2A7SA

Crystal structure of the acyl-coa carboxylase, accd5, from mycobacterium tuberculosis
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
529
structure length
529
Chain Sequence
IDIHTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDEDSFVELDALAKHRSTNFNLGEKRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEVTMEELGGAHTHMAKSGTAHYAASGEQDAFDYVRELLSYLPPNNSTDAPRYQAAAPTGPIEENLTDEDLELDTLIPDSPNQPYDMHEVITRLLDDEFLEIQAGYAQNIVVGFGRIDGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLPGTDQEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYCVMGSKDMGCDVNLAWPTAQIAVMGASGAVGFVYRQQLAEAAANGEDIDKLRLRLQQEYEDTLVNPYVAAERGYVDAVIPPSHTRGYIGTALRLLERKIAQLPPKKHGNVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-based inhibitor design of AccD5, an essential acyl-CoA carboxylase carboxyltransferase domain of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Probable propionyl-CoA carboxylase beta chain 5
total genus 171
structure length 529
sequence length 529
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.4.1.3: Propionyl-CoA carboxylase.
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2a7sA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2a7sA01
4B3IA 2VSSF 1UYVA 1J7XA 3RSIA 3IBBA 5G1QA 1K39A 2Q35A 4ZDCA 3NJBA 4WZ8B 3H0UA 1ON3A 3PEAA 4I4ZA 3R9TA 1UYTA 4RCNA 4GM2A 4LK5A 4U1AA 3T88A 2VX2A 4U0GA 3P85A 3V5IA 4B3JA 3PGQA 3QK8A 3ISAA 3HRXA 3KQFA 3K8XA 4QIJA 4Q0GA 3QWDA 3JU1A 3MT6A 5DTPA 2Q2XA 2F9YB 4HNKA 1OD2A 5DUCA 1RJNA 5INGA 4ELXA 4K29A 4IZDA 5DU6A 1WDMA 5KDRB 4U19A 4JCSA 5C90A 3TV5A 2Q34A 3HINA 3T89A 5DU4A 3RSTA 3OC7A 2WTBA 3H0QA 3Q0JA 3R6HA 4JOTA 3H02A 3IB9A 3WG5A 1MJ3A 4QFEA 1WDKA 2ZL3A 3PZKA 5MGBA 3HP0A 3HLN1 2FW2A 3DJAA 4JFCA 4KWBA 4NEKA 3RRVA 5E0SA 4F47A 4QIIA 3QREA 4U0HA 3N6RB 1Q52A 3T3WA 3P2LA 4ZDEA 4HC8A 3T8AA 2A81A 1DCIA 2DUBA 4ZU2A 2UZFA 4JWVA 1XNWA 2J5IB 4FJWD 1XO6A 2J5GD 1UYRA 1FC6A 3Q7HA 4JCQA 3QYRA 1UYSA 2F6IA 5CTCA 3R9QA 4ASIA 3DORA 5DKPA 2VSUE 4NNQA 3H0JA 5DZKA 3MOYA 3BF0A 3KTIA 4L8KA 2IEXA 5DUFA 4ZDFA 1ON9A 4YLHA 1DUBA 5CTBA 1WDLA 2BZRA 4KD6A 2HW5A 5INIA 1XX4A 2NP9A 3GLMA 2ZQQA 4JVTA 3PE8A 1XNVA 5FUSA 4FNBA 3QXZA 3U9SB 4ELSA 2QQ3A 4FZWC 3KTKA 2D3TA 4U0GH 3NJDA 4RYFA 5FIFA 5KDRA 3GF7A 3GKBA 2X24A 5JBXA 4RYFH 5DZKH 3VIVA 4ZDBA 2FZSA 3T8BA 3KTHA 3LKEA 1OD4A 2F9IA 1WZ8A 3STAA 2VSSA 2CBYA 1FC9A 3L3SA 4ZDDA 2J5II 4OG1A 1HZDA 1UIYA 3OT6A 3M6MA 2J5GA 3KTGA 4KPKA 3FDUA 5JBWA 2EJ5A 3TLFA 1VRGA 3BEZA 4MOUA 2ZL4A 3TZ3A 3ZWAA 2PG8A 4FN8A 2ZL0A 2PPYA 3H81A 3U9RB 3GMAA 1HNOA 2GTRA 1PIXA 3TT6A 1FCFA 2F9IB 5KJPA 3GF3A 3KTJA 3ZWBA 1EF9A 5G1SA 3MYBA 2DEOA 3I47A 3ZW9A 2W3PA 3SWXA 5E0SH 4L6WA 4WYOB 3SLLA 2FBMA 3TVUA 4OLQA 3FF6A 1W2XA 2ZL2A 3BPPA 3TT7A 4K3WA 5DL1A 3Q1TA 1TYFA 3OMEA 1K32A 1O8UA 1YG8A 3Q0GA 4K2NA 5C9GA 1N6EA 4Q1IA 1JXZA 1EF8A 3H0SA 1NZYA 4KNPA 4ELWA 2F6QA 2VSSE 4EMLA 4OMRA 3K50A 2VSUF 1SG4A 1SZOA 1RJMA 1YG6A 4FN7A 4Z0MA 4I42A 3R9SA 4JJTA 3G64A 2J5IA 3P5MA 4IZBA 3QXIA 4FZWA 4DI1A 3M6NA 1EY3A 5INFA 1XNYA 4IZCA 1FC7A 2J5SA 5DU8A 4U18A 2A7KA 2A7SA 3TDCA 4MI2A 3R0OA 4JYLA 1Q51A 4B3HA 1N6DA 3QKAA 2VSUA 1X0UA 1PJHA 2ZQRA 2C8TA 3HE2A 4WCZA 2PBPA 3IAVA 5DTWA 4EMMA 1Y7OA 4GHNA 3ST9A 2X58A 1TG6A 4JCRA 4JCTA 2VSUC 3MFMA 3TVWA 3ZWCA 4I52A 4G2RA 3LAOA 2F9YA 5G1RA 4FNDA 5E0NX 2CE3A 1N6FA 3QMJA 5IKLB 4JSBA 3ZW8A 3V5EA 4MXIA 2VREA 4EMPA 4FB8A 1NZYB 3U9TB 1HNUA 4JYJA 3TRRA
chains in the Genus database with same CATH superfamily
4B3IA 2VSSF 1UYVA 1J7XA 3RSIA 3IBBA 5G1QA 1K39A 2Q35A 4ZDCA 3NJBA 4WZ8B 3H0UA 1ON3A 3PEAA 4I4ZA 3R9TA 1UYTA 4RCNA 4GM2A 4LK5A 4U1AA 3T88A 2VX2A 4U0GA 3P85A 3V5IA 4B3JA 3PGQA 3QK8A 2YJGA 3ISAA 3HRXA 3KQFA 3K8XA 4QIJA 4Q0GA 3QWDA 3JU1A 3MT6A 5DTPA 2Q2XA 2F9YB 4HNKA 1OD2A 5DUCA 1RJNA 5INGA 4ELXA 4K29A 4IZDA 5DU6A 1WDMA 5KDRB 4U19A 4JCSA 5C90A 3TV5A 2Q34A 3HINA 3T89A 5DU4A 3RSTA 3OC7A 2WTBA 3H0QA 3Q0JA 3R6HA 4JOTA 3H02A 3IB9A 3WG5A 1MJ3A 4QFEA 1WDKA 2ZL3A 3PZKA 5MGBA 3HP0A 3HLN1 2FW2A 3DJAA 4JFCA 4KWBA 4NEKA 3RRVA 5E0SA 3BPTA 4F47A 4QIIA 3QREA 4U0HA 3N6RB 1Q52A 3T3WA 3P2LA 4ZDEA 4HC8A 3T8AA 2A81A 4NARA 1DCIA 2DUBA 4ZU2A 2UZFA 4JWVA 1XNWA 2J5IB 4FJWD 1XO6A 2J5GD 1UYRA 1FC6A 3Q7HA 4JCQA 3QYRA 1UYSA 2F6IA 5CTCA 3R9QA 4ASIA 3DORA 5DKPA 2VSUE 4NNQA 3H0JA 5DZKA 3MOYA 3BF0A 3KTIA 4L8KA 2IEXA 5DUFA 4ZDFA 1ON9A 4YLHA 1DUBA 5CTBA 1WDLA 2BZRA 4KD6A 2HW5A 5INIA 1XX4A 2NP9A 3GLMA 2ZQQA 4JVTA 3PE8A 1XNVA 5FUSA 4FNBA 3QXZA 3U9SB 4ELSA 2QQ3A 4FZWC 3KTKA 2D3TA 4U0GH 3NJDA 4RYFA 5FIFA 5KDRA 3GF7A 3GKBA 2X24A 5JBXA 4RYFH 5DZKH 3VIVA 4ZDBA 2FZSA 3T8BA 3KTHA 3LKEA 1OD4A 2F9IA 1WZ8A 3STAA 2VSSA 2CBYA 1FC9A 3L3SA 4ZDDA 2J5II 4OG1A 1HZDA 1UIYA 3OT6A 3M6MA 2J5GA 3KTGA 4KPKA 3FDUA 5JBWA 2EJ5A 3TLFA 1VRGA 3BEZA 4MOUA 2ZL4A 3TZ3A 3ZWAA 2PG8A 4FN8A 2ZL0A 2PPYA 3H81A 3U9RB 3GMAA 1HNOA 2GTRA 1PIXA 3TT6A 1FCFA 2F9IB 5KJPA 3GF3A 3KTJA 3ZWBA 5HUQA 1EF9A 5G1SA 3MYBA 2DEOA 3I47A 3ZW9A 2W3PA 3SWXA 5E0SH 4L6WA 4WYOB 3SLLA 2FBMA 3TVUA 4J2UA 4OLQA 3FF6A 1W2XA 2ZL2A 3BPPA 3TT7A 4K3WA 5DL1A 3Q1TA 1TYFA 3OMEA 1K32A 1O8UA 1YG8A 3Q0GA 4K2NA 5C9GA 1N6EA 4Q1IA 1JXZA 1EF8A 3H0SA 1NZYA 4KNPA 4ELWA 2F6QA 2VSSE 4EMLA 4OMRA 3K50A 2VSUF 1SG4A 1SZOA 1RJMA 1YG6A 4FN7A 4Z0MA 4I42A 3R9SA 4JJTA 3G64A 2J5IA 3P5MA 4IZBA 3QXIA 4FZWA 4DI1A 3M6NA 1EY3A 5INFA 1XNYA 4IZCA 1FC7A 2J5SA 5DU8A 4U18A 2A7KA 2A7SA 3TDCA 4MI2A 3R0OA 4JYLA 1Q51A 4B3HA 1N6DA 3QKAA 2VSUA 1X0UA 1PJHA 2ZQRA 2C8TA 3HE2A 4WCZA 2PBPA 3IAVA 5DTWA 4EMMA 1Y7OA 4GHNA 3ST9A 2X58A 1TG6A 4JCRA 4JCTA 2VSUC 3MFMA 3TVWA 3ZWCA 4I52A 4G2RA 3LAOA 2F9YA 5G1RA 4FNDA 5E0NX 2CE3A 1N6FA 3QMJA 5IKLB 4JSBA 3ZW8A 3V5EA 4MXIA 2VREA 4HDTA 4EMPA 4FB8A 1NZYB 3U9TB 1HNUA 4JYJA 3TRRA
chains in the Genus database with same CATH topology
4B3IA 2VSSF 1UYVA 1J7XA 3RSIA 3IBBA 5G1QA 1K39A 2Q35A 4ZDCA 3NJBA 4WZ8B 3H0UA 1ON3A 3PEAA 4I4ZA 3R9TA 1UYTA 4RCNA 4GM2A 4LK5A 4U1AA 3T88A 2VX2A 4U0GA 3P85A 3V5IA 4B3JA 3PGQA 3QK8A 2YJGA 3ISAA 3HRXA 3KQFA 3K8XA 4QIJA 4Q0GA 3QWDA 3JU1A 3MT6A 5DTPA 2Q2XA 2F9YB 4HNKA 1OD2A 5DUCA 1RJNA 5INGA 4ELXA 4K29A 4IZDA 5DU6A 1WDMA 5KDRB 4U19A 4JCSA 5C90A 3TV5A 2Q34A 3HINA 3T89A 5DU4A 3RSTA 3OC7A 2WTBA 3H0QA 3Q0JA 3R6HA 4JOTA 3H02A 3IB9A 3WG5A 1MJ3A 4QFEA 1WDKA 2ZL3A 3PZKA 5MGBA 3HP0A 3HLN1 2FW2A 3DJAA 4JFCA 4KWBA 4NEKA 3RRVA 5E0SA 3BPTA 4F47A 4QIIA 3QREA 4U0HA 3N6RB 1Q52A 3T3WA 3P2LA 4ZDEA 4HC8A 3T8AA 2A81A 4NARA 1DCIA 2DUBA 4ZU2A 2UZFA 4JWVA 1XNWA 2J5IB 4FJWD 1XO6A 2J5GD 1UYRA 1FC6A 3Q7HA 4JCQA 3QYRA 1UYSA 2F6IA 5CTCA 3R9QA 4ASIA 3DORA 5DKPA 2VSUE 4NNQA 3H0JA 5DZKA 3MOYA 3BF0A 3KTIA 4L8KA 2IEXA 5DUFA 4ZDFA 1ON9A 4YLHA 1DUBA 5CTBA 1WDLA 2BZRA 4KD6A 2HW5A 5INIA 1XX4A 2NP9A 3GLMA 2ZQQA 4JVTA 3PE8A 1XNVA 5FUSA 4FNBA 3QXZA 3U9SB 4ELSA 2QQ3A 4FZWC 3KTKA 2D3TA 4U0GH 3NJDA 4RYFA 5FIFA 5KDRA 3GF7A 3GKBA 2X24A 5JBXA 4RYFH 5DZKH 3VIVA 4ZDBA 2FZSA 3T8BA 3KTHA 3LKEA 1OD4A 2F9IA 1WZ8A 3STAA 2VSSA 2CBYA 1FC9A 3L3SA 4ZDDA 2J5II 4OG1A 1HZDA 1UIYA 3OT6A 3M6MA 2J5GA 3KTGA 4KPKA 3FDUA 5JBWA 2EJ5A 3TLFA 1VRGA 3BEZA 4MOUA 2ZL4A 3TZ3A 3ZWAA 2PG8A 4FN8A 2ZL0A 2PPYA 3H81A 3U9RB 3GMAA 1HNOA 2GTRA 1PIXA 3TT6A 1FCFA 2F9IB 5KJPA 3GF3A 3KTJA 3ZWBA 5HUQA 1EF9A 5G1SA 3MYBA 2DEOA 3I47A 3ZW9A 2W3PA 3SWXA 5E0SH 4L6WA 4WYOB 3SLLA 2FBMA 3TVUA 4J2UA 4OLQA 3FF6A 1W2XA 2ZL2A 3BPPA 3TT7A 4K3WA 5DL1A 3Q1TA 1TYFA 3OMEA 1K32A 1O8UA 1YG8A 3Q0GA 4K2NA 5C9GA 1N6EA 4Q1IA 1JXZA 1EF8A 3H0SA 1NZYA 4KNPA 4ELWA 2F6QA 2VSSE 4EMLA 4OMRA 3K50A 2VSUF 1SG4A 1SZOA 1RJMA 1YG6A 4FN7A 4Z0MA 4I42A 3R9SA 4JJTA 3G64A 2J5IA 3P5MA 4IZBA 3QXIA 4FZWA 4DI1A 3M6NA 1EY3A 5INFA 1XNYA 4IZCA 1FC7A 2J5SA 5DU8A 4U18A 2A7KA 2A7SA 3TDCA 4MI2A 3R0OA 4JYLA 1Q51A 4B3HA 1N6DA 3QKAA 2VSUA 1X0UA 1PJHA 2ZQRA 2C8TA 3HE2A 4WCZA 2PBPA 3IAVA 5DTWA 4EMMA 1Y7OA 4GHNA 3ST9A 2X58A 1TG6A 4JCRA 4JCTA 2VSUC 3MFMA 3TVWA 3ZWCA 4I52A 4G2RA 3LAOA 2F9YA 5G1RA 4FNDA 5E0NX 2CE3A 1N6FA 3QMJA 5IKLB 4JSBA 3ZW8A 3V5EA 4MXIA 2VREA 4HDTA 4EMPA 4FB8A 1NZYB 3U9TB 1HNUA 4JYJA 3TRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3I A;  2VSS F;  1UYV A;  1J7X A;  3RSI A;  3IBB A;  5G1Q A;  1K39 A;  2Q35 A;  4ZDC A;  3NJB A;  4WZ8 B;  3H0U A;  1ON3 A;  3PEA A;  4I4Z A;  3R9T A;  1UYT A;  4RCN A;  4GM2 A;  4LK5 A;  4U1A A;  3T88 A;  2VX2 A;  4U0G A;  3P85 A;  3V5I A;  4B3J A;  3PGQ A;  3QK8 A;  3ISA A;  3HRX A;  3KQF A;  3K8X A;  4QIJ A;  4Q0G A;  3QWD A;  3JU1 A;  3MT6 A;  5DTP A;  2Q2X A;  2F9Y B;  4HNK A;  1OD2 A;  5DUC A;  1RJN A;  5ING A;  4ELX A;  4K29 A;  4IZD A;  5DU6 A;  1WDM A;  5KDR B;  4U19 A;  4JCS A;  5C90 A;  3TV5 A;  2Q34 A;  3HIN A;  3T89 A;  5DU4 A;  3RST A;  3OC7 A;  2WTB A;  3H0Q A;  3Q0J A;  3R6H A;  4JOT A;  3H02 A;  3IB9 A;  3WG5 A;  1MJ3 A;  4QFE A;  1WDK A;  2ZL3 A;  3PZK A;  5MGB A;  3HP0 A;  3HLN 1;  2FW2 A;  3DJA A;  4JFC A;  4KWB A;  4NEK A;  3RRV A;  5E0S A;  4F47 A;  4QII A;  3QRE A;  4U0H A;  3N6R B;  1Q52 A;  3T3W A;  3P2L A;  4ZDE A;  4HC8 A;  3T8A A;  2A81 A;  1DCI A;  2DUB A;  4ZU2 A;  2UZF A;  4JWV A;  1XNW A;  2J5I B;  4FJW D;  1XO6 A;  2J5G D;  1UYR A;  1FC6 A;  3Q7H A;  4JCQ A;  3QYR A;  1UYS A;  2F6I A;  5CTC A;  3R9Q A;  4ASI A;  3DOR A;  5DKP A;  2VSU E;  4NNQ A;  3H0J A;  5DZK A;  3MOY A;  3BF0 A;  3KTI A;  4L8K A;  2IEX A;  5DUF A;  4ZDF A;  1ON9 A;  4YLH A;  1DUB A;  5CTB A;  1WDL A;  2BZR A;  4KD6 A;  2HW5 A;  5INI A;  1XX4 A;  2NP9 A;  3GLM A;  2ZQQ A;  4JVT A;  3PE8 A;  1XNV A;  5FUS A;  4FNB A;  3QXZ A;  3U9S B;  4ELS A;  2QQ3 A;  4FZW C;  3KTK A;  2D3T A;  4U0G H;  3NJD A;  4RYF A;  5FIF A;  5KDR A;  3GF7 A;  3GKB A;  2X24 A;  5JBX A;  4RYF H;  5DZK H;  3VIV A;  4ZDB A;  2FZS A;  3T8B A;  3KTH A;  3LKE A;  1OD4 A;  2F9I A;  1WZ8 A;  3STA A;  2VSS A;  2CBY A;  1FC9 A;  3L3S A;  4ZDD A;  2J5I I;  4OG1 A;  1HZD A;  1UIY A;  3OT6 A;  3M6M A;  2J5G A;  3KTG A;  4KPK A;  3FDU A;  5JBW A;  2EJ5 A;  3TLF A;  1VRG A;  3BEZ A;  4MOU A;  2ZL4 A;  3TZ3 A;  3ZWA A;  2PG8 A;  4FN8 A;  2ZL0 A;  2PPY A;  3H81 A;  3U9R B;  3GMA A;  1HNO A;  2GTR A;  1PIX A;  3TT6 A;  1FCF A;  2F9I B;  5KJP A;  3GF3 A;  3KTJ A;  3ZWB A;  1EF9 A;  5G1S A;  3MYB A;  2DEO A;  3I47 A;  3ZW9 A;  2W3P A;  3SWX A;  5E0S H;  4L6W A;  4WYO B;  3SLL A;  2FBM A;  3TVU A;  4OLQ A;  3FF6 A;  1W2X A;  2ZL2 A;  3BPP A;  3TT7 A;  4K3W A;  5DL1 A;  3Q1T A;  1TYF A;  3OME A;  1K32 A;  1O8U A;  1YG8 A;  3Q0G A;  4K2N A;  5C9G A;  1N6E A;  4Q1I A;  1JXZ A;  1EF8 A;  3H0S A;  1NZY A;  4KNP A;  4ELW A;  2F6Q A;  2VSS E;  4EML A;  4OMR A;  3K50 A;  2VSU F;  1SG4 A;  1SZO A;  1RJM A;  1YG6 A;  4FN7 A;  4Z0M A;  4I42 A;  3R9S A;  4JJT A;  3G64 A;  2J5I A;  3P5M A;  4IZB A;  3QXI A;  4FZW A;  4DI1 A;  3M6N A;  1EY3 A;  5INF A;  1XNY A;  4IZC A;  1FC7 A;  2J5S A;  5DU8 A;  4U18 A;  2A7K A;  2A7S A;  3TDC A;  4MI2 A;  3R0O A;  4JYL A;  1Q51 A;  4B3H A;  1N6D A;  3QKA A;  2VSU A;  1X0U A;  1PJH A;  2ZQR A;  2C8T A;  3HE2 A;  4WCZ A;  2PBP A;  3IAV A;  5DTW A;  4EMM A;  1Y7O A;  4GHN A;  3ST9 A;  2X58 A;  1TG6 A;  4JCR A;  4JCT A;  2VSU C;  3MFM A;  3TVW A;  3ZWC A;  4I52 A;  4G2R A;  3LAO A;  2F9Y A;  5G1R A;  4FND A;  5E0N X;  2CE3 A;  1N6F A;  3QMJ A;  5IKL B;  4JSB A;  3ZW8 A;  3V5E A;  4MXI A;  2VRE A;  4EMP A;  4FB8 A;  1NZY B;  3U9T B;  1HNU A;  4JYJ A;  3TRR A; 
#chains in the Genus database with same CATH topology
 4B3I A;  2VSS F;  1UYV A;  1J7X A;  3RSI A;  3IBB A;  5G1Q A;  1K39 A;  2Q35 A;  4ZDC A;  3NJB A;  4WZ8 B;  3H0U A;  1ON3 A;  3PEA A;  4I4Z A;  3R9T A;  1UYT A;  4RCN A;  4GM2 A;  4LK5 A;  4U1A A;  3T88 A;  2VX2 A;  4U0G A;  3P85 A;  3V5I A;  4B3J A;  3PGQ A;  3QK8 A;  2YJG A;  3ISA A;  3HRX A;  3KQF A;  3K8X A;  4QIJ A;  4Q0G A;  3QWD A;  3JU1 A;  3MT6 A;  5DTP A;  2Q2X A;  2F9Y B;  4HNK A;  1OD2 A;  5DUC A;  1RJN A;  5ING A;  4ELX A;  4K29 A;  4IZD A;  5DU6 A;  1WDM A;  5KDR B;  4U19 A;  4JCS A;  5C90 A;  3TV5 A;  2Q34 A;  3HIN A;  3T89 A;  5DU4 A;  3RST A;  3OC7 A;  2WTB A;  3H0Q A;  3Q0J A;  3R6H A;  4JOT A;  3H02 A;  3IB9 A;  3WG5 A;  1MJ3 A;  4QFE A;  1WDK A;  2ZL3 A;  3PZK A;  5MGB A;  3HP0 A;  3HLN 1;  2FW2 A;  3DJA A;  4JFC A;  4KWB A;  4NEK A;  3RRV A;  5E0S A;  3BPT A;  4F47 A;  4QII A;  3QRE A;  4U0H A;  3N6R B;  1Q52 A;  3T3W A;  3P2L A;  4ZDE A;  4HC8 A;  3T8A A;  2A81 A;  4NAR A;  1DCI A;  2DUB A;  4ZU2 A;  2UZF A;  4JWV A;  1XNW A;  2J5I B;  4FJW D;  1XO6 A;  2J5G D;  1UYR A;  1FC6 A;  3Q7H A;  4JCQ A;  3QYR A;  1UYS A;  2F6I A;  5CTC A;  3R9Q A;  4ASI A;  3DOR A;  5DKP A;  2VSU E;  4NNQ A;  3H0J A;  5DZK A;  3MOY A;  3BF0 A;  3KTI A;  4L8K A;  2IEX A;  5DUF A;  4ZDF A;  1ON9 A;  4YLH A;  1DUB A;  5CTB A;  1WDL A;  2BZR A;  4KD6 A;  2HW5 A;  5INI A;  1XX4 A;  2NP9 A;  3GLM A;  2ZQQ A;  4JVT A;  3PE8 A;  1XNV A;  5FUS A;  4FNB A;  3QXZ A;  3U9S B;  4ELS A;  2QQ3 A;  4FZW C;  3KTK A;  2D3T A;  4U0G H;  3NJD A;  4RYF A;  5FIF A;  5KDR A;  3GF7 A;  3GKB A;  2X24 A;  5JBX A;  4RYF H;  5DZK H;  3VIV A;  4ZDB A;  2FZS A;  3T8B A;  3KTH A;  3LKE A;  1OD4 A;  2F9I A;  1WZ8 A;  3STA A;  2VSS A;  2CBY A;  1FC9 A;  3L3S A;  4ZDD A;  2J5I I;  4OG1 A;  1HZD A;  1UIY A;  3OT6 A;  3M6M A;  2J5G A;  3KTG A;  4KPK A;  3FDU A;  5JBW A;  2EJ5 A;  3TLF A;  1VRG A;  3BEZ A;  4MOU A;  2ZL4 A;  3TZ3 A;  3ZWA A;  2PG8 A;  4FN8 A;  2ZL0 A;  2PPY A;  3H81 A;  3U9R B;  3GMA A;  1HNO A;  2GTR A;  1PIX A;  3TT6 A;  1FCF A;  2F9I B;  5KJP A;  3GF3 A;  3KTJ A;  3ZWB A;  5HUQ A;  1EF9 A;  5G1S A;  3MYB A;  2DEO A;  3I47 A;  3ZW9 A;  2W3P A;  3SWX A;  5E0S H;  4L6W A;  4WYO B;  3SLL A;  2FBM A;  3TVU A;  4J2U A;  4OLQ A;  3FF6 A;  1W2X A;  2ZL2 A;  3BPP A;  3TT7 A;  4K3W A;  5DL1 A;  3Q1T A;  1TYF A;  3OME A;  1K32 A;  1O8U A;  1YG8 A;  3Q0G A;  4K2N A;  5C9G A;  1N6E A;  4Q1I A;  1JXZ A;  1EF8 A;  3H0S A;  1NZY A;  4KNP A;  4ELW A;  2F6Q A;  2VSS E;  4EML A;  4OMR A;  3K50 A;  2VSU F;  1SG4 A;  1SZO A;  1RJM A;  1YG6 A;  4FN7 A;  4Z0M A;  4I42 A;  3R9S A;  4JJT A;  3G64 A;  2J5I A;  3P5M A;  4IZB A;  3QXI A;  4FZW A;  4DI1 A;  3M6N A;  1EY3 A;  5INF A;  1XNY A;  4IZC A;  1FC7 A;  2J5S A;  5DU8 A;  4U18 A;  2A7K A;  2A7S A;  3TDC A;  4MI2 A;  3R0O A;  4JYL A;  1Q51 A;  4B3H A;  1N6D A;  3QKA A;  2VSU A;  1X0U A;  1PJH A;  2ZQR A;  2C8T A;  3HE2 A;  4WCZ A;  2PBP A;  3IAV A;  5DTW A;  4EMM A;  1Y7O A;  4GHN A;  3ST9 A;  2X58 A;  1TG6 A;  4JCR A;  4JCT A;  2VSU C;  3MFM A;  3TVW A;  3ZWC A;  4I52 A;  4G2R A;  3LAO A;  2F9Y A;  5G1R A;  4FND A;  5E0N X;  2CE3 A;  1N6F A;  3QMJ A;  5IKL B;  4JSB A;  3ZW8 A;  3V5E A;  4MXI A;  2VRE A;  4HDT A;  4EMP A;  4FB8 A;  1NZY B;  3U9T B;  1HNU A;  4JYJ A;  3TRR A; 
#chains in the Genus database with same CATH homology
 4B3I A;  2VSS F;  1UYV A;  1J7X A;  3RSI A;  3IBB A;  5G1Q A;  1K39 A;  2Q35 A;  4ZDC A;  3NJB A;  4WZ8 B;  3H0U A;  1ON3 A;  3PEA A;  4I4Z A;  3R9T A;  1UYT A;  4RCN A;  4GM2 A;  4LK5 A;  4U1A A;  3T88 A;  2VX2 A;  4U0G A;  3P85 A;  3V5I A;  4B3J A;  3PGQ A;  3QK8 A;  2YJG A;  3ISA A;  3HRX A;  3KQF A;  3K8X A;  4QIJ A;  4Q0G A;  3QWD A;  3JU1 A;  3MT6 A;  5DTP A;  2Q2X A;  2F9Y B;  4HNK A;  1OD2 A;  5DUC A;  1RJN A;  5ING A;  4ELX A;  4K29 A;  4IZD A;  5DU6 A;  1WDM A;  5KDR B;  4U19 A;  4JCS A;  5C90 A;  3TV5 A;  2Q34 A;  3HIN A;  3T89 A;  5DU4 A;  3RST A;  3OC7 A;  2WTB A;  3H0Q A;  3Q0J A;  3R6H A;  4JOT A;  3H02 A;  3IB9 A;  3WG5 A;  1MJ3 A;  4QFE A;  1WDK A;  2ZL3 A;  3PZK A;  5MGB A;  3HP0 A;  3HLN 1;  2FW2 A;  3DJA A;  4JFC A;  4KWB A;  4NEK A;  3RRV A;  5E0S A;  3BPT A;  4F47 A;  4QII A;  3QRE A;  4U0H A;  3N6R B;  1Q52 A;  3T3W A;  3P2L A;  4ZDE A;  4HC8 A;  3T8A A;  2A81 A;  4NAR A;  1DCI A;  2DUB A;  4ZU2 A;  2UZF A;  4JWV A;  1XNW A;  2J5I B;  4FJW D;  1XO6 A;  2J5G D;  1UYR A;  1FC6 A;  3Q7H A;  4JCQ A;  3QYR A;  1UYS A;  2F6I A;  5CTC A;  3R9Q A;  4ASI A;  3DOR A;  5DKP A;  2VSU E;  4NNQ A;  3H0J A;  5DZK A;  3MOY A;  3BF0 A;  3KTI A;  4L8K A;  2IEX A;  5DUF A;  4ZDF A;  1ON9 A;  4YLH A;  1DUB A;  5CTB A;  1WDL A;  2BZR A;  4KD6 A;  2HW5 A;  5INI A;  1XX4 A;  2NP9 A;  3GLM A;  2ZQQ A;  4JVT A;  3PE8 A;  1XNV A;  5FUS A;  4FNB A;  3QXZ A;  3U9S B;  4ELS A;  2QQ3 A;  4FZW C;  3KTK A;  2D3T A;  4U0G H;  3NJD A;  4RYF A;  5FIF A;  5KDR A;  3GF7 A;  3GKB A;  2X24 A;  5JBX A;  4RYF H;  5DZK H;  3VIV A;  4ZDB A;  2FZS A;  3T8B A;  3KTH A;  3LKE A;  1OD4 A;  2F9I A;  1WZ8 A;  3STA A;  2VSS A;  2CBY A;  1FC9 A;  3L3S A;  4ZDD A;  2J5I I;  4OG1 A;  1HZD A;  1UIY A;  3OT6 A;  3M6M A;  2J5G A;  3KTG A;  4KPK A;  3FDU A;  5JBW A;  2EJ5 A;  3TLF A;  1VRG A;  3BEZ A;  4MOU A;  2ZL4 A;  3TZ3 A;  3ZWA A;  2PG8 A;  4FN8 A;  2ZL0 A;  2PPY A;  3H81 A;  3U9R B;  3GMA A;  1HNO A;  2GTR A;  1PIX A;  3TT6 A;  1FCF A;  2F9I B;  5KJP A;  3GF3 A;  3KTJ A;  3ZWB A;  5HUQ A;  1EF9 A;  5G1S A;  3MYB A;  2DEO A;  3I47 A;  3ZW9 A;  2W3P A;  3SWX A;  5E0S H;  4L6W A;  4WYO B;  3SLL A;  2FBM A;  3TVU A;  4J2U A;  4OLQ A;  3FF6 A;  1W2X A;  2ZL2 A;  3BPP A;  3TT7 A;  4K3W A;  5DL1 A;  3Q1T A;  1TYF A;  3OME A;  1K32 A;  1O8U A;  1YG8 A;  3Q0G A;  4K2N A;  5C9G A;  1N6E A;  4Q1I A;  1JXZ A;  1EF8 A;  3H0S A;  1NZY A;  4KNP A;  4ELW A;  2F6Q A;  2VSS E;  4EML A;  4OMR A;  3K50 A;  2VSU F;  1SG4 A;  1SZO A;  1RJM A;  1YG6 A;  4FN7 A;  4Z0M A;  4I42 A;  3R9S A;  4JJT A;  3G64 A;  2J5I A;  3P5M A;  4IZB A;  3QXI A;  4FZW A;  4DI1 A;  3M6N A;  1EY3 A;  5INF A;  1XNY A;  4IZC A;  1FC7 A;  2J5S A;  5DU8 A;  4U18 A;  2A7K A;  2A7S A;  3TDC A;  4MI2 A;  3R0O A;  4JYL A;  1Q51 A;  4B3H A;  1N6D A;  3QKA A;  2VSU A;  1X0U A;  1PJH A;  2ZQR A;  2C8T A;  3HE2 A;  4WCZ A;  2PBP A;  3IAV A;  5DTW A;  4EMM A;  1Y7O A;  4GHN A;  3ST9 A;  2X58 A;  1TG6 A;  4JCR A;  4JCT A;  2VSU C;  3MFM A;  3TVW A;  3ZWC A;  4I52 A;  4G2R A;  3LAO A;  2F9Y A;  5G1R A;  4FND A;  5E0N X;  2CE3 A;  1N6F A;  3QMJ A;  5IKL B;  4JSB A;  3ZW8 A;  3V5E A;  4MXI A;  2VRE A;  4HDT A;  4EMP A;  4FB8 A;  1NZY B;  3U9T B;  1HNU A;  4JYJ A;  3TRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...