2A7SA

Crystal structure of the acyl-coa carboxylase, accd5, from mycobacterium tuberculosis
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
529
structure length
529
Chain Sequence
b'IDIHTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDEDSFVELDALAKHRSTNFNLGEKRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEVTMEELGGAHTHMAKSGTAHYAASGEQDAFDYVRELLSYLPPNNSTDAPRYQAAAPTGPIEENLTDEDLELDTLIPDSPNQPYDMHEVITRLLDDEFLEIQAGYAQNIVVGFGRIDGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLPGTDQEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYCVMGSKDMGCDVNLAWPTAQIAVMGASGAVGFVYRQQLAEAAANGEDIDKLRLRLQQEYEDTLVNPYVAAERGYVDAVIPPSHTRGYIGTALRLLERKIAQLPPKKHGNVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable propionyl-CoA carboxylase beta chain 5
publication title Structure-based inhibitor design of AccD5, an essential acyl-CoA carboxylase carboxyltransferase domain of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 171
structure length 529
sequence length 529
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.4.1.3: Propionyl-CoA carboxylase.
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2a7sA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2a7sA01
1PJHA 3QK8A 1XNVA 5INFA 3RSTA 1JXZA 3R9QA 4JCSA 4QIJA 2BZRA 1WDMA 2FZSA 3P2LA 1Q51A 2CE3A 2D3TA 1HNUA 3RSIA 3JU1A 3ZWAA 3VIVA 1WDLA 3Q7HA 4JSBA 3G64A 4F47A 2J5IA 3Q1TA 5CTCA 3R6HA 4EMLA 3H02A 5G1RA 3GF3A 4L6WA 3K8XA 3TVWA 1RJMA 3M6MA 1YG6A 3T88A 3H81A 5G1SA 3SWXA 3Q0GA 3HINA 3KTKA 3QYRA 3V5IA 3IAVA 4B3IA 1EF9A 4ZDFA 4FZWA 1FC6A 4U0GA 4DI1A 4NNQA 3T3WA 5KDRB 3LKEA 1K32A 3TLFA 1EY3A 3M6NA 4U0HA 2UZFA 5DUCA 3NJBA 3ZWCA 3PGQA 2DEOA 2ZQRA 3P5MA 5DKPA 5DZKH 3QXIA 4NEKA 2ZQQA 3HRXA 1Q52A 5DU4A 3OT6A 4I42A 1NZYB 4Z0MA 3GMAA 5E0SH 3NJDA 3H0UA 5G1QA 2GTRA 3GLMA 4FB8A 1HNOA 3H0SA 3QREA 4Q0GA 4GHNA 2J5SA 5DU8A 1N6EA 3MOYA 2PG8A 3H0JA 4U19A 1WZ8A 2J5GD 2VX2A 3ST9A 5C90A 2Q2XA 4YLHA 3OMEA 1Y7OA 1FC7A 3MYBA 4RYFH 3FF6A 1UYTA 1O8UA 4JFCA 3PE8A 2FW2A 2QQ3A 3PZKA 3T8BA 1J7XA 4ZDEA 3MT6A 4JYJA 1K39A 1SZOA 2NP9A 3QXZA 1X0UA 3H0QA 3R9SA 5JBXA 1RJNA 4QIIA 3OC7A 3TT7A 5DU6A 3BF0A 2ZL3A 5DTWA 2VSUF 4KD6A 3U9RB 1XX4A 1XO6A 2EJ5A 1XNYA 1OD4A 3GKBA 3QMJA 1TYFA 4FJWD 4G2RA 5JBWA 2J5GA 4JJTA 1YG8A 4FN7A 3BPPA 3STAA 4MXIA 4RCNA 4ASIA 5INIA 3L3SA 4WCZA 2W3PA 2F9IA 4OMRA 4MI2A 3T89A 4ZU2A 4FNDA 4FZWC 4K29A 3I47A 3DJAA 2WTBA 4L8KA 3QWDA 5KJPA 4U1AA 2VSSF 5CTBA 2X24A 3KTHA 4ZDCA 3PEAA 4KPKA 2ZL0A 4ELWA 3TDCA 4I4ZA 4GM2A 2ZL2A 2X58A 4JCQA 1TG6A 2PBPA 3TZ3A 4EMMA 2Q35A 5E0SA 5KDRA 2ZL4A 3GF7A 1PIXA 4U0GH 3T8AA 2F9YA 4K2NA 4JYLA 5FUSA 2F6IA 4FNBA 2VSUA 1XNWA 2A7SA 4IZBA 3R9TA 5DUFA 2FBMA 1W2XA 3KTGA 3Q0JA 3DORA 3HE2A 2VSUE 2C8TA 2F6QA 4KNPA 4OG1A 4EMPA 4RYFA 1FC9A 4ELXA 3P85A 2J5II 3KTIA 5C9GA 4JWVA 3BEZA 3HP0A 5INGA 3TT6A 2IEXA 4MOUA 5DTPA 1VRGA 3ZW9A 1HZDA 4B3JA 2PPYA 2VSSA 4K3WA 1FCFA 2J5IB 5MGBA 3U9SB 4I52A 2A81A 3WG5A 3RRVA 2VSSE 1UYRA 5DL1A 4U18A 2DUBA 1MJ3A 4HNKA 4JOTA 1UYVA 5E0NX 4KWBA 1UIYA 4IZCA 1N6FA 3U9TB 3SLLA 2F9IB 3MFMA 4Q1IA 3ISAA 3ZW8A 3KQFA 4HC8A 1UYSA 1ON9A 3FDUA 4JCRA 1OD2A 1DCIA 3ZWBA 2HW5A 5DZKA 3N6RB 4ZDBA 4FN8A 5IKLB 3R0OA 4OLQA 4WZ8B 3KTJA 3TVUA 2Q34A 3IB9A 3TV5A 4JCTA 4ZDDA 4IZDA 2VSUC 4QFEA 3QKAA 3V5EA 2VREA 2F9YB 1ON3A 4JVTA 1N6DA 2A7KA 1DUBA 1SG4A 1NZYA 4ELSA 4LK5A 4B3HA 3TRRA 1EF8A 3HLN1 3LAOA 4WYOB 2CBYA 3IBBA 3K50A 1WDKA 5FIFA
chains in the Genus database with same CATH superfamily
1PJHA 3QK8A 1XNVA 5INFA 3RSTA 1JXZA 3R9QA 4JCSA 4QIJA 2BZRA 1WDMA 2FZSA 3P2LA 1Q51A 2CE3A 2D3TA 1HNUA 3RSIA 3JU1A 3ZWAA 3VIVA 1WDLA 3Q7HA 4JSBA 3G64A 4F47A 2J5IA 3Q1TA 5CTCA 3R6HA 4EMLA 3H02A 5G1RA 3GF3A 4L6WA 3K8XA 3TVWA 1RJMA 3M6MA 1YG6A 3T88A 3H81A 5G1SA 3SWXA 3Q0GA 3HINA 3KTKA 5HUQA 3QYRA 3V5IA 3IAVA 4B3IA 1EF9A 4ZDFA 4FZWA 1FC6A 4U0GA 4DI1A 4NNQA 3T3WA 5KDRB 3LKEA 1K32A 3TLFA 1EY3A 3M6NA 4U0HA 2UZFA 5DUCA 3NJBA 3ZWCA 3PGQA 2DEOA 2ZQRA 3P5MA 5DKPA 5DZKH 3QXIA 4NEKA 2ZQQA 3HRXA 1Q52A 5DU4A 3OT6A 4I42A 1NZYB 4Z0MA 3GMAA 5E0SH 3NJDA 3H0UA 5G1QA 2GTRA 3GLMA 4FB8A 1HNOA 3H0SA 3QREA 4Q0GA 4GHNA 2J5SA 5DU8A 1N6EA 3MOYA 2PG8A 3H0JA 4U19A 1WZ8A 2J5GD 2VX2A 3ST9A 5C90A 2Q2XA 4YLHA 3OMEA 1Y7OA 1FC7A 3MYBA 4RYFH 3FF6A 1UYTA 1O8UA 4JFCA 3PE8A 2FW2A 2QQ3A 3PZKA 3T8BA 1J7XA 4ZDEA 3MT6A 4JYJA 1K39A 1SZOA 2NP9A 3QXZA 1X0UA 3H0QA 3R9SA 5JBXA 1RJNA 4QIIA 3OC7A 3TT7A 5DU6A 3BF0A 2ZL3A 5DTWA 2VSUF 4KD6A 3U9RB 1XX4A 1XO6A 2EJ5A 4HDTA 1XNYA 1OD4A 3GKBA 3QMJA 1TYFA 4FJWD 4G2RA 5JBWA 2J5GA 4JJTA 1YG8A 4FN7A 3BPPA 3STAA 2YJGA 4MXIA 4RCNA 4ASIA 5INIA 3L3SA 4WCZA 2W3PA 2F9IA 4OMRA 4MI2A 3T89A 4ZU2A 4FNDA 4FZWC 4K29A 3I47A 3DJAA 2WTBA 4L8KA 3QWDA 5KJPA 4U1AA 2VSSF 5CTBA 2X24A 3KTHA 4ZDCA 3PEAA 4KPKA 2ZL0A 4ELWA 3TDCA 4J2UA 4I4ZA 4GM2A 2ZL2A 2X58A 4JCQA 1TG6A 2PBPA 3TZ3A 4EMMA 2Q35A 5E0SA 5KDRA 2ZL4A 3GF7A 1PIXA 4U0GH 3T8AA 2F9YA 4K2NA 4JYLA 5FUSA 2F6IA 3BPTA 4FNBA 2VSUA 1XNWA 2A7SA 4IZBA 3R9TA 5DUFA 2FBMA 1W2XA 3KTGA 3Q0JA 3DORA 3HE2A 2VSUE 2C8TA 2F6QA 4KNPA 4OG1A 4EMPA 4RYFA 1FC9A 4ELXA 3P85A 2J5II 3KTIA 5C9GA 4JWVA 3BEZA 3HP0A 5INGA 3TT6A 2IEXA 4MOUA 5DTPA 1VRGA 3ZW9A 1HZDA 4B3JA 2PPYA 2VSSA 4K3WA 1FCFA 2J5IB 5MGBA 3U9SB 4I52A 2A81A 3WG5A 3RRVA 2VSSE 1UYRA 5DL1A 4U18A 2DUBA 1MJ3A 4HNKA 4JOTA 1UYVA 5E0NX 4KWBA 1UIYA 4IZCA 1N6FA 3U9TB 3SLLA 2F9IB 3MFMA 4Q1IA 3ISAA 3ZW8A 3KQFA 4HC8A 1UYSA 1ON9A 3FDUA 4JCRA 1OD2A 1DCIA 3ZWBA 2HW5A 5DZKA 3N6RB 4ZDBA 4FN8A 5IKLB 3R0OA 4OLQA 4WZ8B 3KTJA 3TVUA 2Q34A 3IB9A 3TV5A 4JCTA 4ZDDA 4IZDA 2VSUC 4QFEA 3QKAA 3V5EA 2VREA 2F9YB 1ON3A 4JVTA 1N6DA 4NARA 2A7KA 1DUBA 1SG4A 1NZYA 4ELSA 4LK5A 4B3HA 3TRRA 1EF8A 3HLN1 3LAOA 4WYOB 2CBYA 3IBBA 3K50A 1WDKA 5FIFA
chains in the Genus database with same CATH topology
1PJHA 3QK8A 1XNVA 5INFA 3RSTA 1JXZA 3R9QA 4JCSA 4QIJA 2BZRA 1WDMA 2FZSA 3P2LA 1Q51A 2CE3A 2D3TA 1HNUA 3RSIA 3JU1A 3ZWAA 3VIVA 1WDLA 3Q7HA 4JSBA 3G64A 4F47A 2J5IA 3Q1TA 5CTCA 3R6HA 4EMLA 3H02A 5G1RA 3GF3A 4L6WA 3K8XA 3TVWA 1RJMA 3M6MA 1YG6A 3T88A 3H81A 5G1SA 3SWXA 3Q0GA 3HINA 3KTKA 5HUQA 3QYRA 3V5IA 3IAVA 4B3IA 1EF9A 4ZDFA 4FZWA 1FC6A 4U0GA 4DI1A 4NNQA 3T3WA 5KDRB 3LKEA 1K32A 3TLFA 1EY3A 3M6NA 4U0HA 2UZFA 5DUCA 3NJBA 3ZWCA 3PGQA 2DEOA 2ZQRA 3P5MA 5DKPA 5DZKH 3QXIA 4NEKA 2ZQQA 3HRXA 1Q52A 5DU4A 3OT6A 4I42A 1NZYB 4Z0MA 3GMAA 5E0SH 3NJDA 3H0UA 5G1QA 2GTRA 3GLMA 4FB8A 1HNOA 3H0SA 3QREA 4Q0GA 4GHNA 2J5SA 5DU8A 1N6EA 3MOYA 2PG8A 3H0JA 4U19A 1WZ8A 2J5GD 2VX2A 3ST9A 5C90A 2Q2XA 4YLHA 3OMEA 1Y7OA 1FC7A 3MYBA 4RYFH 3FF6A 1UYTA 1O8UA 4JFCA 3PE8A 2FW2A 2QQ3A 3PZKA 3T8BA 1J7XA 4ZDEA 3MT6A 4JYJA 1K39A 1SZOA 2NP9A 3QXZA 1X0UA 3H0QA 3R9SA 5JBXA 1RJNA 4QIIA 3OC7A 3TT7A 5DU6A 3BF0A 2ZL3A 5DTWA 2VSUF 4KD6A 3U9RB 1XX4A 1XO6A 2EJ5A 4HDTA 1XNYA 1OD4A 3GKBA 3QMJA 1TYFA 4FJWD 4G2RA 5JBWA 2J5GA 4JJTA 1YG8A 4FN7A 3BPPA 3STAA 2YJGA 4MXIA 4RCNA 4ASIA 5INIA 3L3SA 4WCZA 2W3PA 2F9IA 4OMRA 4MI2A 3T89A 4ZU2A 4FNDA 4FZWC 4K29A 3I47A 3DJAA 2WTBA 4L8KA 3QWDA 5KJPA 4U1AA 2VSSF 5CTBA 2X24A 3KTHA 4ZDCA 3PEAA 4KPKA 2ZL0A 4ELWA 3TDCA 4J2UA 4I4ZA 4GM2A 2ZL2A 2X58A 4JCQA 1TG6A 2PBPA 3TZ3A 4EMMA 2Q35A 5E0SA 5KDRA 2ZL4A 3GF7A 1PIXA 4U0GH 3T8AA 2F9YA 4K2NA 4JYLA 5FUSA 2F6IA 3BPTA 4FNBA 2VSUA 1XNWA 2A7SA 4IZBA 3R9TA 5DUFA 2FBMA 1W2XA 3KTGA 3Q0JA 3DORA 3HE2A 2VSUE 2C8TA 2F6QA 4KNPA 4OG1A 4EMPA 4RYFA 1FC9A 4ELXA 3P85A 2J5II 3KTIA 5C9GA 4JWVA 3BEZA 3HP0A 5INGA 3TT6A 2IEXA 4MOUA 5DTPA 1VRGA 3ZW9A 1HZDA 4B3JA 2PPYA 2VSSA 4K3WA 1FCFA 2J5IB 5MGBA 3U9SB 4I52A 2A81A 3WG5A 3RRVA 2VSSE 1UYRA 5DL1A 4U18A 2DUBA 1MJ3A 4HNKA 4JOTA 1UYVA 5E0NX 4KWBA 1UIYA 4IZCA 1N6FA 3U9TB 3SLLA 2F9IB 3MFMA 4Q1IA 3ISAA 3ZW8A 3KQFA 4HC8A 1UYSA 1ON9A 3FDUA 4JCRA 1OD2A 1DCIA 3ZWBA 2HW5A 5DZKA 3N6RB 4ZDBA 4FN8A 5IKLB 3R0OA 4OLQA 4WZ8B 3KTJA 3TVUA 2Q34A 3IB9A 3TV5A 4JCTA 4ZDDA 4IZDA 2VSUC 4QFEA 3QKAA 3V5EA 2VREA 2F9YB 1ON3A 4JVTA 1N6DA 4NARA 2A7KA 1DUBA 1SG4A 1NZYA 4ELSA 4LK5A 4B3HA 3TRRA 1EF8A 3HLN1 3LAOA 4WYOB 2CBYA 3IBBA 3K50A 1WDKA 5FIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJH A;  3QK8 A;  1XNV A;  5INF A;  3RST A;  1JXZ A;  3R9Q A;  4JCS A;  4QIJ A;  2BZR A;  1WDM A;  2FZS A;  3P2L A;  1Q51 A;  2CE3 A;  2D3T A;  1HNU A;  3RSI A;  3JU1 A;  3ZWA A;  3VIV A;  1WDL A;  3Q7H A;  4JSB A;  3G64 A;  4F47 A;  2J5I A;  3Q1T A;  5CTC A;  3R6H A;  4EML A;  3H02 A;  5G1R A;  3GF3 A;  4L6W A;  3K8X A;  3TVW A;  1RJM A;  3M6M A;  1YG6 A;  3T88 A;  3H81 A;  5G1S A;  3SWX A;  3Q0G A;  3HIN A;  3KTK A;  3QYR A;  3V5I A;  3IAV A;  4B3I A;  1EF9 A;  4ZDF A;  4FZW A;  1FC6 A;  4U0G A;  4DI1 A;  4NNQ A;  3T3W A;  5KDR B;  3LKE A;  1K32 A;  3TLF A;  1EY3 A;  3M6N A;  4U0H A;  2UZF A;  5DUC A;  3NJB A;  3ZWC A;  3PGQ A;  2DEO A;  2ZQR A;  3P5M A;  5DKP A;  5DZK H;  3QXI A;  4NEK A;  2ZQQ A;  3HRX A;  1Q52 A;  5DU4 A;  3OT6 A;  4I42 A;  1NZY B;  4Z0M A;  3GMA A;  5E0S H;  3NJD A;  3H0U A;  5G1Q A;  2GTR A;  3GLM A;  4FB8 A;  1HNO A;  3H0S A;  3QRE A;  4Q0G A;  4GHN A;  2J5S A;  5DU8 A;  1N6E A;  3MOY A;  2PG8 A;  3H0J A;  4U19 A;  1WZ8 A;  2J5G D;  2VX2 A;  3ST9 A;  5C90 A;  2Q2X A;  4YLH A;  3OME A;  1Y7O A;  1FC7 A;  3MYB A;  4RYF H;  3FF6 A;  1UYT A;  1O8U A;  4JFC A;  3PE8 A;  2FW2 A;  2QQ3 A;  3PZK A;  3T8B A;  1J7X A;  4ZDE A;  3MT6 A;  4JYJ A;  1K39 A;  1SZO A;  2NP9 A;  3QXZ A;  1X0U A;  3H0Q A;  3R9S A;  5JBX A;  1RJN A;  4QII A;  3OC7 A;  3TT7 A;  5DU6 A;  3BF0 A;  2ZL3 A;  5DTW A;  2VSU F;  4KD6 A;  3U9R B;  1XX4 A;  1XO6 A;  2EJ5 A;  1XNY A;  1OD4 A;  3GKB A;  3QMJ A;  1TYF A;  4FJW D;  4G2R A;  5JBW A;  2J5G A;  4JJT A;  1YG8 A;  4FN7 A;  3BPP A;  3STA A;  4MXI A;  4RCN A;  4ASI A;  5INI A;  3L3S A;  4WCZ A;  2W3P A;  2F9I A;  4OMR A;  4MI2 A;  3T89 A;  4ZU2 A;  4FND A;  4FZW C;  4K29 A;  3I47 A;  3DJA A;  2WTB A;  4L8K A;  3QWD A;  5KJP A;  4U1A A;  2VSS F;  5CTB A;  2X24 A;  3KTH A;  4ZDC A;  3PEA A;  4KPK A;  2ZL0 A;  4ELW A;  3TDC A;  4I4Z A;  4GM2 A;  2ZL2 A;  2X58 A;  4JCQ A;  1TG6 A;  2PBP A;  3TZ3 A;  4EMM A;  2Q35 A;  5E0S A;  5KDR A;  2ZL4 A;  3GF7 A;  1PIX A;  4U0G H;  3T8A A;  2F9Y A;  4K2N A;  4JYL A;  5FUS A;  2F6I A;  4FNB A;  2VSU A;  1XNW A;  2A7S A;  4IZB A;  3R9T A;  5DUF A;  2FBM A;  1W2X A;  3KTG A;  3Q0J A;  3DOR A;  3HE2 A;  2VSU E;  2C8T A;  2F6Q A;  4KNP A;  4OG1 A;  4EMP A;  4RYF A;  1FC9 A;  4ELX A;  3P85 A;  2J5I I;  3KTI A;  5C9G A;  4JWV A;  3BEZ A;  3HP0 A;  5ING A;  3TT6 A;  2IEX A;  4MOU A;  5DTP A;  1VRG A;  3ZW9 A;  1HZD A;  4B3J A;  2PPY A;  2VSS A;  4K3W A;  1FCF A;  2J5I B;  5MGB A;  3U9S B;  4I52 A;  2A81 A;  3WG5 A;  3RRV A;  2VSS E;  1UYR A;  5DL1 A;  4U18 A;  2DUB A;  1MJ3 A;  4HNK A;  4JOT A;  1UYV A;  5E0N X;  4KWB A;  1UIY A;  4IZC A;  1N6F A;  3U9T B;  3SLL A;  2F9I B;  3MFM A;  4Q1I A;  3ISA A;  3ZW8 A;  3KQF A;  4HC8 A;  1UYS A;  1ON9 A;  3FDU A;  4JCR A;  1OD2 A;  1DCI A;  3ZWB A;  2HW5 A;  5DZK A;  3N6R B;  4ZDB A;  4FN8 A;  5IKL B;  3R0O A;  4OLQ A;  4WZ8 B;  3KTJ A;  3TVU A;  2Q34 A;  3IB9 A;  3TV5 A;  4JCT A;  4ZDD A;  4IZD A;  2VSU C;  4QFE A;  3QKA A;  3V5E A;  2VRE A;  2F9Y B;  1ON3 A;  4JVT A;  1N6D A;  2A7K A;  1DUB A;  1SG4 A;  1NZY A;  4ELS A;  4LK5 A;  4B3H A;  3TRR A;  1EF8 A;  3HLN 1;  3LAO A;  4WYO B;  2CBY A;  3IBB A;  3K50 A;  1WDK A;  5FIF A; 
#chains in the Genus database with same CATH topology
 1PJH A;  3QK8 A;  1XNV A;  5INF A;  3RST A;  1JXZ A;  3R9Q A;  4JCS A;  4QIJ A;  2BZR A;  1WDM A;  2FZS A;  3P2L A;  1Q51 A;  2CE3 A;  2D3T A;  1HNU A;  3RSI A;  3JU1 A;  3ZWA A;  3VIV A;  1WDL A;  3Q7H A;  4JSB A;  3G64 A;  4F47 A;  2J5I A;  3Q1T A;  5CTC A;  3R6H A;  4EML A;  3H02 A;  5G1R A;  3GF3 A;  4L6W A;  3K8X A;  3TVW A;  1RJM A;  3M6M A;  1YG6 A;  3T88 A;  3H81 A;  5G1S A;  3SWX A;  3Q0G A;  3HIN A;  3KTK A;  5HUQ A;  3QYR A;  3V5I A;  3IAV A;  4B3I A;  1EF9 A;  4ZDF A;  4FZW A;  1FC6 A;  4U0G A;  4DI1 A;  4NNQ A;  3T3W A;  5KDR B;  3LKE A;  1K32 A;  3TLF A;  1EY3 A;  3M6N A;  4U0H A;  2UZF A;  5DUC A;  3NJB A;  3ZWC A;  3PGQ A;  2DEO A;  2ZQR A;  3P5M A;  5DKP A;  5DZK H;  3QXI A;  4NEK A;  2ZQQ A;  3HRX A;  1Q52 A;  5DU4 A;  3OT6 A;  4I42 A;  1NZY B;  4Z0M A;  3GMA A;  5E0S H;  3NJD A;  3H0U A;  5G1Q A;  2GTR A;  3GLM A;  4FB8 A;  1HNO A;  3H0S A;  3QRE A;  4Q0G A;  4GHN A;  2J5S A;  5DU8 A;  1N6E A;  3MOY A;  2PG8 A;  3H0J A;  4U19 A;  1WZ8 A;  2J5G D;  2VX2 A;  3ST9 A;  5C90 A;  2Q2X A;  4YLH A;  3OME A;  1Y7O A;  1FC7 A;  3MYB A;  4RYF H;  3FF6 A;  1UYT A;  1O8U A;  4JFC A;  3PE8 A;  2FW2 A;  2QQ3 A;  3PZK A;  3T8B A;  1J7X A;  4ZDE A;  3MT6 A;  4JYJ A;  1K39 A;  1SZO A;  2NP9 A;  3QXZ A;  1X0U A;  3H0Q A;  3R9S A;  5JBX A;  1RJN A;  4QII A;  3OC7 A;  3TT7 A;  5DU6 A;  3BF0 A;  2ZL3 A;  5DTW A;  2VSU F;  4KD6 A;  3U9R B;  1XX4 A;  1XO6 A;  2EJ5 A;  4HDT A;  1XNY A;  1OD4 A;  3GKB A;  3QMJ A;  1TYF A;  4FJW D;  4G2R A;  5JBW A;  2J5G A;  4JJT A;  1YG8 A;  4FN7 A;  3BPP A;  3STA A;  2YJG A;  4MXI A;  4RCN A;  4ASI A;  5INI A;  3L3S A;  4WCZ A;  2W3P A;  2F9I A;  4OMR A;  4MI2 A;  3T89 A;  4ZU2 A;  4FND A;  4FZW C;  4K29 A;  3I47 A;  3DJA A;  2WTB A;  4L8K A;  3QWD A;  5KJP A;  4U1A A;  2VSS F;  5CTB A;  2X24 A;  3KTH A;  4ZDC A;  3PEA A;  4KPK A;  2ZL0 A;  4ELW A;  3TDC A;  4J2U A;  4I4Z A;  4GM2 A;  2ZL2 A;  2X58 A;  4JCQ A;  1TG6 A;  2PBP A;  3TZ3 A;  4EMM A;  2Q35 A;  5E0S A;  5KDR A;  2ZL4 A;  3GF7 A;  1PIX A;  4U0G H;  3T8A A;  2F9Y A;  4K2N A;  4JYL A;  5FUS A;  2F6I A;  3BPT A;  4FNB A;  2VSU A;  1XNW A;  2A7S A;  4IZB A;  3R9T A;  5DUF A;  2FBM A;  1W2X A;  3KTG A;  3Q0J A;  3DOR A;  3HE2 A;  2VSU E;  2C8T A;  2F6Q A;  4KNP A;  4OG1 A;  4EMP A;  4RYF A;  1FC9 A;  4ELX A;  3P85 A;  2J5I I;  3KTI A;  5C9G A;  4JWV A;  3BEZ A;  3HP0 A;  5ING A;  3TT6 A;  2IEX A;  4MOU A;  5DTP A;  1VRG A;  3ZW9 A;  1HZD A;  4B3J A;  2PPY A;  2VSS A;  4K3W A;  1FCF A;  2J5I B;  5MGB A;  3U9S B;  4I52 A;  2A81 A;  3WG5 A;  3RRV A;  2VSS E;  1UYR A;  5DL1 A;  4U18 A;  2DUB A;  1MJ3 A;  4HNK A;  4JOT A;  1UYV A;  5E0N X;  4KWB A;  1UIY A;  4IZC A;  1N6F A;  3U9T B;  3SLL A;  2F9I B;  3MFM A;  4Q1I A;  3ISA A;  3ZW8 A;  3KQF A;  4HC8 A;  1UYS A;  1ON9 A;  3FDU A;  4JCR A;  1OD2 A;  1DCI A;  3ZWB A;  2HW5 A;  5DZK A;  3N6R B;  4ZDB A;  4FN8 A;  5IKL B;  3R0O A;  4OLQ A;  4WZ8 B;  3KTJ A;  3TVU A;  2Q34 A;  3IB9 A;  3TV5 A;  4JCT A;  4ZDD A;  4IZD A;  2VSU C;  4QFE A;  3QKA A;  3V5E A;  2VRE A;  2F9Y B;  1ON3 A;  4JVT A;  1N6D A;  4NAR A;  2A7K A;  1DUB A;  1SG4 A;  1NZY A;  4ELS A;  4LK5 A;  4B3H A;  3TRR A;  1EF8 A;  3HLN 1;  3LAO A;  4WYO B;  2CBY A;  3IBB A;  3K50 A;  1WDK A;  5FIF A; 
#chains in the Genus database with same CATH homology
 1PJH A;  3QK8 A;  1XNV A;  5INF A;  3RST A;  1JXZ A;  3R9Q A;  4JCS A;  4QIJ A;  2BZR A;  1WDM A;  2FZS A;  3P2L A;  1Q51 A;  2CE3 A;  2D3T A;  1HNU A;  3RSI A;  3JU1 A;  3ZWA A;  3VIV A;  1WDL A;  3Q7H A;  4JSB A;  3G64 A;  4F47 A;  2J5I A;  3Q1T A;  5CTC A;  3R6H A;  4EML A;  3H02 A;  5G1R A;  3GF3 A;  4L6W A;  3K8X A;  3TVW A;  1RJM A;  3M6M A;  1YG6 A;  3T88 A;  3H81 A;  5G1S A;  3SWX A;  3Q0G A;  3HIN A;  3KTK A;  5HUQ A;  3QYR A;  3V5I A;  3IAV A;  4B3I A;  1EF9 A;  4ZDF A;  4FZW A;  1FC6 A;  4U0G A;  4DI1 A;  4NNQ A;  3T3W A;  5KDR B;  3LKE A;  1K32 A;  3TLF A;  1EY3 A;  3M6N A;  4U0H A;  2UZF A;  5DUC A;  3NJB A;  3ZWC A;  3PGQ A;  2DEO A;  2ZQR A;  3P5M A;  5DKP A;  5DZK H;  3QXI A;  4NEK A;  2ZQQ A;  3HRX A;  1Q52 A;  5DU4 A;  3OT6 A;  4I42 A;  1NZY B;  4Z0M A;  3GMA A;  5E0S H;  3NJD A;  3H0U A;  5G1Q A;  2GTR A;  3GLM A;  4FB8 A;  1HNO A;  3H0S A;  3QRE A;  4Q0G A;  4GHN A;  2J5S A;  5DU8 A;  1N6E A;  3MOY A;  2PG8 A;  3H0J A;  4U19 A;  1WZ8 A;  2J5G D;  2VX2 A;  3ST9 A;  5C90 A;  2Q2X A;  4YLH A;  3OME A;  1Y7O A;  1FC7 A;  3MYB A;  4RYF H;  3FF6 A;  1UYT A;  1O8U A;  4JFC A;  3PE8 A;  2FW2 A;  2QQ3 A;  3PZK A;  3T8B A;  1J7X A;  4ZDE A;  3MT6 A;  4JYJ A;  1K39 A;  1SZO A;  2NP9 A;  3QXZ A;  1X0U A;  3H0Q A;  3R9S A;  5JBX A;  1RJN A;  4QII A;  3OC7 A;  3TT7 A;  5DU6 A;  3BF0 A;  2ZL3 A;  5DTW A;  2VSU F;  4KD6 A;  3U9R B;  1XX4 A;  1XO6 A;  2EJ5 A;  4HDT A;  1XNY A;  1OD4 A;  3GKB A;  3QMJ A;  1TYF A;  4FJW D;  4G2R A;  5JBW A;  2J5G A;  4JJT A;  1YG8 A;  4FN7 A;  3BPP A;  3STA A;  2YJG A;  4MXI A;  4RCN A;  4ASI A;  5INI A;  3L3S A;  4WCZ A;  2W3P A;  2F9I A;  4OMR A;  4MI2 A;  3T89 A;  4ZU2 A;  4FND A;  4FZW C;  4K29 A;  3I47 A;  3DJA A;  2WTB A;  4L8K A;  3QWD A;  5KJP A;  4U1A A;  2VSS F;  5CTB A;  2X24 A;  3KTH A;  4ZDC A;  3PEA A;  4KPK A;  2ZL0 A;  4ELW A;  3TDC A;  4J2U A;  4I4Z A;  4GM2 A;  2ZL2 A;  2X58 A;  4JCQ A;  1TG6 A;  2PBP A;  3TZ3 A;  4EMM A;  2Q35 A;  5E0S A;  5KDR A;  2ZL4 A;  3GF7 A;  1PIX A;  4U0G H;  3T8A A;  2F9Y A;  4K2N A;  4JYL A;  5FUS A;  2F6I A;  3BPT A;  4FNB A;  2VSU A;  1XNW A;  2A7S A;  4IZB A;  3R9T A;  5DUF A;  2FBM A;  1W2X A;  3KTG A;  3Q0J A;  3DOR A;  3HE2 A;  2VSU E;  2C8T A;  2F6Q A;  4KNP A;  4OG1 A;  4EMP A;  4RYF A;  1FC9 A;  4ELX A;  3P85 A;  2J5I I;  3KTI A;  5C9G A;  4JWV A;  3BEZ A;  3HP0 A;  5ING A;  3TT6 A;  2IEX A;  4MOU A;  5DTP A;  1VRG A;  3ZW9 A;  1HZD A;  4B3J A;  2PPY A;  2VSS A;  4K3W A;  1FCF A;  2J5I B;  5MGB A;  3U9S B;  4I52 A;  2A81 A;  3WG5 A;  3RRV A;  2VSS E;  1UYR A;  5DL1 A;  4U18 A;  2DUB A;  1MJ3 A;  4HNK A;  4JOT A;  1UYV A;  5E0N X;  4KWB A;  1UIY A;  4IZC A;  1N6F A;  3U9T B;  3SLL A;  2F9I B;  3MFM A;  4Q1I A;  3ISA A;  3ZW8 A;  3KQF A;  4HC8 A;  1UYS A;  1ON9 A;  3FDU A;  4JCR A;  1OD2 A;  1DCI A;  3ZWB A;  2HW5 A;  5DZK A;  3N6R B;  4ZDB A;  4FN8 A;  5IKL B;  3R0O A;  4OLQ A;  4WZ8 B;  3KTJ A;  3TVU A;  2Q34 A;  3IB9 A;  3TV5 A;  4JCT A;  4ZDD A;  4IZD A;  2VSU C;  4QFE A;  3QKA A;  3V5E A;  2VRE A;  2F9Y B;  1ON3 A;  4JVT A;  1N6D A;  4NAR A;  2A7K A;  1DUB A;  1SG4 A;  1NZY A;  4ELS A;  4LK5 A;  4B3H A;  3TRR A;  1EF8 A;  3HLN 1;  3LAO A;  4WYO B;  2CBY A;  3IBB A;  3K50 A;  1WDK A;  5FIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...