZRHA 3QG5A 4A15A 1XD9A 4JLNA 1TX4B 3U6KA 4Q5IA 4LJ9A 2WMNB 3TAHA 1GRNA 1G7CA 4F4JA 3KKPA 4Z1MA 3GFPA 2WWHA 4EPXA 5TVKA 2C8VA 4JJKA 4Q1CA 1I2DA 4RZUA 4TQUS 3LW8A 1XPRA 4G01B 2D4HA 4RD6A 2HEIA 1DPFA 2PLFA 4PHGA 2XZOA 5KDDA 3QIAA 4RD2A 4NP6A 1CP2A 2QAJA 3PENA 2FA9A 2CVFA 1MRSA 2RGXA 2YOGA 1GZSA 3BGWA 3MLEA 3NIBA 4C3ZA 4D2IA 2ZR7A 3VR3A 2H92A 5DI3B 2CLCX 3EA5A 4URXR 1X6VA 3KDSE 3SBEA 2CK3A 2Z4RA 1ZRHA 2QPAA 2OFOA 1XWIA 3AEZA 5ELXA 2GBLA 3Q7QA 4W5HA 3BB4A 1P2UA 5FI0B 4F92B 1UKZA 1HUQA 1FP6A 221PA 1NJFA 2FN4A 4IDHA 2ZI4A 3B78A 4B32A 3A1SA 1ZC4A 3E2IA 1UEIA 4BFYA 1KI9A 2ZE8A 2GXQA 3IILA 5AWFC 2QTVB 3QPWA 1U8AA 1EX7A 3I32A 5L3VA 5DI3A 1KDPA 4A0GA 3B8HA 1IY0A 2WKRA 1NNEA 1SVWA 1ZW6A 3PUWA 1KO8A 2AHOA 3BRWD 2FEOA 2GF9A 1W0JD 3WHLA 3EIHA 1XCMA 2GF0A 1FNMA 3RANA 3TVDA 1UKEA 4BFSA 1SKYB 3RS5A 5FPHA 4JVNA 2P6UA 1SKYE 4QBFA 3UMRA 2CL6X 2XITA 1J90A 1G7SA 1HTWA 2WICA 1KK1A 1XEXB 1II9A 5CK4A 3TUIC 4HATA 3P4XA 2WSSD 3O8CA 3C4JA 2ZSFA 2GEUA 3T15A 1G1MA 1RKBA 1EFRD 2GZHA 4Q7KA 2GHIA 3LNCA 3IPYA 5JEEA 4B3GA 2C98A 2AK3A 2NZ8A 4OHYA 1DBSA 4URWR 5HPYB 3P20A 1LW7A 3CLVA 5EUMA 1VHTA 1WCV1 721PA 3THXB 2RGBA 1H8EA 3W34A 1CEEA 1M6NA 2G3YA 2BEJA 2UKDA 1CBUA 4P33A 1G5PA 2ZSAA 2QGNA 1XEXA 3O47A 4LRWA 4RD0A 3WRYC 1U9IC 4AKGA 4WAUA 1JBKA 1FUUA 2IYXA 4LJ6A 3U2QA 5HCIA 4Q9LA 1TF5A 2QZ4A 4BASA 1R7RA 4RFSA 4LPKA 4TL6A 4ARZB 4B34A 5EJEA 3W3ZB 4U5XA 4IVRA 3IIKA 5EXPA 2I1VB 3K70B 1IJFA 4Q02A 1R8SA 1U0HC 5K8IA 1KJYA 4HAZA 4B2PA 1N6NA 2ZREA 3LRPA 4JT2A 4QJ4A 1TPZA 2GKSA 2G6BA 3AV0B 3IKJA 4LOAA 4EIWA 1X1RA 1ZM2A 2EYUA 2ZRLA 2QBYB 3VKWA 1ZP6A 4LJ5A 4Z54A 3EWAA 2E9SA 2QSZA 2VHQA 4CEJB 1YZKA 4XSHA 5KHOC 1E9BA 5A0FA 4ARZA 3VNVA 3UG7A 3A8TA 2NPFA 3E1SA 4A8JC 5G3YA 1NVVQ 5TY0A 3RLFA 2J0UB 3OE7A 3KKMA 5KDLA 2AFHE 2Q3MA 3AQ4A 4BE7B 4UNSA 4MH0R 2PL3A 3I72A 5KNDA 4HLDA 3VR6A 1FTNA 1HY3A 4PX9A 4JVMA 4CF7A 2QBYA 4Q9JA 2NMVA 4EAQA 3SU8A 2C9YA 4CEJA 2W58A 5BXQC 2DFLA 3CH4B 1V43A 2P5SA 5K8UA 4LZZA 1U9IA 3DZDA 3N5CA 1EFCA 3WY9A 2ZXUA 3K8YA 1QVRA 2WOOA 2R44A 4NCIA 2J0UA 1KK3A 5FTMA 3ZZUA 4YLGA 3QOFA 2F1IA 4TZ6A 3IPXA 2ZR0A 2XEXA 3TGPA 2ZU6A 3OAAA 4MRNA 1G3UA 2QGZA 2F7SA 3VKHA 2P0EA 5EP3A 3KJGA 4WW0A 2ZUCA 2QMEA 1E0AA 4L5BA 5B30A 1ZUNB 3WYGA 1WRBA 3AUXA 4ASUA 4M9XA 2FZLA 2ZSEA 1RFLA 3K0SA 1GKYA 2H17A 1UF9A 2QU8A 1DAKA 4MRPA 4Q7MB 4B2LA 1W4RA 1E1RD 4B3DA 2OILA 1BMFA 1QHGA 5L3RA 1H8HA 5KDOA 2DPXA 4G1UC 3EPLA 1ZIPA 4Q00A 4D81A 1E9RA 3K9NA 2QTHA 2BOVA 2ZI9A 5B57C 4IOMA 4ZKEA 3TIFA 2GRJA 1XF9A 4HDCA 2BCGY 3GD7A 1FTSA 3ZDQA 1JR6A 4R2HA 1W47A 4NE2A 2QPTA 3IQXA 1KI4A 4UXIA 1JQJC 1X1SA 3VQTA 4IDQA 5SZKB 2GCPA 4FWTA 3EX7C 4QGFA 3AUYA 4KITB 3B7GA 1W4BA 5KSOA 5CB6A 5B64A 4FCWA 3WMEA 4XSGA 3L0PA 2LCFA 3JZAA 1ZUIA 3IIMA 5IT5A 1XD2B 1D9XA 3NTUA 1FUKA 4Z8YA 3M0EA 1XP8A 1PLJA 1Q0UA 3S1AB 2JLSA 4Q4AB 4WIAA 4LPSA 4AWXA 3W3AA 4M1MA 4MITA 2FPMA 4WBSA 2A5JA 4DCVA 3VR2A 2AKAB 3GMTA 4LBVA 2V4ZA 5FUVA 1JEEA 1KGDA 1UKYA 4Q7JB 4V03A 4I1UA 1A7JA 1XD2A 1NSFA 5FTNA 1EFRA 2YC4C 4FMCB 2RB4A 2B7CA 1E9AA 1QG2A 3S1AA 4QNMA 2VP6A 2BWJA 1NN0A 3IEUA 4V0KA 2FMXA 5C1BA 2XTNA 1DARA 3PR1A 3DMDA 2FFHA 3W6PA 1MO5A 2GEDA 1NVXQ 1EXMA 3BJIC 2ZJOA 4TLAA 5CDFE 4H9GA 4MKHA 4B76A 2NO6A 4JLBA 4IKEA 2R6AA 3AVQA 4N1AA 3BS4A 3KFVA 5J4VA 3D7MA 4H1VA 4A82A 2MSCB 1AIPA 3FYHA 1RRPA 821PA 2QM8A 3UPUA 4N0DA 4US2R 5JMTA 4KI0A 2V54A 3EG5A 3VHLB 5B58C 2IS4A 3I8XA 4BFWA 2Q9AA 2EFDB 3A6PC 3GLFA 5GJWC 2HF9A 5CDFA 1SXJD 2RHDA 4JLJA 3DHWC 3GEEA 5FOTA 1X8LA 2C9OA 1P6XA 2V7QA 5FBLB 4UNRA 4CRWB 3VAAA 2V1XA 1Z6GA 2ZRNA 4JIMA 4IOKA 3FKSA 4D82A 3PQCA 1N2CE 2IL1A 2KE5A 1Z3IX 3L2OB 3BB3A 3NVAA 2ZQ5A 3CRMA 4LV6A 4XTCS 3PEWA 3FVQA 2JATA 4MDFA 1YR6A 2WJHA 2NIPA 4QOSA 1D6JA 4NCHA 3RAPR 1W36D 2PH1A 5GJBA 4PAQA 4C9BA 4P4SB 4TTQA 3IBGA 5JJKA 3T06B 4I4LA 4C0KA 4NU0A 3RS4A 2VL7A 4EFLA 4G5QA 3JVUA 5EE3A 1YRAA 5EE1A 4TYNA 3W90A 4ACAA 3BH6A 1KI7A 3OHMA 3AM1A 4JBXA 2AFIE 1NVVR 3H2YA 4DUGD 4FW9A 4HLCA 4Y0AA 1W0KD 5EXXA 1TQ4A 1CU1A 1DAMA 1GDDA 4FIDA 5DIFA 4GOJA 1RIFA 3BH7A 2NPIA 1DG1G 5KU1A 3K9HA 3WNBA 2FSIA 1S1CA 3TSWA 3NKVA 3GEIA 1P9WA 3FE2A 2FOLA 2CE7A 1IN5A 4BZXA 4KFSA 4P4SA 1GILA 1TL7C 2QI9C 2IXFA 4JVLA 1YKSA 3KKOA 1YZTA 1VCIA 4NDZA 1EGAA 2VSFA 2CNWD 4F4IA 1G7RA 2FZ4A 4GSYA 2REXB 3CX6A 1DAHA 1P2VA 1EK0A 4F7WA 1Z08A 1E2HA 4AG6A 5ANRB 2RHMA 3KUDA 3OIYA 4JSYA 2EFHB 1TAGA 2BJWA 3BERA 1VMAA 1E9CA 3BFXA 1QF9A 5KYKA 1KZGB 4HZUB 4HB2A 1DEKA 1M7GA 1M7HA 1P9NA 1NL3A 4I81A 5LB4A 4DJTA 2WVJA 2NO1A 4C7OA 2VF8A 3SDZA 1XDBA 2QQEA 4Q1BA 2QNRA 5DI9A 1F2UB 1N5KA 2E1RA 4PC1A 3RRNA 1JXMA 1CXZA 1VG8A 2H1LA 2WM9B 1ESMA 4HI0E 4D26A 1MH1A 3R8FA 3CWQA 1KI3A 2ZAMA 3N2IA 4PTLA 1WDTA 1RJ9B 1PUIA 4IVPA 2WIBA 3V9PA 2ZPTX 4MUAA 3JVVA 2W0SA 3FMFA 3W8RA 4E09A 1AZSC 1HEIA 1OE0A 2OXRA 2VLIA 2O8DB 3CB4A 1MABB 2A5YB 5F98A 1YZNA 1XJCA 2GAOA 4B74A 1ODFA 2A9KA 3L0IB 1SVKA 3QQ5A 4LK2A 4BEJA 4D0GA 1F2UA 1XU4A 4DDVA 3DKPA 1HA3A 3B1XA 4NKRA 4QL3A 5JJLA 1TU3A 3OF5A 4OQNA 1W7AA 4WZAE 5FBQB 5F9HA 1K8RA 1XPUA 1DE0A 2IUTA 2JLVA 3W6OA 4YMUA 1PVOA 1RJ9A 3W5JA 2FSFA 2NQ2C 3TR0A 2X77A 3WRXC 1AKYA 4C0HA 2B7BA 3N70A 4CIDA 3C16C 1ZYUA 2X8AA 3CNLA 4ZIRA 1NMYA 1E9DA 4BFZA 2I4IA 3WBKA 4LY6A 4CEHA 4GI7A 2O8DA 2ZRAA 1GIAA 1MABA 2W2TA 4M2LA 2JA1A 2C99A 2ZIAA 4EPYA 1G21E 3VHXA 2PX3A 3ADCA 3KKQA 2Q21A 3KXIA 1HE1C 4Z1MD 3K0CC 1JPNA 1YR7A 3QVVA 4MRRA 2P67A 1G64A 4KYUA 2ONKA 2GWHA 5G41A 4JVSB 5IRCD 1OPXA 2PZEA 1U98A 2GNOA 2IYSA 2VSOA 3F0TA 1U8ZA 1ZD8A 2VP2A 4BRUA 3WMGA 2C2HA 3W5IA 4DSOA 4B35A 1UDXA 2JLQA 4EPTA 1I4TD 5HE9A 1WXQA 2QN6A 4FD2A 4PC7A 3NXSA 4QGAA 3BAFA 4WVFA 1ZNWA 5HKKA 4AK9A 5AJXA 5FL7A 4MRVA 4GP6A 2WWGA 3K1JA 4DLUA 4Q03A 4X8HA 5EP1A 1NVWQ 1XTQA 5JCZA 3HU1A 3KB2A 4TL9A 2A2ZA 3MGCA 1P73A 1TUIA 2CK3D 5JHGB 4P4UA 3H86A 2YYZA 4Q9HA 3H1TA 2WJIA 3LBHA 4B73A 1N5IA 1GM5A 4GZLA 3IEVA 1XX6A 5H1YA 1II0A 2ZS7A 4IRUB 4AKIA 5H68A 3RRMA 1QHIA 1T5IA 4MKFA 5CITA 1WB9A 2MSDB 1XTJA 1Y63A 3OIVA 2DB3A 4FMDB 1X3SA 1KZ7B 3CH5A 3QXCA 2VO1A 2A5GA 5EE5B 4PAOA 1QBKC 3WNCA 5E7MA 1LS1A 2ZRBA 2RGDA 4MYTA 4UKDA 1LV7A 2DWOA 5L3QB 3EZ6A 5KOYA 2VP5A 1W5SA 1R0WA 5E3HA 4JZKA 5FPKA 1DADA 1PLKA 2EW1A 3R9WA 1ZBDA 5KPJA 1KK2A 2IYRA 2X2EA 2G0TA 3CBQA 2C03A 4PHHA 2V55B 1P9RA 1QRAA 4MGZR 1SZPA 1YHNA 3ND8A 3SFZA 1RZ3A 3FTQA 2IX3A 3EIQA 1XBTA 2E87A 3RRZA 3HWSA 3U60B 3V00A 2XZLA 3HU3A 1E4YA 4YMWA 1P2TA 1NN5A 3GLGB 4PPGA 1LNZA 3GLGE 3TKLA 4O0MA 2ZJBA 3R7WB 4XVUA 5JBQA 4N3NA 4RCYA 3NEYA 3EZ9A 4NYJQ 1C1YA 1Y3AA 1YRBA 1BIFA 1H8ED 1VCOA 3U61B 2BMJA 1XTSA 3SYNA 1OW3B 4IOJA 2IK8A 1JJVA 3N2EA 5IK2A 1BH2A 4DCNA 1ZU5A 1S8FA 3GLGA 2QAGC 1SVLA 5A4JA 2ZRMA 3KQKA 3ICQB 4BFUA 2I1QA 2VBCA 2HT6A 1L2TA 4IHQA 3SNHA 1J8YF 4PANA 4KLZA 3TUZC 4QG7A 1XPOA 2IF0A 1W48A 1TQ2A 4FCVA 1N6KA 5BQ5A 1KHTA 1NBMA 2QEQA 3NBYC 1KIMA 1Z0IA 2KI5A 4Q19A 2YHSA 3KQNA 5LD2C 5HZKA 3THOA 5FOSA 5J40A 4A2WA 5BW8A 3JZMA 2WBLC 2BEKA 5CLQA 4ZO4A 3TE6A 3IBYA 4QJ5A 1D2EA 3IO3A 2RCNA 3OESA 3K70D 4TWZA 4MYHA 1R10A 3R9XA 2RH5A 2ZYTX 1EX6A 3T1TA 3PIRA 4LV8B 1MV5A 2XJ4A 3CPJB 3B13B 2CDNA 4M9ZA 3RNLA 4EPWA 1Z63A 1GKIA 2PX0A 4M1TA 4B6EA 2CLDX 3EXAA 1BO6A 4Q7LA 1XMIA 5EP4A 1BOFA 3T34A 1NF3A 2FPKA 2H8KA 3CNNA 2GCOA 1CJMA 3SJBA 1J99A 1CF4A 4O25A 4DEYA 4DKXA 1K6MA 1FOEB 3DPUA 4KU4A 4HUTA 3B9PA 4HAUA 1RPZA 1N6OA 1A5TA 2FWRA 2QAGA 3U3OA 1AGPA 4TLCA 2G1JA 1XTIA 4NCJA 5BN4A 1E2JA 1P62B 2OBLA 3D6TB 3IIJA 3OAAD 3T12A 3FHOA 4D4LA 4C0QC 1KO7A 3K0FA 3MD0A 2A3RA 4NCKA 1FZQA 2FFQA 2ZE7A 5TMPA 4Q4JB 1G3MA 5FOXA 3EWSA 3RC3A 4TZ0A 4CVNA 2CHQA 2O52A 5FFMA 3U3KA 4ASUD 1G19A 3DKVA 1GRRA 4C0JA 2OLJA 2HJVA 3L8YA 5G40A 3NC1C 3MRSA 4O2LA 2CE2X 2IYUA 2GCNA 2YV5A 1ZM9A 1BMFD 1Q44A 1KSGA 1DELA 2V9PA 1H8HD 3T61A 5KSZA 3LA6A 2FJUA 2BDTA 4PZYA 1GOTA 1I2MA 1U99A 3B5JA 2O8BB 1RRGA 2D2FA 1CR4A 3EA0A 4B44A 4Q4JA 1R8QA 4KBGA 5BYKA 3KJEA 2HJGA 4Q1EA 3CIOA 5C4GB 3U6BA 1E2NA 2DWPA 4DSUA 1ZVQA 2ZI6A 1E0JA 1QHHB 4PQYA 2C9CA 4GPTA 4OL0A 1FMLA 4F38A 5J47A 1UAAA 1W49A 1S1MA 1OH5A 2ZITA 3SC3A 1Z47A 4DRZA 1FFHA 1OIVA 1W4AA 2GXUA 3KJIA 2PCJA 3B82A 5DLQC 4C0SA 2O8BA 2J1LA 1OFHA 2X19A 3HR8A 4W5JA 3AVOA 4MYUA 4V0OA 5K8LA 3NH9A 4G5GA 3UXMA 2WKQA 3QEOA 1M2OB 3EZFA 1G8GA 5G3ZA 1HQCA 1QHHA 3LO5A 1E2GA 1EFHA 2QMUA 3FFBA 1R4AA 2OEPA 3SYKA 3B85A 4RKFA 1Z0AA 2ZAOA 5AJYA 2BMFA 3QKUA 2EWVA 3W8NA 2QMHA 3Q85A 4BZQA 4YDSA 4TLEA 1S3GA 1OF1A 1XEFA 3DL0A 2V8OA 3T35A 2OSBA 3BFVA 4BLOA 2ODEA 4RFSB 2P2LA 4Q1FA 4BPBA 3Q8XB 2PZGA 3SS8A 1OFTA 2BKEA 4LI0A 5BN3A 3OEEA 1OHHA 5JWRA 1QHXA 3PUXA 2VYFA 1OSNA 3DEFA 1XD8A 2WAYA 4QHYA 2ZS9A 4GT1A 1LF5A 1T91A 2D62A 4KXFB 3K0AA 1IOZA 2W2VA 2QMOA 1NIJA 2W2XA 4PSAA 1KDOA 3P32A 2JJ8A 4OYHA 3RWOA 2RAPA 4B75A 2D7DA 4D80A 3V4RA 4O3MA 4OI1A 1MO3A 4NYJR 4IJMA 4IEEA 2AXPA 4Q1DA 3LD9A 3SJAA 4JBYA 4IEIA 2IXGA 4AG5A 1N6LA 1G5RA 1NG9A 1GITA 1OH7A 2OBMA 2VHUA 1E2EA 3PEUA 1TF7A 2WAXA 3SEAA 3KTAA 5FTJA 4D0LB 4D4MA 3BE4A 4JLDA 3I92A 3O8RA 4OHWA 1XRJA 2F9LA 3D31A 2EU8A 4KV9A 2V7QD 1VPLA 421PA 1FQKA 4ZDJA 1AN0A 4A0HA 2F9MA 3K0EA 4LBYA 2OBNA 2P3SA 3FKSD 2A30A 2QORA 5F2EA 2DFTA 4DLVA 5FOUA 2DFKB 2FNAA 3AVPA 1E1QA 2QT1A 4DT1A 1TQDA 2PCLA 3IGFA 3VNUA 4PZZA 3MJHA 4S35A 3AVXA 2JAQA 3AF3A 4O2RA 4M53A 1W46A 2RMKA 4G0NA 1UBEA 1XB2A 1ZCBA 2NZJA 3CR7A 4PSKA 3REFA 1UPTA 2D7CA 3ZLJA 2B92A 1CTQA 2ECKA 3ZJYA 3EPHA 1R6BX 4CT5A 4XWOA 2JLWA 1E2KA 4FMBB 1ZAKA 1OKKA 2J7KA 5DE3A 5DHAA 1P2SA 1VDZA 3AKEA 3LWNA 4G3XA 5SZHB 1CIPA 3QF7A 4M1KA 2O0HA 3MWLA 1SKQA 1MKYA 3BXZA 1IAQA 3LDAA 3TW4A 4A8JB 1IN8A 1IONA 5FUWA 2GJSA 4URYR 2XAUA 1OV4A 2VHTA 2WJVA 3ASZA 3GEHA 1YZQA 1Z28A 2IEYA 2QM7A 2PJZA 2HXSA 3OFNA 2R8RA 2WMOB 1G18A 2CL0X 5JZVA 3LQRA 2ZANA 2FF7A 4HYYA 1U0LA 1G4UR 1ONBA 1P75A 4OBEA 5EQTA 2UZIR 2J7PA 3C7KA 2WKPA 3QKTA 1M7BA 2GK6A 5DHFA 3UMFA 4NTZA 1EFTA 4A8JA 1S2MA 2G83A 2QL6A 3FWYA 4DC9A 4URZR 3M1IA 2PZFA 2GZDA 2ODBA 4P0TA 4M21A 4QC2A 2IT1A 4UNPA 1NMXA 2WPDA 3UANA 3X2SA 1JAHA 2DR3A 4DZZA 3PXGA 6Q21A 1XZQA 2AD1A 3HPQA 4MYCA 4LCBA 1RRFA 3PG5A 2NO7A 4A36A 1G8HA 3CPHA 2BM0A 5EXSA 1OFUX 2EVWX 4YMVA 1U2RA 5JI3E 4HAYA 2OFWA 2VSXA 2PEZA 1F5NA 2P6NA 5TDHA 3PV0A 4PSVA 4POAA 2IWHA 4UJ3A 1SULA 3QXHA 3EPJA 1JQLB 1OXSC 1GUAA 1QZXA 2A78A 3C15C 3G5UA 4IVQA 2EYQA 4KLNA 4JLMA 4OJQA 3FPAA 2WHXA 3VR4A 3CONA 1PLLA 1T6NA 3TAUA 5L8VA 1N6RA 4XD7A 1OXVA 1S4QA 5TB5A 2FSHA 2IHBA 3F8TA 3HYRA 4B43A 4ITRC 3SJZA 2IS2A 1P4SA 3GJ0A 1RC8A 2J0SA 3AF1A 4QFMA 2YZ2A 2FGKA 3TVTA 2ZRCA 2F3RA 1ANKA 4PHTA 3R8CA 3QPUA 3TH5A 1K5DA 2ZJ2A 1KI6B 2QP3A 1GNRA 1RE0A 2OCYC 5FBVB 1G3QA 1A2KC 3UIEA 3F3YA 5DO9A 1N25A 4IDOA 1MT0A 3PITA 2V6JA 3IHWA 4NYIQ 3RSLA 1ZU4A 2CCJA 3GLFB 3GLFE 4LJ4A 5FBRB 1U90A 2O0KA 5CM9C 1OXTA 2F1HA 3B1WA 3AH8A 1YVDA 3A36A 4NH0A 1FPMA 3X1ZA 2MMCA 1EWQA 1KI6A 1VG1A 4F93B 3L8ZA 1YJ5A 5DISB 4AYTA 1KY2A 1DVRA 4N0EA 3AVYA 1AA9A 3BD9A 5FUXA 5LBIA 5HKKD 2J9RA 2DBYA 1MO4A 3UKDA 3B9QA 1TADA 4PPQA 3B1YA 3QY0A 2X1VA 5FL7D 2ORIA 3TQCA 4PPFA 2R62A 1IJEA 2GA8A 1LS6A 5CJPA 2BC9A 2DWQA 1E99A 1XNJA 5TARA 1VYTA 2NOAA 4MKGA 4QHTA 2V6IA 2YWEA 2W83A 2JJ2A 4U02A 1XCGB 2FU5C 2NG1A 2OV2A 2ZTSA 1Z6XA 2VQSA 4KVAA 1YZLA 3GLHB 1PZNA 3LQQA 4KFRA 3GLHE 1NKSA 5CLLA 1YZGA 2IYLD 1DS6A 1DAGA 4I1VA 1COWA 3Q3JB 4OI4A 1KSHA 3LVRE 4LHWA 4XH9B 1Z83A 2PMDA 1JR3E 2OFXA 4ZCIA 1OB2A 1GL7A 3GJ5A 1J7KA 4MGKR 1FP7A 4LBWA 2VP0A 4LYJA 2XJ9A 3A1TA 4C30A 1X86B 4NL4H 3Q7PA 1OJLA 4KAXA 5H70A 2WWXA 2Z0MA 4FN5A 4TYQA 2ZROA 1EESA 1R5NA 2BBOA 2QY9A 3BOSA 1Z22A 3GLHA 3PEYA 3U5ZB 3AP3A 2ZRJA 1F48A 4JL8A 1NI3A 1N6PA 4IDPA 2XGJA 4NCNA 4B3FX 2ZE5A 5KPDA 1JR3A 4FMCF 3EPKA 3CRW1 3THYB 4UNNA 1XJ0A 1N6IA 5FOWA 3PJRA 4HUQB 3EASA 4LYAA 2Q9CA 3FHCB 3RSOA 2VHCA 2QE7A 2XNDA 1KI2A 1W1WA 2OO7A 5JRZA 2JLXA 3U3RA 4C7OB 4GFDA 1G6HA 2PEYA 4B3CA 3QUSA 1WBDA 1UFQA 2QROA 4GZMA 1XMSA 2YC2C 3RS7A 2JGNA 3ZD6A 4BGDA 3LLMA 4I1OA 3REGA 1CR2A 5JFGA 1VIYA 1GNPA 1FNNA 3THYA 2BHRA 2CMKA 4CT4B 4HUQA 5IK2D 3D8BA 4HLUC 3KQUA 4OHXA 4C2TA 4QM7A 1Q22A 1OXXK 2Z43A 3K9LA 4EFMA 4ZI3A 1TTTA 3GJ6A 2ZU0C 3DM5A 1KO4A 3WP0A 2IYYA 2REOA 2FV8A 2XB4A 4BLTA 1E32A 1NBMD 4IXNA 4M1OA 3RS0A 1WE2A 3SZRA 3TJZA 3KQHA 2FPLA 1KDRA 5SZIA 2VHJA 4D6PA 5FTLA 1GTVA 3BK7A 4FINA 4QBHA 1DAEA 4DHEA 5DSZA 2C04A 4LJ7A 1JAIA 1W5TA 3DM9B 2KBFA 4BFVA 2BKUA 2GTPA 2H7VA 1C4OA 4ZIRB 2BIFA 2J5XA 3BWDD 3GPLA 4ABYA 4CEHB 3DDCA 2IYWA 3CWZA 5AJVB 3IUYA 4M4SA 4JL5A 3AP1A 3TSZA 5C4MA 1WF3A 4E07A 3GCGA 4UQOA 3SHWA 2OAP1 1PJRA 4MQBA 5FI1B 3PUZA 5CIWA 1L4UA 1KO1A 1XZPA 2ERXA 3NG1A 3LV8A 4PO9A 1C9KA 1ZM7A 4ZV4A 4M22A 4BQSA 2G88A 2H5EA 3R20A 4JLPA 4M1WA 4X8MA 4A6XA 3E5HA 3V4FA 2FH5B 1R0XA 2JJ1A 4MUBA 2LWIA 2WWWA 4UXHA 3QE0A 1RVDA 4Q01A 5E7JA 4TMKA 1FL9A 4HLUA 4LC0A 3QENA 1KTVA 3I8SA 3HPRA 1TU4A 1HV8A 4AY2A 4XTRA 3T5GA 1Z5ZA 3EW9A 2WJJA 3AF2A 1NN3A 2C5LA 2OE2A 4BLSA 1MR3F 4WOPA 2JLRA 621PA 4JBWA 4Q4LA 1TF2A 1UJ2A 1SVSA 2J0VA 3MFYA 2ZRPA 2XXAB 4TL8A 4NYIR 2W0MA 5KNCA 1NP6A 5IDVA 5F3WB 3RS3A 1G8FA 2YJTD 2OLKA 2FGJA 2XB2A 1E69A 3LH5A 1SHKA 2G9NA 1RYFA 2WWIA 4GP7A 1IXSB 4Q21A 2R6CA 3AVTA 4MA4A 5DNYB 3CZQA 2OUKA 5JHHB 1H65A 2Q0HA 2O8CB 4ZCMA 2H57A 4M9QA 2P6RA 4JSTA 2BBSA 3NHBA 4MGYR 4EPRA 3AVUA 2CLSA 4QBIA 4R71A 4TLBA 1BYIA 2XXAA 2HCJB 3DOFA 2NO9A 1KOFA 3CRRA 4AD8A 1KSFX 1B0UA 1N5JA 4NHOA 4DCTA 2AX4A 1XTKA 1CR1A 1E94E 2NTYC 2L0XA 1UEJA 4DBLC 2KB0A 4HLQB 3LY5A 4JL6A 4DIDA 4UXJA 1DG3A 1T5LA 1G4AE 3OEHA 1F2TB 3R9IA 2O8CA 2OHFA 4OQLA 2X2FA 3VFDA 3K0CA 4V0LA 3AKCA 3ZQ6A 1US8B 1GSIA 1KKLA 2J87A 1Q20A 4EUNA 1T0JB 3RS2A 1XTRA 4KFTA 2ODNA 2YKGA 1K5GA 4KJZA 3RRYA 3KXLA 1PV4A 5JLJA 3A58B 5AJWA 2ZRGA 2HCBA 4YMTA 2ZJ8A 1PUJA 3ZIAA 1XEWX 3H0KA 3H84A 4LV5B 4A92A 3BB1A 2CCGA 3AKDA 2W6IA 2H18A 1OLOA 1F2TA 1OH6A 1WMSA 4KSCA 3C5CA 2J41A 4V0ME 5AR1A 3OEED 1OHHD 4E22A 3QNUA 4KHZA 1US8A 4R9UC 4URUR 5F9FA 1Z6TA 1W44A 4DB2A 1NBME 4PAMA 1DOAA 1JB1A 3J81k 4E03A 1IY1A 1G5TA 4D25A 4NMMA 1NLFA 4DDWA 5H8WA 2WTUA 3L82B 4JYBA 3HR7A 3NDPA 2RGGA 4RZ2A 5DYGA 2G1KA 1XJQA 3ICEA 4HAVA 4V0MA 2EFGA 3RVBA 3ZVLA 2MSEB 5GJVC 2W6JA 3LLUA 4AIIA 2J45A 1T0HB 4U7DA 5AUQA 1U94A 4ACBA 4EKDA 1UBCA 5AUPB 1ESNA 1NIPA 4WXPA 3DO6A 4A9AA 1KI1A 2OZEA 2WWYA 3TNFA 1A1VA 2IUUA 4TTPA 5AUNB 4BWYA 1E79A 2ATXA 2ZRKA 3WBJA 4DLXA 2XZPA 1OT3A 2GVDC 2WV9A 1NG1A 2GCOB 4FMDF 4A6PA 5EZ5A 4ZCLA 3T5DA 4JKIA 4OKSA 2EQBA 4R98A 4M0LA 3HJNA 4GBMA 2HLDA 2QAGB 3LX5A 1E1QD 2R9VA 1BS1A 4OJKA 4ON9A 1VKJA 3RDPA 2ZJ5A 4K81B 3K0FB 2J46A 1WQ1R 3PFIA 2GVZC 5E7IA 2QQ0A 5CYPA 1W2GA 3B1ZA 1UBGA 1W2HA 2Q9BA 4OQXA 5B2ZA 1IN6A 4M1SA 4NPHA 5UKDA 4C0LA 4URVR 4TYYA 2QTFA 1DTSA 3GQBA 1M74A 4PO1A 4J0QA 1R2QA 3DZ8A 4A1FA 4TMZA 1LTQA 5KNBA 4TSFA 3TW8B 3QEJA 2PBRA 4HAXA 4Y0VA 1OYWA 5LD2B 1CJTC 3P4YA 2CXXA 1GFIA 2Q3HA 3CPEA 1QHNA 3MSXA 1OKKD 1Z0KA 3HYTA 1N0WA 1S0UA 1VTKA 4NONA 1UM8A 1X8JA 3CX8A 1BKDR 1JECA 3IQWA 2FX3A 2G0NA 1LFDB 2IS6A 1E2MA 3K09C 4BFXA 1A82A 2A5FA 2GBLC 3UG6A 1Z29A 1VYVA 4K8OA 4F4CA 1NKTA 1R5BA 2B21A 4GOXA 3ASYA 3DVLA 3LBNA 3OFND 4EQ6B 5M04A 1E0KA 4C4PA 4RY2A 2CCKA 2BVNA 2ONJA 3IO5A 2BBTA 3U7GA 4LHXA 2YVUA 2ZYVX 2J7PD 5JRJA 2GETA 1UBFA 2PT5A 2YOHA 1F60A 2IUSA 4AURA 3AKYA 5TV2A 3K53A 3NBFA 4NBSA 4RJLA 4ESHA 3MJRA 1RRCA 1AS3A 2IYVA 2IA5A 1ZIOA 3LXRA 1RW4A 3U3MA 1SQ5A 2DCUA 1L4YA 3ND9A 3PVSA 2WPDD 4EQ6A 4UJ5A 3QG1A 1ZCAA 1RYHA 2O0JA 4QM6A 1LVGA 4DSNA 5HTKA 1M34E 2OG2A 1DO0A 1E3MA 2WJGA 3SI7A 1AZTA 1D8TA 3ZVMA 4QHSA 4I1SA 4DWJA 2F55A 2IF2A 1NRJB 2XX3A 3EZ7A 4XJXA 2AKYA 3U44B 1VYUA 4OI0A 4JLKA 3K09A 4WZBE 3FHTA 4RZ3A 4XD7D 5EXTA 4DVGA 2O8EB 5DN6A 1Z6YA 2C95A 1I4DD 2F1JA 2REBA 2HDNB 4QBGB 1GRQA 4TLDA 3VR1A 3U4QB 2D06A 4V0NA 4S2EA 4WA7A 2PT7A 4GMXA 4G5SA 3B1VA 3FGNA 1AGRA 4TMTA 5CB8A 2IWRA 3SOPA 2N1BA 3K0AB 4MKIA 2H16A 1VECA 4TMXA 2JEOA 3VR5A 4BLQA 4L4UA 2F1RA 3U44A 2GEVA 1ZUHA 4P3YA 4YQFA 1CLUA 3W9YA 3ZH9B 1O87A 2ZJAA 4E5UA 1CRPA 3QXXA 1V5WA 5HE8A 2KBEA 2O8EA 1Q21A 3AVVA 3L0SA 2CHGA 1OYYA 2AWOA 4TT3A 3U4QA 1S3SA 3Q9LA 5HR5A 3BBPA 4YXWA 3KTAB 4IXMA 3TR5A 1IHUA 2ZVPX 2AR7A 2CJWB 1GL9B 3WHKA 5BN5A 2GJ9A 2CBZA 3K70C 2V3CC 2JIZA 4P4TA 2OAQ1 3FDIA 1N3BA 2ODWA 3BIFA 4YDHB 3QSYA 2XOKA 1OFIA 5DGXA 4EPVA 4C2UA 1X8KA 2HYDA 2PJRA 1GVNB 2IYQA 3K9GA 3ZS9A 4QRHA 2XSZA 2GDJA 4AYXA 1NLZA 2AD5A 2EFCB 2C96A 3I62A 1FQJA 4DT1B 4US1R 1JALA 4DLWA 1UADA 2BM1A 5HCNA 2YWGA 3UATA 4CGZA 1CJUC 3CUEF 5E4FA 1EFUA 1Q3TA 1O3YA 2AL7A 3KXKA 2JJ2D 2CJWA 1F3OA 3QF4B 4RD3A 1ZD1A 1R0YA 3QVUA 3ZZTA 5C18A 4RZXA 1Z0JA 4LHZA 1D2MA 5J5CA 2CEAA 2SHKA 3TMKA 3U7EB 1B23P 3D3QA 4LBZA 4LUCA 3NC0C 3PUYA 4YC7A 4ERNA 2Y8EA 2Q3FA 4BUJA 2IXEA 1TUEA 1COWD 4MRSA 2CVHA 1Q1EA 5JEDA 2EWWA 2FSGA 2ANBA 4GL2A 4OHZA 5HZHA 1ZINA 3MWJA 4LHYA 5KUTA 4GNKA 2B8TA 3CR8A 4QNRA 2IW3A 2VRWA 5FR2A 5SZJA 3QF4A 5KSYA 3KJHA 3B60A 4LWZA 1XEWY 4NYMQ 4CYMA 3C5HA 2VEDA 3W6NA 4TYPA 2N42A 3RHFA 1GWNA 3SR0A 4DDUA 1AS2A 1NJGA 3AB3A 4PHFA 4RFVA 1IY2A 4PC6A 1S96A 3LBIA 1JR3D 1GAJA 1ZM4A 1KJWA 4KVGA 2A7QA 1G3IA 1IXZA 4KSBA 2R6GA 4OI2A 4BZPA 3ZGXA 1L8QA 2QE7D 2XNDD 1VG9B 1J8MF 2GAAA 3GFOA 4PR0A 4RKEA 4OK3A 4XOIA 2QG6A 3RYTC 2GJ8A 4B47A 4ZDKA 4PXAA 1BYUA 1N0UA 1Z06A 4DLYA 1T3HA 2D3WA 3AVWA 4HB0A 1Z0FA 1LF0A 3QJYA 2KJQA 2YOFA 2C78A 3GJ4A 3L43A 5JS8A 2I3BA 2F6RA 3U7FB 2HT1A 5DH9A 1AQYA 3VU9B 1AKEA 1KYIA 121PA 4B48A 3PEVA 3RWMB 2G77B 3EC2A 3KB1A 1CR0A 3CF0A 2ZR9A 3ECCA 4JS0A 4WZ6A 1G3RA 3SN6A 1G6OA 4MGIR 3ADKA 4Q47A 1Z8FA 3SHFA 4XWAA 4JJZA 1YQTA 5KO2A 3MAAC 1LY1A 1DAFA 3A4LA 2VIIA 2C77A 3UK6A 1KO5A 3LAWA 2FG5A 2FFAA 3TQFA 3BC1A 4LC1A 3VU9A 4KODA 2D2EA 1P60A 4ILEA 3VMFA 3P1JA 4TL7A 4ZPXA 2ZI5A 5CYOA 3TUJC 3AP2A 3GLIB 3GLIE 2KWIA 1CJVC 1MRNA 3EARA 3PUVA 2ERYA 4PO8A 1OH8A 3I3SR 5J4YA 1Z2AA 1ZNYA 2ZEJA 1JI0A 4L9SA 4IOLA 3LXXA 2OCBA 1Z07A 4QGGA 2R6FA 2ZUDA 4JYCA 5LB2A 2OCAA 2ZJYA 3MWKA 2NGRA 3HDTA 4JLOA 4CW7A 1P61B 4LGMA 2P5TB 3FB4A 4DCSA 4BFTA 2ZI7A 3KKNA 1Q1ZA 3G82C 5A5GA 4II7A 4Q1AA 2ZSBA 3AF0A 3X1DA 4D0NA 4K46A 2N46A 1DAIA 1KMHB 2Z5FA 4EDHA 3GLIA 4W5WA 2JJ1D 1XFAA 4L16A 4DB4A 1WA5A 1P72A 1ZNXA 2ZE6A 2ZRDA 4A2QA 4X8LA 4OHVA 4TMWA 4YMSA 1D9ZA 2AN9A 3I5XA 1AK2A 4X8OA 2BMEA 4Q9KA 8OHMA 1QHYA 1OXUA 3ONWA 4HB3A 1W0JA 4B2IA 5CIQA 2Z83A 2ZRFA 1L7VC 4G5RA 4HSEA 1VCNA 1XMJA 1KY3A 2NO0A 1G41A 2ATVA 2Q6TA 2Z4SA 3CNOA 3MMPA 3MCAA 2F43B 5EUQB 4B33A 3OIWA 1T9HA 2BBWA 2R65A 1I4LD 2LKCA 3E70C 1KSJA 1KMHA 5FPYA 4W9MC 3CO5A 3QBTA 2O5VA 3CW2A 2WSSA 4CDGA 2OXCA 1IXRC 3ZD7A 1DO2A 1E9FA 2VF7A 2ZI3A 3TK1A 3I73A 1OIXA 2Z6VA
chains in the Genus database with same CATH superfamily
2GJAA 4F8EA 1ABEA 4G5FA 3EGIA 3JR3A 5E3IA 5EGNA 4JMLA 3UPDA 4Z51A 1QRUA 1OGYA 1RM5A 3QWFA 2ZUEA 3D5EA 3L02A 1K1EA 3OKAA 5JDIC 4P5PA 3O8NA 1ZVKA 4YCMA 1JXOA 4ZCQA 5GADl 2M6LA 3UBTA 2ABWA 1I32A 2HV9A 3GJTA 4M8IA 5DHSA 1E1CB 3LS2A 3OOSA 3PKZA 2O2IA 3FVRA 1AKNA 3H18A 3FPKA 3MQFA 3KJNA 5SV2A 3Q10A 4EVIA 3T3PB 2VRBA 4QGSA 4ND2A 1FRZA 1PJBA 2ZS8A 4BU0A 3RE1A 4PZLA 3HCCA 4I7EA 5I8ZA 1W19A 4A3SA 4GYJA 3HCBA 1QH9A 2I6UA 5A05A 4YRNA 1PBNA 2ZYWX 1CY1A 1T4CB 3C24A 1ZC3A 4B4DA 2XGMA 4XQCA 1GTZA 1WPGA 1QZUA 1BX3A 4CKZA 3EULA 2IOFK 3IDOA 4A0RA 3JARB 3ADBA 4XQEA 1SKBA 3VSCA 4KNVA 4AN0A 1L5OA 3D8RA 1IMJA 1RQRA 2TMDA 3KVOA 2A35A 4TXHA 5E6SA 4IS2A 1KWKA 2BELA 4YDRA 1B6TA 4YGXB 3WB2A 1ODCA 5JI2E 3CLRD 1JJ7A 2IC5A 3MGAA 4E5YA 3L4KA 4MWCA 2JBAA 3CCBA 4KPYA 4JGBA 1JVSA 4HYQA 3W5AA 5I7VA 2XTMA 3EG9B 3MA0A 2RBKA 3ZKWB 4J94A 1HT3A 1U81A 2ZWMA 3JPWA 3EAQA 4KR2A 1L7XA 3TEFA 3A2NA 4JLWA 4ZEMA 3E9YA 3OIGA 1XXHE 1Z0DA 3DAOA 2NUAA 4PPNA 1GNQA 3IVRA 1KEEA 1J2JA 2PUJA 1D6SA 2PRIA 4IG9A 3KLMX 1LB1B 2EX1A 5EMMA 4RK7A 3S7ZA 3OZRA 3GJ7A 1NZFA 1PQPA 3ZQJA 1CUWA 1MC4A 3P97A 4JKYA 1IOLA 1M1YE 2YWHA 4R6WA 1Z6AA 3NHRA 3I4LA 3MWYW 3QHAA 4LYFA 3WYAA 3ZI0A 1JHMA 5A4FS 3CF6R 3T1VA 4MW9A 2C4HA 3IS3A 4R9SA 4NIMA 1Q11A 3ONNA 4WKCA 2J3MA 2RGNC 5D8DA 3AEXA 1M0WA 4LE1A 4KEAA 4LJAA 3ZZ1A 1QOPB 3K9FC 2F3TA 1XXHA 1RPJA 3T1QA 1NOIA 1VRVA 5D3MB 4JC0A 1HH4A 2IYTA 1GO2A 4X90A 3KSDO 3UJAA 4YV1A 5AW1A 1CNMA 1SUCA 1NI4A 1EE1A 4BZZA 1EFPA 2B99A 1JYEA 2XHZA 4XPIA 5TXGA 4KO8A 1UOPA 2V4UA 4PLPA 2XVMA 3Q72A 2B4TO 3H9JA 3ZX4A 1M1YA 2IHJA 1VG0B 1OY1A 3CGWA 1ZL0A 2XNKA 5KVSA 4PCAA 1GV0A 3A1UA 2AVDA 1ICIA 3MYRA 4ZHQF 1MX9A 4RPIA 5M5BA 1F0PA 1PD1A 4N65A 2E5FA 2AQIA 4UC0A 3KV1A 2HMVA 2QIPA 3GJQA 3R6GA 1N9GB 5FAXA 2O07A 3JAKA 4RK6A 4IMIB 2Q45A 4PG6A 1A9SA 1WL8A 4IFEA 1J70A 2D1SA 3TVYA 4OLBA 4BDSA 4UD6A 3R3ZA 2HLDD 3GJZA 5AKLA 2X5XA 4EY4A 3S68A 4EBFA 1BD3A 4AUMA 4OQDA 4H3HB 5E6RA 1HE8B 5JSZA 1QG4A 1U7ZA 1IIBA 3QGMA 3TLCA 2AK2A 2TSYB 3V5NA 1OTXA 1ZIYA 2ACEA 1FYWA 2VP3A 3C4QA 1IEXA 2COKA 1EHIA 4GVPA 1W9MA 3H16A 4PYLA 3O8QA 4XGIA 2DVMA 4KYVA 4MI1A 4HAWA 1KIFA 3QVLA 4YP7A 4CEIA 1Q1QA 1E4VA 1C1DB 1ISSA 4LCJA 1I6MA 4XEHA 4OHRA 1E98A 1TW2A 5KNBD 1LH0A 1XVVA 1ZCZA 2GJKA 4KIGA 3PCRB 2GDZA 4JB0A 4RQTA 4YS6A 1S5PA 4BP8A 5IG2A 2QSYA 2NZYA 4UZFA 4BQPA 3L9WA 3EXIB 1KK0A 2Y1CA 2EP8A 1Y8RB 2BM9A 2H5JA 4INOA 1AM4D 1QV7A 2FUCA 2HUPA 2CXQA 1SKUA 3U1VA 3UK0A 1WMFA 2JFPA 1VJ1A 3JVEA 3N8DA 4IZ6A 1E6MA 3B36A 2HPZA 4OHMA 1XRSB 4R1SA 3TBKA 5I01A 3IDQA 3I9OA 1GQRA 1XMVA 3VOSA 4M98A 4MRAA 4Y1EA 4HG2A 4G4JA 5ICCA 5KREA 4JJEA 3IQFA 2IUEA 3L07A 4PIPA 4WFJA 1SGWA 3UJ6A 2WTBA 4A4DA 1M1NA 1OXBB 1TQ6A 5KQSA 8ADHA 4JI4B 1ICEA 4M1YA 3GP8A 4QO8A 2IGTA 1UINA 4PC3A 1J2TA 2TMKA 1JA9A 3FUTA 3C14C 4RD4A 4BQNA 4JT9A 5AUOB 2IE8A 2JDIA 2ZRIA 5JT1A 4MIKA 5DM60 3ENZA 1D2NA 3IKMB 2VNIA 1ZD2P 2EZ8A 2GPSA 1E3LA 2ZSUA 4DSAA 3FFWA 5DYIA 4DW8A 1YJQA 3G7SA 1BX0A 1SXJE 2P75A 4MVXA 1ZESA 3J80A 5DX1A 2O48X 1SXIA 3QUCA 1DMRA 3QKSB 1CZRA 3FVTA 3GD5A 4P86A 4UU1A 4ZANA 3T3GA 4D8YA 3R5JA 4EUEA 2I6XA 2L42A 2W00A 1WQ3A 3DEIA 2P68A 4R68A 1WCYA 4W1RA 4CMKA 9ABPA 3KUCA 5JNRA 1OIWA 3H4MA 1VIMA 3QSGA 4P3PA 1NHWA 4LRQA 2C7RA 1U2PA 6REQB 4P31A 2Y27A 1J2RA 4XEUA 5MFZA 3NYRA 3BFPA 2GZAA 1L7QA 4R2LA 4ZAXA 1R66A 2J3QA 4GKBA 1E96A 3OECA 3ZGOA 3BDVA 2RARA 4B71A 4MR9B 1K0UA 4ESEA 1SXJA 2VEOA 1Q57A 1U7PA 2EBHX 4K6KA 3DBVO 5JAPA 3FMOB 5T6MA 3F5DA 1U8YA 2JKVA 2JLYA 1NM5C 5HIAA 3QJGA 1LI5A 1WDMA 3HVHA 3AF4A 1DIGA 1Z36A 4S24A 3AEQB 3TQTA 1U9YA 4DLRA 3BF8A 4MSUA 2HU8A 4C22A 4DCCA 4ZMRA 3HBAA 1KETA 2IY8A 1L5VA 1NN1A 3NEJA 4M0CA 4YROA 1CZKA 1JHUA 5AVQA 3M6MD 1VDMA 3VR5D 5L53A 3FLAA 3JZFA 2IV3A 3L1UA 1G291 3TKYA 1MFPA 2ZSDA 1RXIA 4FT2A 3U48A 4HRVA 4JQCA 1JMVA 3HP1A 2C61A 3PUJA 1BWRA 5T4EA 2K7ZA 3LNTA 4KQJA 2QP9X 4DBLE 4EHHA 1SOAA 2GUGA 1F8UA 3G9UA 4EHIA 3RG8A 4TT3D 4QE3A 1KF0A 1L5QA 4GM0A 2Y0EA 3AM3A 3U49A 2RK3A 4K9OA 2AMLA 5AKJA 1Y4SA 3HE3A 4WLUA 4TMVA 2C88A 2Q6IA 1WV0A 4FI3C 3QK7A 3IOEA 3W77A 2QUZA 4Q9IA 3GJ3A 4YRKA 5A3JA 4HB4A 1I7DA 4IDFA 3H1BA 4QOGA 4R2IA 4BNZA 3A4MA 3PCTA 3IPRA 4JAVC 3SKXA 1HYHA 1MA3A 2C5FA 2P0AA 1MPXA 2XOKD 3HB0A 4BWVA 4CZ2A 4EYKA 5AXDA 4Q4HB 1QDEA 1S9DA 4LOLA 2IZ5A 1ZAYA 4IIVA 1E6CA 2VTEA 4M36A 2HSDA 1RKUA 2O2XA 4PC2A 3K6SB 3IALA 3LIIA 3V2GA 4P32A 1M66A 1A5SB 1ETUA 1DTWB 4OD0A 4Q18A 4KR3A 5BYJA 3VOAA 3ZXSA 4Z4EA 3SG0A 1SVIA 4O4HB 1KMQA 4ME6A 3IB6A 1A2OA 1NQTA 1U1CA 2J4DA 2GM3A 3C6ZA 1G9XA 1ORWA 2C3UA 2IVFA 3A1WA 3CX7A 3NX4A 3WGZA 1PJSA 1WBBA 3KAJA 4DIEA 1BCSA 1JKFA 3IBTA 3LUPA 5B1HA 3L4BA 1NNUA 4J7UA 5JJIA 5JD6A 1XYVA 1ZNZA 3R7WA 5ALHA 3OICA 4C7MA 5GONB 2RAUA 4IMRA 3DFIA 4NMXB 3EQ6A 2BGWA 1FSZA 4B40A 1L5WA 2BMDA 2SKEA 1EYZA 2VT7A 3JATA 3NBZC 3KXPA 1E2DA 2JIMA 5ECGC 3F1KA 3UWSA 4DEXA 4IHJA 1UPUA 3HK2A 3I5YA 3KLOA 3K5HA 1TVMA 4GI1A 1N8KA 5HDBB 5EQDA 3IE0A 3ZWXA 4Z8XA 5JVDA 3KSBC 4D4KA 4DJDC 1M8PA 1T5OA 3NR2A 3HCAA 3BXPA 4XPZA 5JCXA 4AO8A 1EUCA 2RGEA 1HBJA 2VJYA 2ZKIA 4JI0B 3NAZA 5JE8A 1NXVA 1KYQA 3FBTA 3V8QA 3A7DA 1KYWA 1R4ZA 3PXBA 4QGHA 3UMBA 4HGNA 2GXSA 5BWCA 4IQ0A 2WR8A 5DNVA 4PQFA 2AN5A 4GOKA 2VATA 1EDOA 5IZCA 1L3IA 4ER3A 2O54A 1J5PA 3E3MA 3B5IA 3G79A 4DBZA 3PVZA 5EEHA 1RSZA 5ITZA 3KFXA 2HM7A 3NWPA 2OESA 1ONPA 1CY0A 4AJ4A 4EHFA 1QFSA 2BZSA 2FE4A 3LY7A 4FE3A 4US0R 3U3ZA 4CLOB 4DLZA 2FMTA 1G20E 1H0SA 5AHXA 3IMKA 1SR8A 3ROFA 3T1OA 1JAYA 4W7SA 4WY2A 3T7AA 1X7GA 2H1RA 5FTKA 1A2BA 1E3EA 1KQ3A 1LX6A 3ZTWA 1RHKA 4R5MA 3RASA 4H7PA 5CM8B 3OA2A 1JB9A 4O29A 3B70A 2AZTA 3VDNB 1WUTA 1GKUB 1QVAA 2IZ1A 1YCGA 1GD1O 2QA5A 4ZV7A 5C1DA 4KAJA 3RK1A 4LTDA 3LW7A 1YRQA 2MSNA 1XD9A 3ZHTA 4JLNA 4DLAA 4C06A 5ADHA 1NJ1A 2QIOA 4Q5IA 1DC6A 2UUPA 3TB4A 4B0PA 4EUSA 1GRNA 4LYGA 3LCVB 1G20A 3P2MA 5CVJA 2B1IA 3GFPA 1D5WA 2AF3C 3PKIA 2DF8A 4GLBA 5AM0A 4Z1MA 3MS2A 1TYCA 2GVNA 4EPXA 4EHDA 3KWMA 1C3OB 4JJKA 2JGKA 1E3WB 1K06A 2FPIA 1I2DA 1ST3A 2JVKA 1XTTA 2NU6A 4LXXA 4TQUS 4CGZA 3D6JA 1CG6A 3DOHA 4RM2A 1XPRA 3IQIX 1KL7A 1NT4A 2PLFA 4JY7A 5AXCA 4G8CA 4PZAA 1K6XA 3QIAA 1AHPA 2XMSA 4NP6A 3MK31 2ZULA 4HNUA 3WZLA 1XJ5A 2FA9A 3LTEA 4ZGWA 1VOTA 3OZFA 1GZSA 3Q5GA 4DNXA 8GPBA 2C84A 5LJIA 3HXQA 1PYGA 4E1AA 5K03A 3SS9X 1X6VA 2X7XA 1L7EA 3NW9A 4URXR 1C14A 2Z4RA 4EM6A 4REOA 1IE3A 5CDHA 3HHPA 3ZGVA 3AEZA 5ELXA 4G97A 2GBLA 2ACVA 1LLUA 1Z26A 3Q7QA 3BB4A 4ZVOA 4DA7A 5GIPE 1P2UA 3E4CA 3KUUA 1U28A 3KVYA 1UKZA 3IXQA 5FI0B 4PSCA 3LRTA 2OHXA 2VTDA 1NJFA 2FN4A 2PO7A 5E9QA 1P1HA 5HKLA 5B53A 2HJSA 4CN9A 5FOQA 3RI3A 4HVTA 5JOQA 2NYRA 1C4WA 3A1SA 5JS2A 5FWDA 4DLPA 2ZE8A 1ZI8A 4WFIA 3IILA 4GPD1 5AWFC 4AW9A 1UR5A 2FZCA 3G9ZA 1PAUA 2I78A 2C58A 3ONDA 2BE9A 4CI0B 1IXYA 5DI3A 4O63O 4V3BA 4GLLA 1IY0A 2WKRA 3MBIA 2XUGA 1CCWA 1B7GO 16PKA 1ZW6A 4ZQFA 1KO8A 1ORVA 3BRWD 4XGQA 2FEOA 3EGDB 3L7AA 3WHLA 1W0JD 3FZQA 4CM1A 4D9BA 4G0UA 1IHOA 2ODQA 1Q7BA 3NHYA 3NT2A 3TTXA 1FMFA 3E35A 3RH0A 4BFSA 2VT6A 4LQCA 5FPHA 1JHZA 1SKYE 2P6UA 4BVLA 4CF3A 2CL6X 1J90A 3L8GA 4CL0A 1XEXB 2C4NA 3I6ZA 4LGYA 5IX8A 4HATA 1QMPA 1E20A 2QTVA 4YRCA 7YASA 2W2MA 3O1HB 1MU0A 3QVWA 2J31A 5AKXA 1RKBA 1T2VA 2VAXA 5H3LA 2PQ6A 4IGFA 3QRWA 3AHFA 3M6VA 1JG3A 1AY0A 1IB6A 3LNCA 4MZDA 1LRKA 2C98A 1HE3A 2AK3A 2NZ8A 4ZOEA 3QELB 3NC4A 3JQ8A 3VU8A 4D1YA 3TG8A 4XX0A 2AOUA 2HRZA 2QTAA 3AIKA 3IUNA 3WK4A 3T9FA 2I9KA 4ZCTA 1NQAO 3E9QA 3LP6A 3EEQA 721PA 1JFFB 2DR0A 4YRPA 3AXSA 4G0MA 4AX4A 2RI0A 1LPPA 3DWEX 4WLNA 3OQMA 1M6NA 3K16A 1A88A 1UUFA 2BEJA 1QZ3A 2UKDA 3J7TA 4MAAA 4LF5B 5DLPA 1B8UA 4N7BA 2ZSAA 3JWJA 5C53B 4RD0A 4LRWA 2DEUA 5FP0A 1FDVA 2WF5A 2WTNA 1SD5A 3CB2A 2R8BA 1P1FA 3MQ2A 1QQTA 2IYXA 3H13A 3U2QA 5HCIA 1X7YB 1MDFA 1D6MA 4RULA 1TF5A 2BKVA 3N2YA 5HFAA 4B34A 3AEUA 5LYJB 2E4WA 3DXXA 4I50F 1BAPA 1GPKA 2ARKA 4CG3A 1Q95A 5LCXA 3IIKA 1GGNA 1KRHA 1VE5A 5DCYA 1IJFA 4AJNA 4ARCA 3R24A 1U0HC 3A70A 2MYPA 1DQPA 2BMWA 4UDXX 3QWBA 3LRPA 5C80A 5IJ0A 3NTLA 1TPZA 3AV0B 3CE6A 2D1TA 3CLTD 3IKJA 3V1NA 1ZM2A 4EIWA 3KETA 3D6FA 3OFVA 4Z99A 4EW2A 2EYUA 1VJ0A 3CF4G 3DKRA 3GFQA 3VKWA 4WRRA 3FNGA 4CV2A 1HDRA 5IDYA 1L8AA 2E9SA 4NEQA 4XSHA 4IWXA 4N9QA 1UBHS 1ZUD1 5D3ZA 4I8IA 2C9BA 2YHUA 3D2AA 4O4IB 1P7YA 3ZWVA 4FSHA 4KX3A 4MUEA 2ZJ3A 5DEOA 1CDDA 1RXCA 3UO8B 3A11A 4U5QA 4XD2A 2ES4A 2QU7A 4AJLA 3C3KA 1Q7EA 3JQ7A 1N32B 1NVVQ 3N8IA 2J0UB 1XKTA 2VUIB 5KDLA 3ZHBA 2B94A 2AFHE 5G1NA 4UNSA 4MH0R 2B1RA 2J85A 2PL3A 4QYSA 5JATA 1L1FA 3VR6A 4MP6A 1EK5A 3WADA 4R2JA 3ZE0B 3ZU3A 2PWPA 1PE0A 1BXGB 5A4AA 1AMOA 4LF8B 1XDSA 2MSKA 3IUMA 2COUA 4CEJA 1C1HA 1USWA 4PLFA 4P35A 3LT2A 1C8VB 4CDNA 2P5SA 3S2IA 4EEKA 1RCFA 6ADHA 3S2FA 2YN4A 3D3KA 1CF2O 2YMQA 3DZDA 2Z08A 3N5CA 5KINB 3WY9A 2Q2VA 3ICPA 3SEFA 4D41A 3IE1A 3H5RA 2R8PA 3OVMA 4AO7A 2GYWA 4YRBA 5HUHA 5F3RA 1RWVA 4H16A 1NQVA 2AFHA 5FTMA 4EELA 1Z4QA 4AZSA 5CDUA 4J8PA 2R25B 2I2CA 3TCXB 2XUOA 3IPXA 1N77A 4OQ4A 4W9RA 2E21A 1I9GA 4BQIA 4MRNA 3PC2A 3PNBA 3UJDA 1ZWKA 2QGZA 2NX2A 4GE3A 2AI3A 1E0AA 4L5BA 3AW8A 1TIBA 3MWFA 3OZVA 1ZUNB 2VFAA 5B30A 2KX7A 4C0XA 4L7QA 1NFFA 2P1ZA 1UJMA 4MUJA 3GXBA 4M9XA 4OXXA 4BWFB 4EARA 4KPGA 2DAPA 4Q24A 2B4RO 2EDCA 1RCTE 3MJ4A 1PR6A 4YJ2F 2F8TA 4LVNA 4B9AA 1SNYA 4RK0A 1L9XA 4I19A 4WESB 4B2LA 4ZCRA 1FS4A 1VKNA 1I7QB 1WSAA 3I2JA 4LY3A 4D8WA 1QHGA 2PH5A 1ABFA 4NABA 4LY9A 4NV0A 5L3RA 2ISSD 3Q9NA 3LUGA 2NU7A 2P5UA 4KMOA 3T3IA 3T6KA 1WUKS 4G1UC 4TQGA 1WEKA 2ISCA 4Q00A 4EF6A 3NOQA 1LA2A 1JKJB 2BOVA 2ZI9A 4IOMA 2CXOA 3MCZA 4ENWA 3T3NA 4HDCA 1ZIDA 2W2PA 4PCUA 5TVGA 2XUDA 3GD7A 3BQ9A 3EIOA 4RPKA 4YASA 1W47A 2CHEA 4NE2A 1U3VA 2GOYA 3EHDA 1V16A 4ZOAA 1YBHA 1X1SA 5ADVA 5SZKB 3PGJA 1ZMOA 2GCPA 1GZ6A 4OHBA 3CVVA 5JV5A 1GR0A 1E64A 3UGQA 5EJGA 4XSGA 1JTFA 4AY6A 3IIMA 3UT5A 4KK4A 4IGAA 2FKAA 1D9XA 1FUKA 5AFSA 3NYQA 2A9FA 3ETDA 4NAHA 4TV9A 2VHZA 5A7FA 1PG2A 3A6GA 3H7AA 1Q0UA 5JRDS 1SUPA 2YWXA 3T9EA 1C9JA 2JLSA 3LXMA 4KWHA 4LN1A 4Q4AB 4B46A 5EHZA 1RWOA 1O0CA 4X66B 4M1MA 4CTNA 3BE6A 3PU6A 2FPMA 3FY4A 2PZLA 3A05A 1P4JA 3GQVA 5GM1A 4FNAA 2B7LA 4ISCA 2XMGA 4R83A 4WBSA 4YHBA 3MUOA 3BF7A 1FP4A 1HF3A 1U80A 1YOVA 4DCVA 3UAZA 1PYDA 2V4ZA 4DRYA 3IAHA 1ABBA 3QU7A 4Q7JB 2AMFA 2HLHA 2Q2QA 5KNDH 3VUEA 4N5NA 1NSFA 1MX5A 1EFRA 1ULTA 2O06A 3MTGA 4FMCB 4K9DA 5A4DA 3FI0A 1E9AA 1K2VN 3S1AA 4BATA 3CT4A 1GUDA 4YCCA 1A69A 2BWJA 2VP6A 5E4YA 3GMDA 3ZNPA 1AA6A 3PA8A 4UATA 2FMXA 4BJ6A 1VPVA 2J5QA 5C1BA 2AC4A 4GXNA 3QX8A 1DARA 3LPMA 3PR1A 5GOZA 4UUAA 5KTTA 1GNTA 1MO5A 3TW6A 5AKGA 4G5YA 1NVXQ 2E4UA 4MVJH 1KC1A 4EHJA 2LDXA 2ZJOA 3N8GA 1S8OA 4MKHA 3SQNA 2AHRA 2GD6A 2NO6A 2P2NA 3KOYA 3VZRA 1UT5A 4N1AA 4PZDA 5ALPA 1WXEA 4H59A 2GYUA 4C7XA 4H1VA 3SICE 1AIPA 3R7SA 3VPCA 5F1YA 2QM8A 1G6Q1 4QU9A 2CFCA 1WKCA 5JMTA 4MMXB 1VSUA 3VHLB 1NJSA 13PKA 3I8XA 4BNXA 2WQZA 2Q9AA 3BCRA 3SMVA 5TMDA 2FWPA 3SSAA 3R74A 2VCYA 2OO5A 3IYLW 1S8AA 2FG6C 1XHEA 2XWPA 4J03A 1F8XA 3DF7A 2YMMA 4KRYA 1CWUA 4LI3X 3MD9A 5D5PA 3NUZA 4Y9RA 1OC4A 3MCTA 3E48A 3JD0A 3R7DA 1R1DA 1ZCJA 1L9KA 2RB5A 3AR8A 1EGHA 2AIRA 2D59A 3ITKA 4HDNA 4YQZA 3HBMA 2Q29A 3CZRA 3WGLA 1YTLA 2HPAA 2I6FA 5D85A 4GMGA 3VAAA 1SIUA 1RWKA 3D5TA 3U80A 3M2PA 1NDHA 4NENB 4AY4A 3BIJA 4D82A 4V0RA 5H83A 2I1WA 2IL1A 3ENWA 5HYVA 1RWBA 4BVFA 2I03A 1MP0A 1PR2A 3FVQA 1AB6A 5DNWA 3RAPR 5GJBA 4NCHA 2IPNA 4G26A 2E89A 4PAQA 5B3LA 3W78A 1YACA 3E9CA 1VI2A 3OLXA 1NJ5A 4RHUA 5MGNA 4C0KA 3FCCA 3QLEA 4RDIA 4A5OA 4EFLA 5HKBA 1H4QA 7REQA 1A4UA 2XBUA 1NXPA 4O4JB 4QYMA 2JI7A 1KI7A 2D4AA 2XUHA 3AM1A 3E1GA 1BVUA 5C4IA 1BMTA 1ULZA 2WQ7A 1NVVR 2LV8A 1M1XB 1D0SA 1E1LA 3WDLA 1W0KD 5EXXA 2O2ZA 2GO7A 4IJKA 5DIFA 5KYNA 1VA5A 2NPIA 1UWCA 1S1CA 4G5HA 3NKVA 1P9WA 1Z6QA 1X7WB 2TS1A 3FE2A 5AOAA 3ZCXA 2CE7A 4RUKA 4EKGA 4KFSA 3PC4A 4P4SA 5JMPA 3X2FA 4H77A 9LDBA 3H8SA 2C4MA 4MYSA 2G1AA 3DMTA 2CNDA 5FNVA 2UZ1B 3ZJUA 3ZN2A 1QFXA 4KZKA 4UUNA 4NDZA 2XYQA 4ZAYA 3FNQA 3TIXB 4EB0A 3QEKA 4WGFA 4QFDA 1I5OA 2IUYA 1D6NA 1G7RA 2JH8A 1HYGA 4GSYA 4KGVA 1FNCA 3CX6A 1P2VA 4GPBA 1EK0A 2Y93A 3BN3A 2FPUA 1BGXT 2JAHA 5D86A 3U81A 2PT6A 1FYVA 4COKA 4YJ3F 3VO9A 3KUDA 4G1MB 4JSYA 1CPYA 2PXAA 4WUTA 3GR6A 3SPXA 2YIVX 4L51A 2PKQO 5ULLA 3VU1A 1VMAA 1E9CA 3PBKA 3RVMA 5LXTA 1B1CA 1GLGA 1T8SA 5EZYB 3W5BA 5DBGA 3HKBB 1KZGB 4FXOA 4UPDA 5HFNA 4HZUB 1YR1A 4HB2A 1M7GA 2X5NA 1ZH8A 1WB6A 2J5BA 2H2WA 2NO1A 2QRGA 5F78A 1P1CA 4JVOA 3MJFA 4H0CA 4D02A 4AJJA 2QQEA 3ZE6A 2Q4EA 5BQXA 1Z73A 3RAGA 3A1FA 2HI0A 5C7YA 1OJ7A 3RRNA 1JXMA 2WTEA 4UEOA 5DMXA 5LFAA 3OSUA 9MHTA 3QBJA 4GG1A 4PTLA 4HX5A 2B69A 1M2HA 1N5OX 5AKHA 3X2EA 1HLFA 2WDPA 3KPJA 3H2BA 3IHTA 5ENZA 4MUAA 4ZO7A 4BN5A 3QUQA 2PH7A 3GVXA 4UCWA 3GDHA 1FYDA 3W8RA 1HX7A 4BO5A 4OKIA 1AZSC 4G0ZA 5ER6A 2FDXA 1HEIA 2JHGA 2ZIXA 4LX8A 3W2IA 4N3CA 3LWDA 3VPFA 4PXYA 4JGIA 4CLXA 2VH1A 1P91A 2A1UA 3L0IB 4LXIA 4BEJA 1KYTA 3SBXA 4R7TA 4DMCA 1JG6A 2FMHA 3AU8A 3T4EA 3B1XA 2JK1A 4NKRA 3FTPA 3HZRA 3I6BA 4WZAB 1SUEA 1Y80A 2AR9A 2D13A 5CA0A 2W6PA 3UB2A 3ZTYA 4CF6A 3ZDAA 2V58A 4EFDA 2IUTA 2BH2A 2QZSA 1PVOA 3PYXA 3W5JA 2NQ2C 3TR0A 1X1TA 1XNRB 3DTVB 2KLHA 3C16C 4L73A 3CNLA 3HVIA 3T3HA 4FFBA 3QI7A 2NU8A 3VJLA 3ZEIA 3ZGZA 4LY6A 3C7DB 3NAMA 1FS6A 1H22A 4UUOA 4W5RA 3UJ9A 4EGSA 1XVAA 3EVGA 3SWWA 5KYYA 4BMZA 4JLUA 1U7XA 2A1IA 3VHXA 5B4VA 2PX3A 3TOCA 5JROA 5KI6A 4M99A 4BS9A 1XPJA 3CF4A 1NHGA 1HE1C 1QC5B 4JI8B 1R6DA 4ZICA 1QZTA 3P9QA 1UBNA 3CXRA 2OHGA 4KYUA 5AQ1A 3FSJX 2OQ2A 2JI4A 4JVSB 4FW8A 4EW3A 1YB4A 4ZU1X 2OO3A 4YMLA 2GNOA 2IYSA 4KAFA 1DKNA 1NATA 2VP2A 3L5OA 4DOMA 2Z2JA 3PP8A 1K66A 2MSWA 4Y9TA 3T7IA 3L6BA 3WB0A 1Q15A 4PC7A 5DTMA 4GC5A 3NXSA 4QGAA 3BAFA 4WVFA 3ZV4A 4BB0A 3O8LA 5BOSB 4OX9B 4I8XA 4P7KA 1EGMB 1E66A 1W76A 3OLCX 2GFQA 3AY3A 4OSOA 5EP1A 2ID7A 1XTQA 2OD7A 2WVGA 2G1UA 3S2ZA 2APJA 3U7JA 3H19A 4RTLA 3MGCA 4DIKA 3OTOB 2R7NA 4L72A 4NFYA 4X5OA 5H80A 3TN7A 4Z4IA 4P4UA 2XMDA 2XCUA 5BWNA 3F3KA 4Q9HA 5FX2A 4B73A 2WJZB 1N5IA 2XRFA 3IEVA 3T9CA 1XX6A 1QYCA 2JFHA 4B4VA 4KR6A 3VDQA 1SB8A 4FQ7A 1T5IA 1FJXA 2P2GA 4AKIA 3QVGB 4K28A 1WW3A 4EA7A 5HRUA 4OJMX 3SZ3A 2MSDB 1XTJA 2ZWAA 2ORED 3ZHRA 1Q0ZA 2JH3A 5BR7A 1ZGCA 4M1QA 4UZSA 5CT9A 2VRNA 1KZ7B 3QXCA 4YPFA 2VO1A 4HVCA 4IQ4A 3NM4A 4EK9A 2F64A 1QBKC 2BEWB 1JEYB 4CF5A 2RHLA 3MHTA 3DBRA 1FLAA 1LS1A 1KP3A 2PSFA 2RGDA 3N7TA 4Q3AA 3VSEA 2VTBA 1LV7A 2GN4A 2CSXA 3KR1A 3EZ6A 4LECA 4MPPA 2I6GA 5KOYA 4GAEA 3D4OA 1O6BA 5E3HA 1C7JA 3H1FA 1Y7IA 4KO3S 4FFPA 4QU8A 4HO1X 1PLKA 2EW1A 4YQEA 1ZBDA 1THZA 1WU8A 4RS4A 4YO8A 2B98A 2BPOA 4OAOA 3F78A 5F5XA 1BW9A 3W9UA 2VJNA 4DRXB 4B83A 1GL3A 4ZZIA 1SZPA 1NLMA 4OHKA 4R41A 3FTQA 1J22A 3EIQA 5CX4A 4S1NA 3AV3A 4GDMA 2LXNA 2P3LA 4XQ0A 1E4YA 1K8XB 3V00A 1P2TA 3PF9A 4B85A 2V7TA 4PPGA 4TTIA 1CJBA 1LNZA 2BW0A 4Z4CA 3NVKI 3SX0A 2O2GA 3WB9A 4CMIA 4NXNB 1ULBA 1ZX1A 3R23A 4RCYA 3DEAA 2JLBA 1R4MA 3TX6A 2DZDA 3G6KA 3QMWA 4GR4A 1W87A 4LXGA 1YRBA 3RJ5A 1GGJA 6GPBA 3RC7A 1R6VA 1TZBA 1YMQA 2ZDQA 2XRYA 5EIFA 1XZ8A 1UPBA 1YVUA 5DOZA 4D46A 2PE5A 3T1HB 2AZ4A 3NTQA 2YHAA 3B9BA 3RRFA 4B3IA 1E1YA 4LE2A 2JAXA 3SYNA 4CIXA 1D07A 3AR9A 4GICA 3RTGA 4DQUA 4N5HX 1E6KA 2VHXA 1WZIA 2ZBFA 3CZCA 2QAGC 4LVUA 4BFUA 3O3MB 2VBCA 3P9NA 4XJVA 1IM8A 3SNHA 3FTEA 1JVNA 3CUKA 3TDKA 2H2HA 4LIPD 4QG7A 5ARBA 2RE8A 3CH6A 3V7WA 2NXJA 3S4YA 3JD1A 3K8ZA 1L7DA 3H9CA 4HDKA 3KKLA 3GPIA 4BNKA 2YVAA 3RSQA 2GN2A 3KYDB 3I83A 2OENG 4M0DA 5DTEA 4XQGA 1YCHA 1Z0IA 5KYVA 5I51A 2XCSB 4EUHA 2YJGA 4B6QA 4Y2UA 4CKCA 3IL2A 1IRXA 4LXYA 5HZKA 5FOSA 2HBRA 3DBLB 1U8TA 3GEDA 4JOQA 3TQRA 3WKBA 4A2WA 5BV0A 1DCTA 3V46A 3P94A 4DDMA 2YRFA 4QJ5A 5JAZA 1D2EA 4P8RA 3IO3A 3KOXA 3OESA 5E3JA 4TWZA 3V8MA 3I9V6 2BEVB 2PUTA 4HSGA 4L08A 1O94C 1BMQA 1DG9A 1GAWA 1MV5A 1DBPA 1V35A 3G49A 3TTYA 5CXUA 1MTOA 2DC1A 2WFMA 2VHEA 3AHDA 4W5OA 2PX0A 2W8ZA 3TNYA 4CWAA 3PDIA 2DBVO 4I4IA 4AJ2A 5IP5A 2OZLB 1G9SA 1V26A 3CX4A 1EDDA 3C70A 3IP5A 2UZ0A 3K30A 4JEHA 3CNNA 3F5QA 2GCOA 3QU4A 5EJ4A 1QOZA 1K6MA 1MJHA 1YNSA 3DL4A 3P71T 2B82A 4LRSB 5ERYA 4D92A 5DHUA 5J23A 3AB8A 4ROTA 2FB9A 1T25A 2MWMA 4K6FA 4Q7EA 3OTHA 4ALLA 3I9JA 1EVIA 2VJPA 3IIJA 5BYKA 5KTOA 1LI7A 5HCUA 5KTPA 1Y4AE 5DASA 4NCKA 1GPH1 3COYA 3MN1A 3E22B 5BN1A 3CNEA 2FPGA 5FOXA 3RC3A 5TMPA 4YJGA 2CHQA 2O52A 3OZWA 3EHEA 3GA7A 3KPUA 1YA6A 1G19A 4KDEA 1KU6A 3WIDA 3UK2A 1TJ3A 3D3NA 4AZVA 2HJVA 2C2GA 3FA2A 4MZXA 1ZW1A 4C0JA 1UK8A 3MRSA 2CE2X 1T0BA 3MJTA 3JQFA 2GCNA 2X0NA 2I4TA 2H4JA 4MWGA 1CIJA 3KCNA 3ASUA 3GAZA 1SIOA 2A9JA 3S5UA 3UUGA 4XUCA 5A71A 1KSGA 1G6KA 5SYAA 2VYCA 1RACA 4K3UA 5B7NA 4B4WA 2D2FA 4DCPA 3EA0A 1TJNA 1X13A 1R8QA 3Q1LA 1JKXA 4FFMA 3L1VA 3OZUA 4KBGA 3KJEA 4TWIA 4BKQA 5C4GB 4CM4A 3U6BA 4R8SA 5TJHA 5BMVB 4GZ6A 3L0ZA 4HQOA 4R0VA 5TF4A 1CUDA 1QHHB 1TCAA 3W79A 4OL0A 2FRDC 1PJ3A 4QYWA 1BE8A 3DFKA 5T4BA 5J47A 1SUWA 4RIGA 3FDFA 3VHQA 1JHQA 4K9MA 1UAAA 1TT7A 3KLPX 1ZLYA 2NU9A 3GDOA 3P9PA 1S1MA 4MAMA 2ZITA 4RKWA 3WJ7A 2JNWA 3U9SA 1FFHA 1M0EA 4HVLA 1FDSA 4MV6A 3TLKA 3EF1A 3C3BA 4MGHA 4C0SA 1NXOA 3LO8A 2X19A 1JVBA 4MHSA 3AVOA 2PMEA 5K3EA 1WCIA 3GLQA 3NH9A 1KERA 2WUWE 1YAHA 4H17A 4MKRA 4BB9A 1PR1A 3QEOA 4GBGA 4FN4A 1DLJA 5ED0A 4LRTB 1G8GA 1O89A 5F7ZA 2PK3A 2XKJE 3LWBA 3GMSA 5TPWB 5H7XA 2J6CA 1PR9A 2P1RA 2PQ2A 1MW9X 4HH0A 7ADHA 2AYXA 4J3FA 3AY7A 4BNFA 3QX3A 2C42A 2WJAA 4FOOA 1UZNA 1ZN7A 4QPNA 3VR2D 1FU7A 1JR2A 1Z0AA 2ZAOA 3QKUA 2X6QA 2EWVA 1OAKA 3W8NA 4BZQA 3CUTA 2QRVA 4OQZA 4MW6A 4TLEA 4CKXA 4CTOA 1S3GA 3DL0A 1IZ7A 2V8OA 3T35A 3UHAA 4C87A 3EXEB 5ALOA 4BLOA 3FD8A 1D04A 2WF7A 4GRIA 4Q1FA 3IDFA 3IAXA 3Q8XB 4HMOA 3T7KA 3UJCA 5CYGA 3ZDXB 5B6IA 1P2FA 4JHXA 3RYCB 2HU7A 2I65A 3C7TA 1A71A 3OUTA 3PNLA 3ZDFA 1W4ZA 3OEEA 3PUXA 4HNRA 3Q8LA 1U5BA 1OSNA 1D1SA 1J25A 2RK6A 3DEFA 3N6XA 5C8XA 1TZCA 3AU9A 4QHYA 1GPJA 4YRFA 3S27A 2ZS9A 3DL7A 4GT1A 3P0HA 4EF5A 1P8JA 4LFBB 1S4MA 1J8DA 1ZR2A 1MXFA 1U1IA 2WM2A 1TO6A 4ZGBA 3WQBA 5KOHB 3FB1A 2IPAB 2W2XA 1DDGA 2IZZA 4W8HA 3GZJA 3IDZA 4M7OA 2E1PA 4XOUA 5BT8A 1T5DX 1SJ9A 3V4RA 3TF5A 5A6SA 3HFJA 4ZREA 1SQSA 3VPBA 4IJMA 1QIGA 4K6GA 3GU3A 4J6EA 2I1LA 3I1YA 2PGOA 5THKA 5FWXB 2IXGA 1XLVA 1TOAA 3CU5A 4AG5A 2CLLB 1EGVB 1JBQA