2A7XA

Crystal structure of a pantothenate synthetase complexed with amp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
277
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantoate-beta-alanine ligase
total genus 88
structure length 277
sequence length 286
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a7xA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a7xA01
5IHXA 3A05A 5LM3A 3ZJTA 1K92A 1GN8A 4H3SA 3IH5A 4R0NA 3UOWA 3COYA 2PZAA 2H2AA 1T9GS 1T6YA 1EFPA 1EJ2A 2Z08A 4ARCA 2CUZA 1WKBA 1O0CA 2JANA 3NBAA 1IH8A 4U63A 3OP1A 4KR9A 3IODA 1EFPB 3PNYA 1CT9A 3FWKA 4JXXA 2G36A 3HMQA 4NX2A 2WSIA 1EUQA 2DETA 4ZCRA 2B7LA 1NP7A 2BYTA 2PIDA 2O8VA 1IFXA 2VXOA 4MVCA 5JBNA 3A4IA 2OV4A 1HYBA 1NURA 4YP6A 1JEEA 3CLSC 4EG3A 2A84A 1KR2A 1WJGA 1JIIA 1G8FA 2DR2A 3CLUC 3NBKA 1IQUA 1EXDA 3FOCA 1PG0A 3IUBA 4A91A 3PXUA 4HK4A 1Q19A 2HGZA 1A8HA 2C5SA 2Z3VA 3DPIA 4UZEA 1KAQA 3S3TA 4DLPA 2CT8A 1WZ2A 1QRTA 2DXIA 4MULA 2A1TR 4MVXA 5KCMA 1M8KA 2D13A 1XNHA 3KT8A 3X1KA 3N9IA 3A2KA 4G6ZA 2JAXA 2NZ2A 1QRSA 1J21A 1VBMA 2A86A 1NYLA 1QRUA 3G6KA 1O94D 5H16A 5K0SA 2A88A 4MW9A 4K0RA 3QTBA 4CQNA 2O5RA 3IMEA 4ARIA 1KQPA 1JZQA 3PNBA 4I6JA 1OD6A 1I6LA 2DLCX 3MLAA 1JGTA 4R2MA 1K97A 1G8HA 2XRYA 3SZ3A 1TEZA 3UK2A 4JXZA 1KH3A 1QNFA 1N77A 1I6MA 4L2IA 3H9CA 1PFVA 4MW6A 2CFOA 4CT0A 1N2JA 1LI5A 1YIDA 1COZA 2A1UB 3H99A 2CV0A 3COZA 1JIJA 4X0EA 1EUYA 2CYCA 1WXHA 4ND7A 4ZT4A 1Q11A 1I6KA 4KPUA 1TYCA 2J08A 4NAUA 2D54A 5DEOA 4MW1A 4ZCSA 4MUIA 1IQRA 2J5BA 1H1TA 3GUZA 1VBNA 4MW2A 4EG8A 1K4MA 1PG2A 1M8JA 5HG0A 3LOQA 3P52A 1U7DA 2JA2A 3AIIA 1O6BA 1EFVA 2ZUEA 1WQ4A 4HPWA 4J76A 1O95D 1OBHA 3KT3A 1D2RA 3DLAA 1N2HA 3ELBA 3MLBA 4QREA 1EFVB 3TQOA 4DJAA 4TS1A 4K03A 2CSXA 4MUGA 1KQNA 1WXIA 3HL4A 3VGJA 4YP7A 1GTRA 3I05A 3MMXA 1F7VA 4YP5A 1TYAE 3AKZA 4EG7A 4PBTA 3IVCA 4JYZA 2YXNA 1OWOA 3P0JA 4EG1A 4NZPA 3TNJA 1MB9A 3N2YA 1R6TA 5FO1A 1U0BB 3IVGA 3SEQA 1LI7A 2A1UA 3TS1A 4U7JA 1NZJA 5FO0A 3JXEA 2IP1A 1U7XA 2J09A 2PXHA 3RK1A 1M8FA 3NV7A 5J59A 4KR7A 2QUIA 4JZYA 3MUEA 3CLUD 1N2OA 1N2GA 1J1UA 2A1TS 5TEVA 3ZXIA 1KP2A 3AG6A 1SURA 4J75A 3RFFA 1GAXA 3ZXSA 1KP3A 3C8ZA 2OQ2A 1NUUA 1N3LA 1ZH6A 1PFYA 1VBKA 3TZLA 2WQ6A 1M83A 4G5FA 2GOYA 1F7UA 4UZFA 4NAHA 4PBSA 1XNJA 1YUMA 1ZJWA 4ZT5A 1NI5A 2QTRA 2VTBB 3FETA 5IJXA 4XFDA 1KKUA 3QE4A 1ULHA 1ILEA 4I6GA 2X0KA 2QTNA 1ZUNA 2A4MA 3OTWA 2QUKA 2AZXA 4ZCQA 4G5YA 3L92A 5TEWA 3HV0A 4U8HA 1J09A 1Q15A 4P2BA 5KWVA 1JMVA 1I2DA 1O95C 1S4MA 1T9GR 1N1DA 2CV1A 4WNYA 4EF6A 2J07A 5H7XA 3HGMA 3Q10A 3G5AA 4DDMA 1Q77A 2PG3A 1GPMA 2YWCA 3IUEA 1NUQA 3K9WA 2ZUFA 1U3DA 1NUSA 1O0BA 1XNGA 5HUJA 1OWMA 1BS2A 4GU5A 1MBZA 3ND7A 3UMVA 3SEZA 4RPIA 3F3MA 1MB2A 4FZJA 1B6TA 5DB4A 4GRIA 1FYDA 4F4HA 4KR6A 4PY2A 3CLTD 2RE8A 3ND6A 4EG4A 3FHJA 1JILA 3SP1A 3VRHA 4JFAA 3CA8A 2XRZA 3A04A 3H05A 4OUDB 3CLRC 3ILVA 2GKSA 2WQ7A 1QTQA 1YULA 4QBTA 2DUMA 1KQOA 4PBRA 1GTSA 2H29A 4OUDA 4S1OA 1O96A 4XFJA 4ND6A 4MWCA 4MWBA 2NSYA 4MW0A 2CYAA 1F9AA 1XJQA 2QJTA 1IHOA 4ZT3A 1T6XA 1GLNA 3LCJA 4HJRA 1M8GA 3FI0A 1O97C 1WOYA 3TZEA 2WB2A 3K32A 2TS1A 4R2LA 3COWA 3INNA 3IVXA 1G8GA 1G59A 2X1LA 3PRHA 4I6EA 3ZIUA 1P7PA 3D6UA 4CDNA 4CDMA 5J58A 3UY4A 1MAUA 4EGAA 2RD2A 4NATA 5TGTA 1N2IA 2QTMA 1WXFA 4EG6A 1QU3A 1WQ3A 1JZSA 3AL0C 1KAMA 1J1ZA 1O97D 1U3CA 3L93A 3RJZA 2QJFA 3ZJUA 1DNPA 1YUNA 3BL5A 5K0TA 1V8FA 1MC1A 1H3NA 1R6XA 3DO8A 3AG5A 2DPLA 1K4KA 1WXGA 4DNXA 2D5BA 3E27A 4ZT2A 2V0GA 1X8XA 2IJGX 1N2EA 1Y42X 1JIKA 3P0IA 1QQTA 4DE5A 2Z09A 3IOBA 1N78A 3ZUGA 3Q12A 3KT0A 1R6UA 1M1ZA 2GM3A 2E21A 5BNZA 4EFKA 1X6VA 2A7XA 1N2BA 2X3FA 1NSYA 2E89A 4DDHA 1YIAA 5FNZA 4WSOA 3CLTC 2PZBA 1QJCA 3IOEA 3RBAA 1IRXA 1YI8A 2PFSA 3FNRA 3HFJA 5LLTA 4MUJA 3TQIA 3SZGA 1PFWA 1EE1A 2R5WA 2E0IA 1T6ZA 1MAWA 2YY5A 3PNVA 5HUHA 3DV2A 1OWNA 1LW7A 1ZH0A 4XSVA 2AKEA 4MW7A 2PZ8A 3KT6A 3FDXA 1TYBE 3N8HA 4NDAA 4Q93A 2EL7A 3FH0A 1O5TA 5TS2A 1VLHA 1GZUA 3H97A 3CLSD 2AG6A 2CYBA 2DEUA 2J4DA 1VL2A 3VU8A 3QTTA 4RUKA 3IMGA 4MUFA 4YBRA 3X1MA 4MVYA 3ISJA 1TFUA 2HMAA 1OWPA 1QU2A 3IDFA 3IMCA 1IQ0A 1MJHA 4MW5A 3IOCA 3Q4GA 1FFYA 4ZT7A 3FG9A 3COVA 4HJXA 4MUHA 2EJCA 3ZGZA 1JEDA 3P0HA 3CVWA 3G59A 1TQ8A 4MUNA 1WY5A 4YMIA 4OJMX 3CVXA 1J20A 4ZCTA 4L2IB 4EG5A 4ZT6A 1M8PA 1OBCA 2YWBA 3SDBA 4Q16A 1IVSA 2QUHA 3CR8A 1KH1A 2QUJA 1O94C 4MVWA 4KPUB 3AFHA 3SYTA 2X1MA 4MAFA 2ZP1A 3LE8A 2I1LA 5DK4A 1F4LA 5J5AA 1JECA 3ND5A 1TYDE 4AQ7A 3D6VA 1KORA 3RK0A 1MRZA 1PFUA 3KFLA 4MUKA 1OWLA 3M5WA 4F3RA 1RQGA 4MWDA 3U1VA 5EKDA 3MXTA 4MQ6A 2V0CA 2DERA 4ZCPA 1J70A 2CV2A 4MLPA 1NUPA 2VTBA 5LFAA 2QJOA 1NUTA 2E18A 3ZJVA 5F23A 4E1AA 3FIUA 4MUEA 3FY4A 1V47A 3HZRA 1O96B 3GLVA 3RHSA 5AHWA 2HZ7A 1H3FA 3GMIA 5KHAA 2BTEA 1N75A 1WXEA 3CVUA 4MWEA 1MOPA 4MW4A 4AS1A 3X1JA 4BWVA 2IELA 3N05A 3CLRD 5DASA 3CVVA 3UC5A 4KKVA 3CVYA 1UFVA 4QRDA 1JHDA 1H3EA 1KH2A 3H9BA 4DDKA
chains in the Genus database with same CATH superfamily
4E2YA 1FUEA 1UM8A 5ALOA 1Y8RA 4LUCA 1W5BA 2GZ1A 1XXHA 2H2FA 4M0EA 4BN4A 4YJ2F 1IBLB 1PL8A 3H2BA 3PT9A 3KAPA 4AMYA 1JIVA 3QVLA 1GEGA 1PSWA 3R0IA 1DJOA 2PS9A 4JK3A 5ESXA 4ZVTA 2BBWA 2PAAA 3IKTA 4TKVA 5IK2A 5ILOA 5FI1B 4F5DA 4TYPA 1XV5A 1DXHA 1DPFA 1VKZA 1ST3A 3C8HA 4KACA 4M7PA 4YLGA 2AK2A 1Q2UA 2I66A 3OCYA 4KXYA 1VPEA 2POCA 3TZKA 1M1UA 4FC6A 4YQYA 3EH2A 5TMPA 1Z6XA 4IXTA 2WFAA 1AUVA 3WMFA 1ULUA 5I48A 2F55A 3GJ6A 221PA 4FS3A 3UJBA 4BCBA 3ZW7A 1SOMA 1I10A 4B7CA 1J8DA 2QQGA 3ORQA 2VT3A 1P2SA 4NX2A 4YPOA 2WSIA 1ONBA 3O31A 3ZGVA 4BVHA 3PXEA 5JPDA 2VBCA 4QM7A 1YONA 2QN8A 2WVGA 4IL5A 1GJRA 1C8KA 4WNAB 1WHSB 3HBLA 3EUEA 3K30A 4JROA 4KGZA 3FMIA 5EMHA 1CS4C 1GRNA 3P9NA 5CNMA 5LZ8A 2IUUA 2TMDA 4GZ6A 4G0MA 4K81B 3ZLBA 5E2AA 1HRKA 3FHTA 1JEEA 2QR2A 2VJQA 2XIQA 5ELMA 4EG3A 3RS8A 4ZVQA 1Z88A 4NEHB 1UR5A 1GKYA 5C1PA 4Y1FA 4LHVA 4MPRA 5KC9A 1ORVA 1IBKB 3P4UA 1MG5A 3JQDA 1ISGA 3AERA 3LP5A 1T34A 4LXYA 4MLCA 4OA8A 1GPKA 1YBVA 3GEPA 3TWOA 1TF5A 4ZMRA 2XCQA 4JL8A 3STWA 1TEHA 2JH3A 1YCGA 4UHDA 3UHJA 1UMCB 4H18A 1SKYE 1E79A 3WGLA 4KYTA 4X62B 4EUSA 4Q1VA 3PFCA 4Y0AA 2P68A 4WTOA 5A04A 5HF8A 4AY2A 3QSGA 3KSAC 1QO9A 3JQ7A 4G6ZA 1RWKA 3BB1A 1EJ6A 4I50F 4OG2A 1ZR4A 4YRDA 1A5ZA 2BBSA 1JEAA 4G4JA 5IEBA 4K86A 1NOIA 3GRYA 1NM5A 1EWQA 3A4TA 4IDDA 2MWMA 2KMLA 2I2FA 2I52A 5JATA 2UYHA 1KIAA 5KJ6A 4MR9A 4ZYUA 1B0AA 4J0EA 2PQ0A 3CS3A 4Q39A 5H3HA 3WFIA 3CW9A 3O3CA 5TPZA 3I9MA 1SOWA 4Q4JB 3IYLW 4NMXB 3HJRA 2ZT6A 3F1KA 1H42A 4I6JA 3T3NA 3VU3A 5HPYB 3QNWA 4MTLA 3W9UA 4GKAA 5KNBA 2Y77A 4YQFA 1EVKA 2CVPA 3UTDA 5ICEA 5LZ4A 2VPYA 3BYZA 2EFJA 2P9TA 2DOKA 1QK4A 1Y9AA 2AOVA 1ORHA 3KSUA 2GB4A 3PFHA 1WMBA 2AJTA 2J9ZB 1CQIA 4C0SA 2M98A 3RHTA 1VXRA 3RSSA 1PFVA 4D8XA 5JNUA 3CZ5A 2CC2A 3DNMA 2PH7A 2OHFA 5HEKA 4IXMA 4X3PA 3FZGA 3KP1A 1EFAA 1GG2A 3VA7A 4I2NA 4Y6OA 1W46A 5MF6A 4KOEC 5FEUA 1CC1S 4YJ3A 4PSAA 3VR5D 1T91A 2Y71A 5JJBA 3K5PA 3D54D 5M34A 1C14A 1M10A 4B85A 4YMLA 5A0FA 5BW6B 4TRRA 5BQXA 3EE6A 4C0KA 4QO8A 3B53X 2HREA 3AIKA 2DHCA 3N1UA 1TYCA 5JWHA 4Q5IA 5JDCA 4TGLA 3A3NA 4U2GA 5HMLA 4I55F 4MW1A 2Z4SA 2Y0PA 2GSWA 3CH6A 1C1DB 2JL1A 4FCTA 4FT2A 4IOLA 5COAA 1RT9A 3SFTA 3GUZA 2WU1A 1GFZA 2B4RO 1E9DA 2GZDA 2EBWA 3GN1A 1QVAA 3IAXA 4P4SA 2CJFA 4W6QA 1V6SA 5HKKA 3HXTA 5CCDA 4I3FA 1IDOA 4G2NA 2NU6A 4OHCA 1XZBA 4MX8A 5LYJA 1FSZA 2F3SA 3R5HA 3RANA 3TD9A 3TLGB 4ZICA 2ZUEA 1WQ4A 3R5FA 4KVFA 2O5EA 2RGEA 2H7YA 2VN8A 2VYQA 2X77A 1O95D 3CF0A 3RO7A 1T10A 1DBRA 5JPIA 1MO2A 2GW4A 5CVDA 5F4ZA 2C9ZA 4F1KA 3K96A 4HLUC 5I7AA 2PSHA 4E11A 2WIBA 2LPMA 4UVIA 3FGPA 1T4MA 4J1QA 3H86A 3BGIA 3BTOA 3DBIA 4H3HB 4QUEA 1NT4A 2HNKA 2C29D 4XRRA 5REQB 4EATA 2XQKA 4FP9A 4L7VA 3OEWA 3R7LA 4A8HA 4RHTA 2H1HA 1CDEA 1Z9BA 1Z5UA 3JWGA 3ONWA 2RGNC 4RX1A 4BUZA 3HYRA 3ENVA 3LT4A 2YYYA 2ZRIA 4M0CA 4M8LA 2EKQA 4Z0HO 3CRQA 3X1XA 3C3YA 2GLUA 3W5AA 2WJGA 2WJ4A 2IYEA 3I12A 1G1AA 4C07A 2YV1A 3IVGA 1R0XA 4H7DA 4YN3A 4B48A 2PL5A 4TV8F 2YDXA 4LG1A 4YAKA 3K31A 3KCNA 3TTTA 5ABPA 3HJNA 3PJDA 5EIBC 4D0GA 1MNAA 2Q2OA 5AESA 2O19A 3DEHA 3PEFA 5AVRA 2R6JA 1X1EA 2Z83A 3AL3A 2QRVB 2WKWA 2YTZA 1M8FA 2ZJ3A 3KTAB 3MUOA 4WT7A 4ZYTA 2NTVA 5G3ZA 5BV0A 4X60A 4O1IA 1R9MA 3P20A 3HUUA 5KQPA 4M83A 5IH7A 3A1SA 1Q95A 3HCBA 3Q40A 4GBGA 3ZK7A 3ADBA 5L51A 3PENA 1LPNA 2VO1A 2YW2A 1PZNA 1C7EA 1ZD2P 1T0HB 1T3HA 3D6HA 1GSIA 1X7YA 3IA7A 4MB6A 3GHHA 2IZ5A 2D0IA 3IBSA 2YJNA 3A6JA 4BMYA 1MC5A 3PITA 1FJ2A 1JQ5A 4R6WA 4X6UA 4PPYA 4QJBA 3NC1C 1ID1A 1OOEA 3LL7A 1W9MA 5DI3B 4GI5A 4GW3A 3VDQA 4UEKA 2JFUA 1XKLA 4GPBA 2OBYA 2WJPA 3MGGA 2FA9A 4Q4LA 1DRKA 4JR0A 5EUCA 5IT0A 1GQYA 4LRWA 3LRXA 2JS7A 2AUMA 2B6HA 1BMTA 4IUBS 1Z37A 4ENWA 3FJ1A 4N01A 3GVXA 4NEGA 5L95A 1KYQA 4LJ5A 1YGYA 2QTCA 2O2SA 3NOOA 3SLGA 2IH4A 1PT8A 1GKIA 1Z6GA 3E9EA 3LC2O 3OQBA 5HE9A 3GUUA 3GEIA 2IITA 3HLYA 1D4ZA 1AUQA 5T4FA 3RSQA 2G7MC 4U8HA 3TUJC 2L18A 4Q7EA 1V7ZA 2HJHA 2HMWA 4YXWD 1CJTC 3WLJA 4FXOA 3CISA 4DJTA 4FQ8A 1DC3A 2NQ8A 3LX5A 4QXPA 5KJEA 4D4JA 1EBUA 1QH1B 3G0HA 3WYGA 1MKYA 2J7PD 1D6NA 2OEPA 1JHZA 4RC9A 3RJ9A 3IS3A 3FR7A 4CIYA 1QK5A 3LF1A 2O1WA 4DG9A 1K7YA 5TMBA 3EZXA 5DZSA 4U5QA 1MTOA 3EFBA 3QMPA 2YWCA 1ILWA 3EF1A 1SC9A 4BFZA 3I2JA 3LW7A 1I4DD 3NIWA 3RPEA 4MQ4A 4AECA 4JBWA 4UUPA 1H9AA 2WYUA 5DHSA 1RHQA 2J6IA 3BDIA 3O1JC 5KQRA 5FWXA 3EA4A 1CP2A 2FGKA 4YAEA 2WA2A 3CT6A 3Q6IA 4MIYA 1QDEA 2O5CA 4FZJA 5FTWA 2GN4A 2VHQA 5JMTA 1UBJS 3NIFB 3ZHSA 1TLFA 3HFGA 1Q44A 2YIVX 2ZM5A 5E7QA 3FPBA 3CJTA 2AR7A 1R6AA 3CFFL 1Z82A 2LWIA 4X97A 4Z1OA 3SP1A 2QLTA 2PFGA 1OXXK 3GEBA 1PGJA 3MHTA 3A04A 1XHFA 3BJIC 2UZ4A 2D1RA 2FOIA 2W42A 3ES9A 1WSDA 1LBTA 5ESWA 3R6WA 4DANA 3LZ6A 1KOFA 2IC5A 4NFLA 4GUDA 4H08A 1UMDB 2C03A 2G0AA 2VDUE 4QE3A 4LSWA 1FFDA 4YRKA 3OWHA 1FTQA 1SB9A 2FSVC 4EARA 4ZHQB 1H2HA 5AVTA 3MLEA 3M3DA 1SU4A 4OFXA 1T9AA 2NSYA 1DWQA 2CYAA 4GEGA 3Q8LA 2AG0A 2QJTA 1NDHA 4TT3D 3OEHA 1NT2A 4WD3A 5CFNA 3NJ4A 3B3AA 3HBNA 4JITA 3WV5A 2P67A 4OXNA 1U8ZA 4JB0A 5AICA 4B75A 5D5PA 7ADHA 2N0SA 3K0CC 3INTA 4I7EA 3WE7A 4AO7A 3UCXA 1N34B 1FUUA 3C4QA 1EG2A 1H93A 4AZ3A 5JNRA 4D57A 1RM5A 3H4VA 2Q3EA 1JSRA 4U1RA 1RRPA 1YB5A 1GA4A 3PJGA 3JASA 4ZAYA 5CDTA 2CMFA 1IPHA 1VFNA 2X1LA 3BILA 5CTJA 1P7PA 1U5AA 2NSHA 2V5AA 3JR7A 2X0FA 4DEVA 1WB9A 4FYXA 5CFZA 1J5XA 2RD2A 4PYIA 3ZZMA 3PLAE 4WN3A 1WQ3A 4WXRA 3CB2A 1TVKA 4U2BA 1SG6A 2ZZKA 3V4OA 4A2WA 3Q85A 4G36A 4YMHA 2OFOA 2NADA 1SIOA 2Y93A 4YRJA 1VYTA 1RQLA 3QE0A 3G1WA 2WPDD 3GEDA 1HPLA 2AJDA 3CY6A 1X9HA 4ZOLA 3PIDA 3AG5A 4N4AA 3GAAA 5J63A 1U0NA 4HYYA 3FYDA 5ALLA 2O07A 1N1GA 4D81A 4QTTB 4U8GA 1J90A 3HJAA 4NXNB 3TECE 3L7NA 3O74A 3SIPA 3QKIA 1NW6A 3CN9A 4TL7A 3THYB 2ZWIA 1XEAA 4TXNA 1N6NA 3FBTA 4GT1A 1HORA 4U2KA 5F64A 1XK6A 5IVHA 1PSZA 4A3SA 2PZGA 5A06A 4ZPXA 2B1QA 2HWUA 3H1FA 3KD3A 4EGJA 1KFCB 3ZU2A 2HAEA 4KN9S 2XT6A 5J40A 2IPOA 2PZEA 1EXMA 1KSFX 3QWBA 3QVWA 4MXDA 4F86A 3RUEA 4IXDA 2PWYA 4MB2A 1NG9A 2B36A 2WJVA 1E3WA 2PM8A 4NJMA 1BXRA 1Z0SA 3CIFA 3H2YA 2AC7A 3DL2A 2C4TA 3SYRA 5ES3A 3D3JA 3U40A 3A1DA 3ZHRA 1ZUHA 1AA6A 1LB1B 1BH2A 1CUAA 2IUFA 2YY5A 3KWFA 3FVQA 2HJ9A 1ICEA 4G4IA 4RIGA 1A9XA 1TC2A 1ZM9A 2R8XA 3ZLVA 3DC7A 1TZ2A 4YY3B 4BNGA 2H16A 3A1FA 5JZ9A 4PC3A 4NH4A 5LUAA 1QRRA 3HVIA 4C14A 3FH0A 5TGDA 4J0JA 1GZUA 2JJ1D 1Y3DE 2ZI9A 4HF7A 1LPBB 2IHKA 4TLCA 2G28A 2WV7A 4A10A 4L8YA 1KMQA 5B7NA 3BMNA 1W30A 2B83A 5LQCA 2EKZA 3R5XA 4BX2A 4HDRB 3TW8A 4QPNA 1SWWA 1VCIA 1IUNA 2CD7A 1U0LA 3ADPA 3GDFA 3QU2A 4LDZA 4TWJA 4WCFC 3F6BX 5BR7A 4UD6A 3KQHA 2ZTSA 3WBFA 5J4LA 5REQA 5AXDA 1DUIA 5GM2A 1WBDA 1JDBB 1PG5A 2JF0A 3SYKA 2CL6X 3OEEA 4EAQA 1VJ0A 2NVWA 4LXGA 3QYAA 4I1VA 4L28A 5IAGA 3DXFA 3WLFA 4E3WA 4Y2JA 2BFFB 1L7MA 2BEJA 3LVBA 3TCKA 1Y3AA 5EXTA 1KI1A 3AUTA 5BR1A 2OTCA 5JD3A 4UM9B 3JWJA 1UPTA 5DYTA 5ECDA 1YZKA 3R3WA 4RA6A 3KJXA 2OAEA 3DBRA 3TOVA 4YX9A 4IRUB 4N6GA 5IAOA 5IKOA 2WI8A 1WY5A 5ALHA 3ZZTA 3S5JA 1ZW1A 2OGSA 2QXYA 3NTOA 5K51A 3GLKA 4JC8A 3O95A 3N07A 4DV4B 4RZHA 4NYIR 3OQ1A 3MOIA 3RS5A 1FSSA 3RAGA 1NXPA 2WA1A 2F1JA 4AP6A 4GC5A 4Z4CA 4UMFA 1VL6A 1PGQA 1Q3TA 1QR6A 1M2NA 3KB2A 2HV8A 1YMVA 4CV0A 4QU5A 2QSZA 2YCBA 1QS0B 5TQ0B 5GOZA 3U16A 1DFGA 2IP2A 3TRHA 1RI5A 1OVMA 1N32B 1PGNA 1EYZA 4LNAA 2VKQA 1V7PC 4MYRA 3W2FA 3W5BA 4QYWA 4RDHA 2X76A 1W75A 1ONSA 1TX4B 2QM0A 3QXXA 1JA9A 4MUXA 1G20E 3Q9NA 3TW8B 3NYIA 4YNBA 4DARA 4F7DA 2QU8A 3H0EA 1HG0A 1NUPA 4KRFA 3W9SA 2GM5A 1MVLA 4KWCA 2VLIA 4L02A 3USZA 4HLQB 4E70A 3C24A 4DMUB 4GSYA 4HEA1 5KNCA 2PUDA 4JLSA 4E1AA 2MMCA 3ZE6A 1FJGB 1R8XA 2Y1KA 3H5NA 1XF1A 3TQFA 3EGOA 3DAGA 3FY4A 3NDRA 1DC4A 5KEIA 1WD5A 1IEVA 1SKYB 2E49A 3D02A 4KJZA 4ZI7F 1OBFO 3ZUPA 2C0QA 4LDAA 4EHBA 4IIXA 4JJ6A 4NHEA 2HU2A 2J0UB 4M8KA 2VUHB 1IN4A 1UPFA 2K7ZA 5D3MB 5EXDA 4H7EA 1IZ0A 6CHYA 3LBAA 3T7EA 1IZ7A 2O2HA 3VH3A 1QBGA 4TMKA 1Y4SA 1U28A 3GT0A 2XGGA 2CJXA 4HAOA 1OUMA 1SCBA 2NSDA 3C3BA 4IIFA 4LIPD 3IT1A 4QRDA 4DW8A 2O2ZA 3ABIA 3FKQA 4E5SA 1ETUA 2F8MA 4KXNA 4WZAE 3MT9A 3SBOA 1HI9A 4EGCB 2Q2VA 4IIHA 3SR4A 1KIMA 4XIGS 3DYIA 1E2GA 4PS0A 1U0EA 3H3JA 4BNYA 3AB7A 2EERA 4ECEA 1AZSC 1B8PA 1KMIY 1QTRA 2P27A 2VYVD 2W6OA 3ER6A 3CINA 3NHZA 1ZS9A 4HSEA 4IMPA 5A71A 3RSGA 4QPPA 5FQOA 5IK2D 1P80A 2ZSJA 4GQAA 2AC2A 4OAOA 2LUOA 1P1KA 4LOKA 3U7GA 4ARCA 1QTIA 1C9EA 3GLHA 1C0KA 3THSA 4PLVA 2HA6A 2GK7A 3RS7A 4Z4HA 4M46A 1DARA 1R64A 4U63A 1JEOA 2PRJA 5JAMA 4LN1A 2GN0A 2H2GA 2QRHA 1I7PA 3GYGA 2HJVA 2JGIA 3EMVA 1W1IA 4QFBA 4LF4B 3ABQB 1T2NA 5JRJA 1MA3A 4BEWA 2Z5GA 4EUFA 3EIEA 4EW2A 4I1SA 5C8VA 3QBEA 3E22A 2C00A 4WCFB 2N9UA 3PU6A 5FPSA 1GA6A 4AZ0B 3NBQA 1T4BA 3P2KA 2B7LA 3C5VA 3PTZA 4E2WA 3PGMA 4C0JA 3GJ3A 2Q5QA 3NC4A 4IF4A 4D7AA 4R1NA 4REMA 3TIXB 1Q14A 2ODBA 3M83A 4PSCA 2OV4A 4CLDA 1K9VF 1QIIA 1BH6A 1U8UA 1G21A 3MZ0A 2F8SA 4L4ZA 1KR2A 2GTIA 2GZRA 3K1TA 3WL4A 1JIIA 4F4CA 1RRMA 3IPRA 4WXHA 4HD8A 1OLOA 2GDZA 2OENG 3BMOA 4UOQA 1IUKA 1POXA 3L02A 1JQEA 3CFAL 5BMVF 1JQLB 2FJ0A 2TSYB 3D4OA 1T2DA 1WP4A 3JASB 1KAQA 3U60B 2XTZA 4MR7A 4Z86A 1H94A 2RC5A 2JCVA 1W2GA 2ZJFA 4OGFA 2NTNA 4NL4H 4BGVA 3L8FA 4MULA 4RPLA 3BXGA 3G9ZA 2M1ZA 3E0XA 4RY2A 4Y2UA 4Y9RA 5B4TA 2LMEA 1DLIA 2RGNA 2VZLA 4LISA 1TQ2A 3KT8A 2R3SA 2ET6A 5IWAB 4WADA 5F7ZA 5JNLA 4HUJA 1JHQA 1G5FA 3IMFA 3OA0A 4IRXA 2ID4A 4O2BF 4MVJM 5BSWA 4DMKA 1SMKA 5C18A 5KNDH 2A86A 4KPYA 1HSOA 4F1WA 1OFTA 2PUTA 5I6DA 1V39A 1YUBA 1COWA 1QONA 2EFHB 2VPTA 4GX2A 5CNKA 5H3CA 5JZVA 1XEXA 5K03A 4QDOA 4TQAA 2ROQA 2PKEA 4YYEA 3ZDCA 2OSVA 2O8DA 3I61A 3T9CA 1UJ5A 3V9AA 5K6AA 1IN7A 3CI0I 3AF5A 4IVQA 5DIZA 3SSNA 3KZCA 3F3KA 1YRYE 3HU3A 4BYGA 4QWWA 4W99A 5CFRA 1IATA 2OO5A 1Y1RA 2A9KA 4NPAA 2FWAA 4YDQA 4UD2A 1R5NA 2B3TA 2EIHA 1DEAA 5IDQA 2ZTVA 1JYFA 4ZOEA 1WXDA 3TYXA 5INTA 4D8VA 5BSEA 1SU7A 3PDIA 4MZXA 1TEZA 3M6MD 2AQKA 2II6A 2P5SA 2PZFA 1IOLA 3W5IA 3H9CA 4I1IA 4WASA 4KLRA 1XEFA 4R51A 1YE8A 3MJVA 4QUIA 1F4PA 1E58A 1N0UA 1ZGAA 4O0MA 1NYQA 2P75A 3LVFO 3Q3HA 1ODSA 3EVBA 1XDWA 1R0SA 3R7DA 2XA2A 3VR5A 1KC3A 2Y66A 2PSDA 1SIUA 1V1MA 3EZFA 1DPGA 3H17A 3UPUA 3ZY2A 3O2JA 2RETA 2BKUA 3W6NA 3I8SA 1GWNA 2F59A 3RYIB 4MR7B 1JWBB 3H4MA 4DHWA 1PZHA 3PGVA 1IE3A 2YZ2A 4E5VA 1T5OA 2SCUA 4JI1B 2GPAA 3QFFA 4AJIA 4D6YA 5JR3A 1QGED 2YJGA 4U0JA 3HUTA 4GGOA 4E5DA 3KG2A 3N0TA 4G4SO 1SXIA 1IEXA 3HZOA 1H1TA 1E3IA 3EXG1 4JBYA 4QA9A 3M6WA 3IP5A 1Q0UA 2NYAA 3MUNA 3RC1A 5A5DA 3B48A 1I7QB 2UXDB 5HG0A 3UB2A 1KK1A 1QLJA 3JR3A 4LYHA 2JZCA 4FR0A 4R4JA 4B8WA 1GGNA 2XVMA 3ZQ4A 1EX7A 1PWEA 1XD8A 2BF4A 4ZCMA 4JODA 1QAQA 1SULA 2PMBA 5DYGA 3ZQJA 2XKKA 3LWBA 4XIIA 2BGMA 3L7YA 4ZCIA 1FYVA 2A0WA 5ICFA 3MLBA 2VUIB 5DH9A 4G23A 1WB6A 3L4JA 1E94E 2ZE7A 3O83A 4MAAA 5AM3A 2WWYA 3CSUA 1FVXA 4PIPA 1GRQA 1ZU5A 2RGAA 1A9TA 1C8VB 4GKBA 1M1XB 1QGDA 5KKAA 3VPCA 3QOXA 4Y18A 1XE3A 3F9CA 1FFSA 1JLKA 1TYAE 4UASA 5HFJA 1MN6A 3HVKA 2VSOA 3OZSA 4NEQA 2WINI 4GYWA 5JCOC 3PB3A 2OCBA 3DEKA 4MRAA 4D96A 3PVCA 5FA8A 4MWOA 3N2YA 3RR2A 1LVGA 3BE8A 4Y7CA 4U4AA 1GLGA 1GRVA 4KYVA 2ZUDA 1JR2A 1YR2A 4NJOA 1DTSA 1QYWA 5LU9A 2ZULA 2EV9A 3T7AA 2W4MA 2NACA 1XTJA 1OT3A 1TKRA 2AEMA 4DJFC 4EJSA 2HCFA 4EUNA 3RAFC 3R0VA 3KKEA 2OORA 1AQIA 3MUEA 3OLVA 4P5EA 5KJCA 2RKWA 4F97A 7GPBA 3Q6NA 4K9RA 4KU4A 4BC0A 1LY1A 1U4NA 4CJXA 4PYQA 4ND1A 2OR3A 2YWHA 2WWTA 2ORVA 3A6FA 4GOKA 5D6OA 5DBHX 3I45A 3FR8A 2XAUA 1BWPA 3BA1A 4XGKA 2XTAA 3R0ZA 2GBLA 4I55B 1AA9A 4AW9A 4ENVA 1XZJA 5D7BA 2P69A 1UKAA 5D3KA 4GP6A 2B5WA 2I3DA 1M83A 3V34A 2YWEA 1OB5A 4NIMA 4JI7B 3GRCA 1C4OA 2VCHA 4NAHA 3S2UA 4PBSA 3N6XA 5KDLA 2EZ8A 3G5MA 4WOJA 3KSRA 3NHSA 4XOUA 1CR6A 4QDKA 5JG7A 1PE0A 3O47A 1V1RB 3R6DA 3FHOA 4X41A 4EM6A 4Z8XA 3RM3A 3PCTA 1W0KD 5FQNA 3TFQA 1NLFA 2ZI4A 3SIWA 4FFPA 5A05A 3IUYA 1JALA 2IOFK 2PUBA 4FS8A 2JIRA 2RHGB 3B52X 3I9LA 1CR2A 4Q37A 1Q15A 5E6UA 1E3QA 2WT9A 2XMPA 1NVGA 2ZSUA 3JAWA 2HT1A 3Q3VA 2XJ4A 1Y8QA 1WUIS 1Y1QA 3WRXA 5JASA 4K05A 3HGMA 1XD9A 4O5AA 3LX6A 4QJ4A 1CPYA 2VK2A 5FOUA 5BVHA 2OPBA 2TECE 3Q11A 1WCIA 2BH9A 1Q0HA 2YJ4A 3I4FA 1NNUA 4OMCA 1X1TA 4YRQA 3LLVA 4YUYA 2DJ5A 1QFMA 1DEXA 1J2JA 1YO6A 2ZDQA 3OA2A 3QUBA 3UXYA 1QV7A 2J45A 2B69A 2CE2X 2CXHA 2F3PA 1HQCA 1UAYA 1UP4A 3ETNA 4GL4A 1Z2DA 1PCXA 2G09A 5HUJA 5TC4A 3OCJA 4C6TA 3BL6A 4MV7A 1QIEA 3GELA 2BEVA 3EAGA 4CEHA 1DX4A 1X7HA 2FFQA 3L1HA 1SCQA 5HZKA 4OX9B 3F3MA 1W5FA 4B6OA 1CR1A 3E9DA 3D7SA 5DISB 1XRNA 2QLBA 3UAZA 4LKOA 3KHTA 3AX6A 2DAPA 4BUCA 5IKPA 4IGIA 1M1YE 2FUCA 1NBMD 1NUAA 3MGBA 3PDUA 4HQ0A 4Y6QA 1K3FA 1TZCA 1TM3E 2D2FA 4HOYA 2OT3B 4OL0A 1TU4A 1WXXA 3TD6A 1L5OA 1VP3A 2FN8A 4LCJA 3U9SA 5FTLA 2L82A 4II3A 4Z99A 4BJ6A 3ILVA 3ZG6A 1SRQA 3MHPA 1DHTA 4G5RA 2GILA 3CKMA 1AK2A 1U2GC 2I3ZA 1N7HA 2OG2A 3MF4A 1Z4PX 1F0KA 2WMYA 1RVDA 3D7LA 3PUIA 5BSGA 1QFSA 2I65A 4QFCA 3WGOA 4XFJA 3OZWA 4NONA 4C4PA 5EEGA 1RQPA 2A5FA 3SSOA 1Z2OX 3BE6A 3G2MA 4YGXB 3ZWOA 5LDDC 1CJUC 2EZ4A 3OJLA 1B3RA 3ZV6A 3ZHTA 3KKOA 2RGRA 1CJCA 3H11B 2V6IA 3OLYA 3IQHX 5T7BA 3BK7A 1FTWA 1UOQA 3E9CA 3PE6A 2CBGA 2ZAOA 5A62A 1QO0D 2Z30A 3KLBA 3KZXA 4R2LA 4B87A 2QENA 1PFQA 3EZ2A 1WCXA 1TCAA 3OZBA 2ZUWA 4CNQA 1QGAA 3RFUA 1U8FO 2QP9X 3WSTA 4D41A 9GPBA 3F7NA 3W2HA 1UAAA 3WDSA 3GK3A 2C96A 1U11A 5LIPA 3EHEA 3M49A 4YJ2A 1GZDA 5K8CA 1Z16A 2BUCA 3A28A 4NARA 5CVVA 3NVKI 3FUTA 3TSWA 3UAWA 4EJ2A 3T3OA 1SXJE 4KXUA 3RABA 2AX4A 3HL6A 1K1EA 4Q4HB 2GPTA 2QM8A 4Q1CA 4TWBA 5D8DA 5HIIA 2ADFA 3QVXA 1Q0PA 5EWJB 5TR9A 3WMEA 2YS7A 5K45A 1T9ZA 3DE0X 3DV9A 4M98A 1KSJA 4DHEA 3N7TA 2Q5JA 3C5WP 4KE9A 3IBCA 3P0IA 3F67A 3RFCA 4KVAA 3VR4D 1TVMA 4ZOLB 4HVCA 1VMKA 3AH8A 1M1ZA 2CHQA 3MJHA 1IZYA 2WKRA 1VCHA 1W36C 1JE0A 2RIRA 1WHSA 1O4VA 4LZZA 1Y6QA 5LIRA 2CHFA 1E0DA 2XD4A 2O8BA 1NQTA 4UTPA 3WJAA 2COKA 2WD9A 4KWEA 4P33A 4KW7A 3ROPA 4D6PA 5C3MA 3IOEA 1YRWA 2XIJA 5ITVA 5FNVA 2HF2A 1IIBA 5ENDA 5F76A 2CLHB 3BEDA 3LL4A 1M2KA 3R1IA 1I8TA 3O7WA 1FDTA 2SCUB 2B4KA 3EBPA 5FB3A 3HCWA 3EGDA 4DDUA 4YPVA 2BFDA 4HNUA 1U7UA 1QF7A 2ZRHA 3K0AA 2WUFA 2I4MA 4RCYA 3GD5A 3RBVA 4BP9A 5AK4A 3S44A 4ER6A 4REQB 2CFIA 1W94A 2FJPA 5KSPA 3DAPA 4FB4A 5KB3A 5EA2A 4L4UA 2D0DA 3G0OA 1UOEA 4PO9A 2P2NA 1TT5A 2VJMB 1GNSA 3WLMA 2A54A 3RS2A 4X1KB 4WZBA 5AJHA 5IXSA 1Q22A 3KYBA 3CLSD 2DUJA 5JSYA 2CYBA 2H8GA 4ZYYA 4JEMA 3WR5A 3VX4A 3CG4A 3UVEA 2VK8A 3VU8A 4NK5A 3GLGE 4L85A 4DZZA 1S3FA 2C5FA 3GCZA 4C3UA 3AVQA 4DN6A 2VRWA 4PHCA 5EJ9A 3HKEB 2HIMA 4EW6A 9LDBA 3ZZUA 1K75A 1QQAA 3TN7A 3P26A 3G0DA 3W8FA 2ZJOA 1XA4A 2VHUA 3W5HA 4BWGA 5CVTA 2VP6A 3IO3A 2FQ1A 3PPYA 1L4HA 3QIAA 4IDHA 3W8EA 5KNDD 3HM9A 3G2HA 2FSGA 3EC2A 3NDJA 2E5LB 4COOA 4GBED 2QYHA 3IHWA 1LC3A 3EK2A 4CIAA 1RWVA 2FPPA 3MWGA 4OKNA 4GMXA 2HXGA 4Y67A 2Q5EA 1JXQA 3K5IA 4BKPA 4X8HA 2ATEA 3ESRA 3GDGA 4V1CI 3I72A 1WCV1 3UW3A 4MHTA 4XWYA 1EG7A 3P0HA 1WB5A 1XD2B 4R9UC 1TQ8A 2K2WA 4UBLA 3R7WB 3W4KA 1IOVA 5JLAA 1J20A 1EEHA 1Z29A 1AKEA 3RVOA 4ARBA 3I8OA 5FBRB 2HO4A 1OU0A 1P3JA 3Q7EA 1II9A 4DY4A 4CKBA 5CURA 4PNEA 3BH0A 5ESDA 2J6CA 1K9SA 2I4RA 2WKPA 4J94A 1XVUA 4LC0A 4RK7A 5H3LA 2BHSA 2CL7X 4GPEA 2IQ5A 3C3MA 4GO1A 4Q16A 5JYBA 1ZW6A 1KI3A 1WKVA 3BAZA 4M0UA 3ESXA 1EDOA 4BLWA 3DGEC 4RULA 4FE4A 1G2PA 3BQNB 3LU1A 3ETDA 4O2LA 4BNLA 1BDIA 1Y4ZA 1OQAA 2NLOA 3HWX1 3VR6A 2GBCA 4IKOA 3RHZA 1O8CA 1DZ3A 2HMVA 4DCSA 1SQSA 4J91A 5IAJA 3OTIA 1WZCA 4MKZA 1CDZA 3ND5A 3PICA 5ALXA 4GKKB 3DONA 1F6DA 4MCHA 1E9RA 3TQHA 3L6OO 4F72A 1OWLA 4IIJB 3VJLA 4CLOA 3OOWA 4P1ZA 3KQPA 1KA9H 2DG2A 2YV2A 5DGDA 3ZVNA 2ZBVA 3AFIA 4F1JA 3JQAA 5IKEA 4KL8S 4MQ6A 3CO0S 4NZZA 3PGJA 2EYUA 2IU0A 2JGFA 2V58A 4HXEB 5IBCA 1V35A 4PLGA 5KWJA 3P27A 4Q7QA 1CY8A 1Y7IA 2AOTA 2E18A 2ISSD 1KTIA 3WNDA 2DKOA 1DT3A 3DF7A 4K6GA 1BDMA 2HSGA 3NFRA 1Z7GA 2HLDD 1Q20A 3VPAA 4EYQA 2OCKA 3QWHA 2P6UA 4RTPA 4NOMA 3IDOA 3BCSA 3GLVA 3HO8A 1P1BA 4C88A 1QV6A 3A10A 3EGWA 4R54A 3CNQS 4INPA 4RAOA 1XRLA 3VZQA 3ESBA 4BWVA 1C30A 3ITKA 4BLUA 3EFEA 3WMXA 4AURA 1K8QA 3C97A 5CJ2A 4Q4DA 3E5NA 2Q4DA 1ZGBA 4FMCB 3ZI4A 3E18A 4BQOA 2G1KA 4PHHA 5T41A 4JJ8A 4R2IA 1GNPA 4EY7A 4DOMA 1DAFA 4FI3C 3ITNA 4GKJB 4GWGA 1AURA 2F67A 3QE9Y 3R3SA 1M0SA 1N92A 4XJTA 5BV8A 1JDUA 4L6CA 1VKJA 4TZ0A 1ES9A 4AUEA 4XWAA 1DMRA 4G41A 4G1FA 4QEDA 4XEUA 1EJ2A 1RQRA 5F12A 5F9MA 2Z58A 4MIEA 4WXPA 1IBCA 1RBZA 1S89A 1UT6A 1YT5A 3LA8A 3ER9A 4COKA 5H80A 3RKSA 4C87A 2O1SA 2VJYA 2DUNA 4ZVPA 3KUCA 3ZX5A 1U2RA 2QD1A 3SR3A 2PX8A 3PX3A 3C3DA 1IVNA 4IGFA 1T8YA 4Z8YA 5FFNA 3NUGA 2OPHA 3DEFA 3MTGA 4JLPA 4NRDA 2PIDA 1XNQB 3MCZA 1OXUA 2AFIA 1MAAA 3PFWO 4MVJD 1QX3A 2ZJ7A 3V33A 2R66A 5L3RA 2XNKA 2PL3A 5HMMA 3SHQA 4ZJPA 4NE9A 4IJ5A 3GDOA 2H3EA 2ATVA 2GEBA 2NU7A 5BVGB 2RHWA 3RRXA 3SN6A 3H8WA 4QBKA 2DR2A 2J9YB 1GZ5A 3VR3D 3PQ8A 1P72A 2ID9A 1ZNQO 4JIGA 4MJ7A 4J9UE 4QQ8A 2PKQO 4OX9Y 2BM1A 5TIIA 1UP7A 1ZIXA 2P77A 1HK7A 4JT4A 1YFKA 1OLXB 1ODIA 3VVBA 2W6PA 2GWRA 1EFLA 4O3FA 1AIPA 3EZGA 5I51A 2D5IA 1VSQA 2IT1A 5AM1A 2UYQA 1F1JA 3JRWA 3MAAC 3F8WA 1SNYA 2ZDGA 1ZO8A 1AZWA 2VPPA 4MS3A 4R1LA 3QBDA 3QQPA 1KZ6A 2IYVA 4ZT2A 2OMEA 1NMSA 5H1YA 3TKLA 3VBEA 3X1KA 4F7WA 5BN4B 1P0CA 4GMKA 5IVDA 2CF6A 5D7NA 2WLSA 5J4HA 1VB5A 3T4XA 1QOPB 4C21A 4EA9A 2GPYA 3ZS8A 3RFVA 2HQRA 3EARA 3HKCA 5FA6A 1E3JA 2HD4A 4NYIQ 1JZTA 3OQMA 3LRTA 3QUQA 5KO2A 4K40A 4N5IX 4KQIA 3B1YA 1PGOA 1PNQA 3SF8B 4GOMD 5JS2A 1X8JA 4BZZA 4AKIA 2C5AA 2EU8A 2DLCX 2CE7A 1G7TA 1DO0A 1JG7A 5EFZA 4NNOA 4U2CA 4LWZA 3TZCA 3GWZA 2PYIA 2P79A 5IF3A 4TLMB 3PPVA 4LZJA 1FBNA 1KH3A 2EARA 2ZQZA 4OD0A 3N28A 4LI3X 1VHJA 1YASA 4DYVA 1PR0A 1P1RA 3D8TA 2VNSA 4O29A 3UGJA 1QR2A 2GD6A 1U2EA 4S35A 2HYIC 4Y6SA 1COZA 2QPAA 3KPJA 4C01A 2H2DA 3PUJA 2RGUA 2WM2A 10MHA 1UWVA 1OXBB 1VJ1A 3A6GA 3I3SR 2JJQA 3EAFA 3JWPA 4H77A 4HV4A 3MWFA 1MO4A 1C2TA 2G9ZA 2WFZA 3QE2A 4GH5A 3UEOA 3P0RA 3TKYA 4BZQA 2PTGA 3L77A 1JMYA 4M6WB 2OXFA 2D54A 2DE0X 2ZS9A 2VXBA 2LDBA 2I6TA 2QTLA 2J5BA 1PGPA 4I36A 4IKPA 5K01A 3NM5A 4U39A 1U7OA 3WKDA 3KYDB 2OAGA 4RH3A 3I76A 4JC0A 5LN1A 3BFJA 5BN4A 1O4WA 1WUTA 4MRMA 1WSWA 1A1SA 2J3DA 2ZKIA 2JA2A 3GRZA 3PKIA 4B3XA 4YCDA 1KY3A 2A30A 2F3QA 3HKCB 1AG9A 4FILA 4LFCB 3S7ZA 3LOUA 2G8NA 1OBHA 5KOYA 1XZGA 1FDUA 2RC6A 1D2RA 4I1YA 1YQXA 2ENUA 2H85A 4GOJA 1J8YF 1E9CA 4P08A 1TYZA 4M55A 4LEIA 1I1QB 3OLXA 2ZXEA 4TKLA 3SHVA 2YMMA 2FZKA 4ZVUA 5JVDF 1MF7A 3VGJA 3R3HA 1Y9DA 3C7KA 4I08A 5GV7A 1JHMA 3N5KA 2J31A 4ARVA 3QEBZ 4Q9LA 4R1QA 3SQLA 3OC6A 5KTSA 1QO7A 2OC9A 4RV5A 2O3TA 3TCXB 4PBTA 1JR3D 4UNQA 4AJNA 3NHJA 1KNQA 4WGFA 1U98A 4G86A 2XYVA 4FHZA 3WYAA 1SBYA 2HIAA 4NK4A 5ELLA 3KL4A 5FO1A 2I4IA 4PSVA 1M7HA 3GFOA 4ZAZA 5I7UA 4N8DA 1ZM4A 3OFJA 1OAOA 1A71A 4Y6LA 1YR3A 4FUQA 2IV2X 3R7BA 3SEQA 4BNNA 1ZY2A 3MQ2A 3NTQA 1GPAA 3FZEA 3W4IA 1TRHA 2QG4A 1JKJA 1XDBA 5FO0A 3RSFA 1JG1A 3TD2A 4ODIA 4DMRA 5CB8A 2GKOA 1T1SA 3DCIA 5BR4A 1JPUA 5EE1A 4YCCA 2Z8XA 3E7WA 3NH9A 3QIVA 2GFIA 3R20A 5ARBA 1T1JA 4DIKA 4RKRA 4UDXX 2P9GA 1RJEA 3GRAA 2VAMA 4FNGA 4Z0NA 4ZYWA 1KI6A 5EJGA 1JFFB 1TM1E 3IBYA 4G9EA 4JLUA 4N5MA 2QG9A 2QX9A 2Y1LA 1G3IA 1RLUA 3P32A 3QWFA 1OTHA 2OQ2A 2X86A 4UM7A 4ZJYA 3O4IA 2D1TA 2QAGB 5BYBA 4K9NA 2AI3A 1GL9B 1QMPA 3N2KB 3PFIA 3T7JA 3U2QA 2H5IA 3UHFA 3BRSA 4EZIA 5C5EA 2Q2WA 3E3LA 2QRUA 5B36A 3UMMA 4TVKA 4KXQA 2B94A 2XB9A 4X91A 2ZE6A 4QEKA 4ALNA 5U4XA 4LE0A 4XIYA 1VG0B 2FE4A 2ZIFA 3FUXA 4M86A 5CB6A 1J56A 1E4EA 2NAPA 1XPUA 5T3YA 3RU2A 4B3CA 3CCFA 4W4TA 1I2MA 2JIPA 3I58A 1XU7A 1H22A 1W0KA 3VKWA 5IX8A 5CH3A 2B8TA 1X8KA 3HM2A 4OVKA 5SZIA 2A50A 1RM0A 3LFHA 4RY0A 3AY7A 3KQKA 4MYTA 1JE1A 5DRTA 5MFZA 2OQRA 1NQWA 3UCEA 5JZOA 3TZQA 3UWOA 2JI9A 5TEWA 3LC0A 3ZY3A 1TK2A 3EEBA 4QWMA 5DOVA 4P58A 1YNSA 1GNVA 2ZUUA 3B13B 1O95C 1QFZA 1T9GR 5LUBA 1B6SA 3NPAA 4FGSA 4OMDA 4WNYA 4C03A 3KJNA 2J07A 5K6AC 2XE6A 1Y7TA 1EQAA 2QQEA 4ILKA 5E6UB 4AZTA 5JYDA 1X1CA 1M0TA 2JGNA 2BGNA 3WL7A 4DCJA 4Q05A 3FDFA 1AGRA 1Z7BA 1U80A 4MIOA 4X1YA 4AYTA 1ZIPA 5G1OA 2VZEA 3OFSA 1FS4A 2GEVA 5HOEA 4R71A 2ZUFA 2XWSA 1O0BA 3ZU5A 3D3NA 1GUFA 3HYSA 1SEPA 3K9NA 1HZJA 4ACBA 1K63A 1PAUA 4JQCA 2BTQB 4I19A 4WZAB 3WIEA 3GJ8A 4QSMA 1WUJS 3HP4A 4OSPA 3ZNPA 4PTZA 2F1IA 5JE8A 3UJ3X 3WJ2A 4BBZA 4M0LA 4WOCA 3FD8A 3ZHZA 4Z3OA 4CEHB 2PGOA 1T4GA 4L27A 3O26A 3MFQA 4YHBA 1SZJG 1ZDMA 4R2HA 3N87A 4IG9A 3PR3A 3HBMA 4NENB 4H1WA 4RKWA 1ORWA 1CE8A 2C31A 2VHXA 4NICA 4ZRNA 4CKEA 2RH8A 4EVSA 1AS0A 2A8YA 2P4QA 5LCXA 1CNFA 2BZGA 1PL0A 3MOGA 2O2CA 3JAKB 2UXCB 5E1MA 4EECA 3G82C 4TYNA 4Z4FA 2DUMA 5IJWA 1K6MA 1XU4A 2OGZA 2O14A 4PGFA 3DZJA 3I39X 4I0WB 4KCGA 4RS4A 1JLHA 5B1IA 4S1OA 1VL5A 3DMFA 5AKZA 1VP9A 2P3QA 4E1VA 2JBWA 1L4BA 4MWBA 2CLOB 1BCRA 3C7DB 1SXJD 2C9BA 2OQIA 4KG7A 1NI4B 1NOKA 2VF2A 4TZTA 3KYCA 4KE7A 4JNKA 4MS3B 1M8GA 4YRLA 1C9JA 2PWBA 1MD9A 4GYJA 1AKNA 2W37A 2B1IA 2WF6A 4QDJA 5T6BA 2E4YA 1JU4A 5AW3A 2O8EA 1UBTS 1KO5A 1GFIA 3C1AA 1CUVA 2SKCA 3CE6A 3DTVA 3IELA 3WB2A 4CDNA 1X3LA 1UL1X 5L3SA 2G4LA 5I4IA 4JDPA 1ULAA 2AMLA 2WNHA 2HCRA 3ADOA 3DJYA 1N5MA 3A4YA 1YCFA 4GKVA 4RSGA 5BWCA 1O97D 4F4UA 2PJZA 1RBYA 3MNFA 3RJZA 3EULA 4DUGA 3WQQA 4TOIA 2IQIA 2VNIA 3C5HA 3E4DA 4YJ2B 4D4GA 1RRGA 4N18A 1DIHA 2Q3MA 1CVIA 5JD5A 5AK6A 5BSMA 1R6XA 4Q3BA 3WADA 2BCEA 1NN0A 1P2BA 2OP1A 1IXRC 2IHBA 3ABRB 1BDJA 4IR7A 4BVKA 3TRIA 2Q5FA 4OAQA 2FQWA 1CD5A 2Z8ZA 2CBZA 3DQZA 3OM8A 2IZ6A 3A1EA 3ZUGA 1HDEA 3GCXA 3KTDA 1ODTC 1TZBA 2ACVA 3E70C 1NE7A 4B6GA 2CL5A 2IXEA 1GM5A 3NBZC 4X85A 8AT1A 2V1XA 5ADUS 2M32A 2F90A 1JSCA 2GVZC 3BG5A 3FVVA 4F4FA 3ZDBA 4A6XA 1AK1A 1YHZA 4ZVVA 1EM6A 4BMSA 2QRZA 2OXCA 2ZQYA 3JV7A 2I62A 3FNRA 4ENTA 4HVAA 4RJIA 3R0JA 4U9HS 2PX6A 2IW1A 1C0IA 1PFWA 1LPOA 1AMNA 2WG2A 3D8BA 4LXHA 5B64A 2BEUA 3WQBA 1MGPA 4F3TA 3ZE8A 5DT2A 5BN5A 3FVWA 2AKEA 1HGXA 1VPVA 3N8IA 2WAAA 4B79A 1TYBE 1NF9A 4CMIA 4IV5A 4IIDA 2IF2A 3GRPA 4MP6A 3GLSA 5AI0A 3K1ZA 4Q00A 2IYUA 5KC8A 1KQGA 3F0TA 3H97A 4BAZA 3R9KA 3RVSA 2PUCA 3TSZA 3DT6A 5HWSA 5MGBA 2CNWD 2YYZA 2ZB3A 4NBLA 1BS1A 3AUXA 2CDCA 3WLTA 3F6SA 4X1KA 4WZBB 4B2LA 4Z4GA 4MYDA 4TSRA 1F8XA 4DBLE 4DCNA 1KJJA 4N0PA 1V8DA 3I64A 4JJ4A 3BXPA 1ECJA 1I33A 5IZCA 5LBIA 1XMVA 2W6QA 1Z5OA 2JIZD 4LCBA 4Q47A 3TQCA 2DLNA 3DO6A 1X1QA 3X3HA 5IDWA 2AG8A 2ZJ8A 5EQDA 3DW3X 5EKTA 3KQUA 5C0OE 5EQJB 1Q83A 4HJXA 3AFMA 1PF7E 4HGRA 4OXXA 2PBLA 1BQ4A 1RP1A 3PQ4A 4PZDA 3TFWA 3UATA 4YMIA 2WJHA 3GP3A 3O8OB 1H6DA 2V4MA 2WAOA 1GR0A 2Z2ZA 2R86A 5AW5A 3ZH2A 4NOJA 1Z26A 4O4LB 1MIOA 1WB4A 3ZWMA 1M8PA 4KEAA 1XYVA 2IKSA 5M04A 4HGQA 1XTQA 2Z8YA 1DBIA 4D4LA 2GHRA 2H7CA 3L6BA 3QVMA 4RHXA 3GROA 2Y1OA 3SU8A 5CD9A 2ZIXB 2A59A 1YJXA 1H5NA 1JA1A 4JENA 4ND3A 1ZAKA 1Z74A 2P9HA 3LSYA 3GLRA 2IYNA 4GMHA 2BVNA 3ZBTA 1QE0A 4AX4A 4DZRA 4M87A 3MT0A 2Y1DA 1QDUA 3INGA 1XDDA 1XCJA 3DD1A 3HA5A 2ZP1A 4C0XA 1F4LA 3RVLA 2A6PA 3AOEC 4P7GA 1REQA 1G8AA 4BCDA 2E5FA 3A0RB 3MB8A 1W4LA 2OV3A 1U1DA 3ODGA 4CLXA 1YHNA 4B7AA 2IBSA 3KOMA 4OHUA 3QTLA 2DERA 1KETA 1MCZA 1D6JA 2XNCA 4UJ5A 3G0BA 3H4IA 3HDGA 4TTAA 1E4EB 5AK5A 5KQLA 4QEZA 4GGMX 4CTOA 1DHRA 1QKJA 1HNZB 3NNDA 4G5XA 1P91A 5B1SA 3JQEA 2ZM6B 3E35A 3L9WA 3NPMA 2JLVA 3LOPA 4WL0A 1OR8A 3KB8A 2X5XA 1M2OA 5THKA 5K4AA 4C4OA 4FOSA 4C78A 1MZPA 5BSHA 1PVOA 2HLDA 1SOAA 1TIPA 5B1YA 2V6GA 4DCGA 1O96B 3DR5A 1VHWA 3RHSA 3RVPA 4F56A 3WWOA 2JAPA 3EMKA 5GWXA 3ZOKA 5FWYA 5KTOA 2R6FA 2D0PB 1PBTA 1N0IA 1X2EA 1XA0A 4HNVA 2ERCA 3RUDA 4R8KA 1TL7C 2PT5A 1Z73A 1SZPA 2CBXA 4UVDA 1N5IA 1DIBA 1IM2A 1B41A 1ZUNB 2C3UA 2X3UA 3KZMA 3V7WA 4IOKA 2MT9A 3KAKA 3E9YA 5CB4F 4AZ3B 3CCCA 3E9MA 4CTNA 1NRJB 2WJIA 1Z36A 1ZCJA 2PAFA 4I3HA 3QKSA 3QPDA 3NWEA 1CUEA 4JB8A 3EGIA 1OCEA 3DDOA 1SD1A 2XOEA 3FDIA 3MBIA 1M9NA 4G5SA 4QPCA 1WVMA 4WKPA 1FMFA 5KTKA 4D56A 3H9UA 3LUGA 1CERA 1A2OA 1B8OA 4HI0E 3BGOS 3ZDDA 3OE7D 2C92A 1ORIA 3GC6A 4ENUA 1XZDA 1T6YA 4FW9A 2BFBB 5JXIA 3VO9A 4LJ6A 1ZG3A 4HB3A 5AM2A 4CM7A 2O7RA 5HXAA 1ENOA 4K6HA 5D5QA 2OO3A 3Q2OA 3KSMA 4TN5A 4M60A 1EAYA 4ZQGA 4F2GA 4QAQA 4O2RA 3WFJA 1RP7A 3IRVA 1IXSB 2OHIA 3FRJA 1NV8A 2IIQA 4GE3A 4RK6A 4E15A 2E87A 3SHTA 4PINA 5WRFA 3IL2A 1V11B 2OD2A 1Y8ZA 2XNDD 3TSCA 1NP7A 1UBOS 2VVTA 3T4EA 3ZBQA 3GWGA 4PAMA 5EVJA 4AIRA 4B0OA 4N5DA 5LR6A 3RAEC 1Q3KA 4UU1A 4RKEA 1PZGA 1NLMA 3C6QA 2D2EA 2CDRA 1JFLA 1RKXA 1SIWA 1GAJA 2HJRA 2YJ5A 2ZJ4A 2F3RA 5IF9A 3G0IA 5CK5A 1G8FA 3WK5A 2ZJ2A 3QH4A 1RHJA 1SH7A 1AS3A 2MINB 2I8CA 3E9RA 5AM5A 2QZSA 3PXUA 4ARZB 4HK4A 5B2FA 2JLQA 4EEXA 3EFHA 3C3WA 3OLQA 4RK0A 5ARCA 4ZC8A 3TG2A 1C81A 4WN9B 2Z95A 2PVPA 1Z8DA 1EA5A 2QVYX 4FN4A 1WZ2A 3LUPA 2KI5A 2Q49A 1FTYA 4ZALA 2LCIA 4IILA 4Q12A 5F21A 3SZMA 5AJUA 4JL6A 4KNVA 2NNLD 2VHWA 3TUIC 2H07A 1UXOA 1XNHA 2ORYA 2CXNA 1TQHA 1E1LA 2BBTA 1VLJA 5EIHA 2R7KA 4ZZ2A 2R4TA 3DEYX 1X7DA 4DLAA 5JH7B 1XZQA 1ZXBA 4TLBA 5FD8A 4PLZA 1X3SA 4RQTA 2WHXA 3KLNA 2CW5A 4LCEA 3IP1A 5FFFA 4AN1A 5ALIA 5LA6A 3Q6MA 1DOHA 3N0VA 3QYFA 3ZHXA 2FK7A 5F1OA 1JHXA 3L06A 1HE2A 2X1VA 5EINA 1E89A 2P6PA 3WB9A 1JSLA 3B78A 4FZRA 3RADC 2HNAA 4AJPA 5HNKA 3LQFA 2NPIA 3RV4A 5C81A 2VQ3A 4YJKA 2R1VB 2FP4A 1GL3A 4L5YA 4G0OA 1OD6A 1T5DX 5KNBD 4I4IA 3KQNA 3EIHA 2CJWB 1PJSA 2ZUTA 1HDYA 1K97A 4B81A 5ILGA 2NO0A 5AT1A 5G0TA 4EMUA 3KOOA 3MS2A 2PRKA 2RH5A 1E7SA 1P7VA 3F6CA 1S9HA 2XQGA 3LYUA 1CZOA 2IYFA 3HE3A 4D02A 4OQMA 5EP2A 1YTUA 2QRLA 4D4IA 1OBOA 2Y0DA 1OIVA 2BR3A 2PX4A 4A8JB 4HX9A 2KSQA 2ZBEA 1VPTA 1GFSA 1Z8HA 2A78A 1PWYE 1Z6TA 1NRIA 2N3ZA 3MJRA 1JEQB 1RLMA 3COZA 5F2KA 3WIVA 5LZ9A 2ZIWB 2B0JA 4Y1GA 1FF9A 2R8OA 1TA4A 1WXHA 2BP7B 2J9RA 4CEIA 4GMFA 3K1AB 1EGQA 3H6HA 4YJHA 2O6HA 4P4SB 2YWRA 4G56A 4B35A 4EPVA 4MUIA 1QYIA 2P8SA 1QCDA 2GJAA 4BO9A 4I99A 4ILEA 1FP1D 2OHHA 3V6MA 3VNSA 4AMBA 4AVYA 1JVSA 4XD2A 4HL6A 1M34A 5CDSA 3NTXA 3HVUA 1F6WA 4JLWA 4Y6GB 5EJMA 4TVBA 4HWOA 4HR7A 1KFKB 1QKIA 4ZAWA 4N47A 1RWBA 4C06A 4W63A 4MV6A 6NULA 2YHIB 3JZAA 3VPSA 4GHWA 3VYTB 4UEOA 5TLSA 4Z2YA 1BXGB 4FEAA 3CEJA 3EPLA 1NZDA 1RMTA 3L8CA 1WW3A 2Q5OA 1ZIDA 3MD0A 1P2GA 3PJEA 1YOVA 4X00A 3UPTA 4RANA 2F43B 1JQDA 2IA5A 1WXIA 1EX6A 1Z8FA 1JP7A 4U9UA 2HF7A 2QD2A 3IULA 4AO6A 1XP8A 3BD8A 3DCJA 1MO5A 3DH0A 3KVNA 2Z56A 3OF2A 4ZZIA 6REQB 1NXVA 2MIIA 3MMXA 5K8JB 3PE3A 1W88B 1XALA 3KRTA 4BFTA 3UCFA 1MQSA 4ZI2A 3V3KA 1ZGHA 2EKBA 1ZM3A 1IK6A 2WAYA 3ELWA 3EOBI 4UU0A 1K27A 3AVUA 1KNXA 1XEWY 4G84A 1P29A 3HBAA 4RZ3A 3LGXA 1Q1NA 2V6MA 1OX4A 4HLUA 4OL9A 1KZ9A 4J7CA 3UYKA 1RDFA 2E4WA 2ODQA 3QUCA 6GPBA 3AHGA 1YHYA 2XWQA 2ZJ5A 2J87A 2IYQA 1GT6A 4EABA 2D2IA 1PW7A 2XOKA 5A3JA 5I7EA 1EP2B 2HGSA 5CJPA 1QSGA 3JXEA 1OYWA 4M1TA 3A4VA 2J09A 2F6RA 5EWLA 3IERA 5H59A 4WW0A 3GZ4A 3MINB 2CKMA 3CLUD 4QUAA 1M2EA 1Y63A 3MPOA 1FNNA 4RIFA 3I01M 1QHNA 4FWIB 2P40A 3GUHA 3QHQA 5TEVA 2WHYA 3VZBA 2FW0A 5LA6F 3IB3A 2IDZA 4QYSA 1T8SA 4YRGA 2JFGA 4ALIA 5BYAA 1KP3A 5KWIA 3N0WA 2MYPA 3S7TA 1XTIA 3PJRA 2JI4A 1VPLA 2ANCA 2YWXA 1RWPA 3QMWA 2G76A 1JKIA 2IL1A 5EESA 2G80A 4QECA 2B9EA 3H2JA 1ND6A 3KUDA 3LK6A 1E77A 1N6HA 4GWKA 2JI6A 5HDBB 1RJGA 1F7UA 1DJQA 2R47A 4BO6A 2Y2UA 2OOKA 4KRYA 2J0EA 1U3TA 4LPKA 1MVOA 4UVHA 2C9OA 4B6QA 2QVGA 1RI4A 3V1TC 3ZIAD 1NR1A 1AHPA 3DV0B 3ZWCA 1BN6A 1LPAB 2F43A 3AF2A 4HPXB 1N25A 4P80A 1IM5A 3VYWA 1INLA 3FNGA 1SK8A 4UPDA 3D3QA 3TLEA 4BQSA 4TKUA 2PBRA 2IYSA 1A76A 2AZTA 2Q6VA 4URFA 3QF4B 4M4SA 4PZEA 2Y6UA 5IN5A 4ZI7A 4BJ3A 1T35A 2X9GA 3KE8A 1KJWA 1X1SA 4N48A 4LOAA 4CKBB 2HF9A 2O0LA 4KQKA 1A2BA 1MP0A 3ECCA 1Z7WA 4F5EA 1BE6A 5K0JA 4FYIA 3DDUA 1KMMA 3U3KA 4A2CA 3JYNA 1O8BA 3T1TA 3ONFA 4FR2A 4K9QA 2EATA 4M53A 3W2EA 3ECSA 1V0JA 4D9EA 3U7JA 5F9FA 1OXVA 4FX2A 4PTYA 1Y3CE 4S1WA 3H5AA 1R0RE 2OFPA 4EGFA 4UE6A 3VDXA 3Q7IA 4BEVA 3L5OA 2FW1A 4KV7A 1E5LA 4FSXA 1DX9A 2ECKA 4XOIA 2FHSA 4ZIRA 2VDPB 2O8DB 3AUUA 1WG8A 1JHVA 1MABB 3K9GA 3EZ6A 3NCHA 4R2KA 2UDPA 3TOSA 4HN2A 1G64A 1V11A 1QANA 3AHHA 3EY4A 1V5EA 2CL0X 5GY7A 5IM4F 3AI1A 3L4BC 2GT1A 4JUBA 4Y7DA 5JY1A 5G02A 2VNAA 1JF8A 2W9XA 2BTQA 5B7PA 5CEEA 2WUVA 3KETA 1L5MA 5A4KA 4RY9A 4K6FA 5JECA 1O9GA 1HG1A 4ZHQA 2EVWX 3M89A 3QUSA 3AWDA 1AVTA 1I24A 1LKZA 5PNTA 2J3IA 1JR4A 4XX0A 4DLRA 5H4GA 3WV4A 3JTMA 1TJNA 2B1GA 2Q41A 1TCCA 1L7NA 2PVCA 2PXXA 1W7AA 3MJEA 2C2WA 3P4XA 1LEHA 1DC6A 4JP8A 1R4NA 2C42A 3I9V6 5LU8A 3ZHOA 2XXAA 3JAKA 3N8NA 2B78A 3NCTA 1JPNA 2P2GA 3LYLA 3F78A 1M1YA 3ZY6A 3P2EA 3WNBA 2Y9MB 2MSCB 3AOGA 3LCJA 3HACA 3N53A 4JOQA 3H7IA 4HJRA 4MMYB 4RQBA 4YASA 1TNDA 4KSYA 4IP0A 1G41A 1P17A 1KVRA 1QLHA 3MC1A 3DOOA 4JT2A 2Q0SA 1NM5C 4PXYA 4CL0A 3RS9A 4CQJA 3ZDXB 5A4DA 4OHOA 2JG3A 2WF5A 5C7IO 4JI0B 3OQVA 4J1TA 5HCNA 1GG8A 3NVAA 3IVXA 1I0LA 3FDZA 1FU7A 3DTVD 4DR1B 4ZU1X 4S2EA 1ISRA 3T3PB 1T15A 1GDDA 2MTBA 1X1DA 4BFXA 1WXFA 4A6PA 4DC9A 1B7GO 2HSEA 2WU3A 3VNQA 4IVRA 4ALKA 1GFWA 4Z9YA 4DLYA 3GZNA 3N2GB 1J0AA 4K6MA 1OYVA 4ZAFA 4HDQB 3SVLA 4PNHA 2C4NA 1V2GA 4OJTA 3HLKA 1BA2A 1UK7A 2XCOA 1Y6GA 2CEKA 5AKGA 2IW3A 2DWPA 3U6KA 1SA0B 1O6FA 2CJPA 3ANYB 3H2SA 1WEKA 3QEJA 2VDMB 5AYVA 5JV5A 2Q1UA 2CDNA 3G2QA 1DBPA 5FI0B 3IEPA 5EP1A 1Q91A 4IZ6A 2HA4A 7AT1A 1JEYB 2QTTA 1QMGA 2R1TB 2GUWA 5IC5A 3C3JA 1HYQA 4ZODA 4HN4B 5FLYA 2EEZA 4IQ8A 2I2DA 1A8PA 3EQ8A 5AVYA 4OO3A 4D82A 1XP5A 3MRVA 4DEYA 1Z62A 4IIUA 3HZHA 5JXWA 1YF3A 2ZSKA 3KKLA 2XQFA 2GZ2A 2PZBA 3A9RA 1NLUA 3H2KA 3HADA 2GARA 1TZMA 1H69A 5FBHA 4CKCA 5LLTA 2X22A 3TQIA 2WU4A 2CDBA 3QPUA 1NXOA 4R3NA 3FMGA 1PJLA 4O02B 3QXCA 5KMGB 1Y9EA 3KIPA 3CWZA 4KPFC 4QAJA 3SJZA 2CXPA 2BR5A 2FSHA 2I22A 4DDWA 1CUBA 1FUKA 4EP1A 4WY8A 2HWYA 4EH1A 1HUQA 4AC9A 4B3RB 3EG5A 3V8RA 2VT7A 1BVUA 1RWNA 2TMYA 1O5TA 3LQQA 3TBFA 3TL6A 3H65A 2PGXA 5B30A 4C7OA 2FTKE 2P1ZA 1PT9A 2FV8A 2ETVA 4FK8A 4F4IA 1TKBA 4RTJA 3JSXA 3FKSA 3CUKA 2FQXA 2Y2VA 3I6QA 3D7RA 4FIDA 4RUKA 2R68A 5EZQA 3VH4A 2WB4A 1KI9A 4MUFA 5SY4A 3QWIA 1B00A 1MPTA 1YVRA 1SHZA 4K8OA 1I2CA 4AN4A 2XGJA 1IULA 1B14A 2XCUA 2XE7A 4EB6A 5AK3A 4BMNA 1TFUA 2NUPA 1OFUX 1IM8A 2CVZA 4XJXA 2CLLB 4OPMA 4UFNA 4ITRC 3VR5H 3IDFA 2D62A 4LXUA 4BLQA 1RVV1 1M3SA 4CTJA 3U7RA 3AILA 5ILQA 4YALA 1V16A 5D00A 1Y3FE 2YFQA 4RXUA 1X9GA 3BSYA 2A57A 4X6YA 1DKMA 1JEDA 1VJDA 3KPVA 4EFMA 5FUXA 3CVWA 4DB4A 2J5KA 4ZGWA 1ORTA 1A8QA 2Q4BA 3LK7A 3FTPA 5CR9A 4BBPA 2JW5A 3CCBA 4HAWA 2PRSA 4LYEA 1E9VA 2WIKA 4UNSA 5E0KB 1KOLA 1NP6A 3SI7A 1IC6A 1IY9A 1Z06A 2XCSB 5ISMA 3UJ9A 3W9YA 2CXTA 5KYXB 4B2YA 2OHJA 4ZMSA 4P4GA 5GPBA 4WERA 2I3AA 1XJ0A 4KQFA 2JKVA 2HQBA 2OHGA 1RFLA 3CR8A 3PFBA 5EE3A 4Z2AA 4L5AA 1SD2A 4JXKA 4F96A 2FEXA 2AX3A 3LTNC 4G24A 4EKNB 1CZUA 3BK1A 1FPMA 1VSVA 1WVGA 2WRZA 4ZV4A 4YCLA 3TNYA 1HLDA 3HHPA 2W2NA 3HKBA 2JFNA 2E6KA 1HYHA 1J22A 2ZYWX 3AXTA 3P96A 1DKNA 3QYJA 4MRNA 3RTGA 4CM4B 2GR8A 5DBOA 4N9QA 1JX6A 1L7PA 1BFKA 4NCKA 4YROA 4A1OA 3IAEA 1XB2A 3RK0A 2VJOA 3FTNA 1HMYA 1VJTA 1YDEA 3DBLA 3OPYB 4IJQA 4DBLC 4B44A 4RTNA 3UJPA 1XYGA 1YZTA 2PQ2A 3CRRA 1L7QA 3EGCA 1FJXA 3S29A 1JJIA 4L57A 1JPJA 1EHCA 3W78A 4QGBA 4Q1FA 2YWDA 3BERA 2VPZA 4TL9A 1GEEA 5AKXA 1YJ8A 4RTLA 1KYYA 2OCDA 4C4XA 3CHYA 1EBFA 2GHQA 4FZVA 1TTHA 2Q28A 3T54A 4MUEA 3E9ZA 4IWXA 3KZ1E 4W5HA 2C99A 4V2IA 1OKKA 4ZAXA 2C7BA 2ZGVA 3EXEB 4D9BA 5DE3A 2FUEA 4WJLA 4ZGGA 2GTHA 2HZ7A 3EBLA 3GMIA 5KYKA 5J3JA 4RJLA 1N75A 2ZZNA 1DB3A 4MJ3A 2PZKA 3LUAA 1Y1LA 4LMBA 4MV0A 5C32A 3KSZO 1SUCA 2FPMA 4BTVA 1XNRB 3H11A 3X1JA 3O9MA 4F8JA 3K0SA 2ZUSA 2QM3A 5BW5A 5F3DA 2XT0A 1EDDA 1VM6A 2JFBA 3G5UA 2JAHA 3LM8A 5FUVA 1F2DA 2CSUA 9ABPA 1M6HA 1NJ6A 4DDKA 4ISBA 1RRKA 2PZMA 3EEQA 3TAUA 4OXYA 5E8JA 3G02A 3GFPA 3K70C 3K0HA 3A05A 1ESNA 1NVEA 4QHTA 1P81A 1U7WA 1DG3A 4ZXPA 4YAJA 4ER3A 2JJ2A 3ZOZA 1ADGA 3C8UA 2DH6A 1AF4A 1ZIOA 1Y7HA 3L82B 3AW9A 3OE7A 3ICCA 3QFTA 2XX3A 1OXMA 4IHJA 3SLRA 5MHTA 2DF8A 3PEYA 1UPCA 2ISCA 4PNPA 4U3JA 1AHNA 1QGUB 1XJ5A 4YRMA 1Z7EA 4O2AA 1ZLYA 1X7GA 3R0QA 4OU5A 1IH8A 1L1EA 4NYMQ 1N8NA 3AR2A 3FMFA 5CPBA 5A0TA 1VMDA 3RT9A 3O93A 3OT5A 1JXAA 3F96A 4QYIB 4Y8VA 2H9IA 2OP0A 4GEKA 2VCEA 4HY3A 3V1KA 5BW4A 3W6UA 1B74A 1EVZA 4TWRA 5LWQA 3BPSA 2HWKA 4EY3A 4C2BA 5C8XA 3DE3X 3WWYA 2OV1A 1RQ2A 2Y27A 4RVGA 2XT9A 4BNDB 1M74A 3GLIB 2J0QA 1Z4LA 1GKLA 1FZQA 3GQBA 1N7JA 1P0PA 3BXFA 4HH1A 5EXPA 4FKZA 3M2TA 4LOLA 1M2VA 4LYGA 5DULA 3SDZA 4YAUA 1KO4A 1ARZA 3EXEA 1Y6JA 3C4JA 3CGGA 3KDSE 5DX1A 5ALQA 3N2IA 2PFKA 4JXJA 1PEYA 1J2EA 3GFSA 1KI7A 1TJ3A 3DPSA 1XHLA 3ICPA 1E7QA 2ZIUB 1WZEA 1P0FA 3N39C 5F5NA 1N1MA 1PNOA 1QG6A 5TMEA 3MTEA 1RI1A 1N9ZA 4RF3A 3K0FA 3QW4B 1S9DA 2EKPA 3DT8A 3PD7A 3DL0A 1HFEL 2ZCVA 3K92A 1C7QA 1HE3A 1VGRA 3HU1A 3MCAA 4MS1B 1R0YA 4O2BA 3TTXA 1CY0A 3MAJA 2JPDA 2PBFA 1P4SA 1SVOA 2WJJA 3CLHA 3ZV3A 1DQZA 4F6CA 4CHGA 1DKOA 3GLQA 1LQ2A 2NZ2A 3NEAA 4IQFA 5CDGA 1RYYA 5D86A 3K9LA 2FAXA 2FEAA 5B1DA 3UGKA 2FR1A 3T0IA 3NOXA 2C9YA 2QM7A 5J43A 1LK7A 3IXQA 1OV6A 3BSSA 3ZI7A 4QARA 5AM4A 5G3YA 4PFSA 3ENNA 4WX2B 1ZOSA 5T57A 3GNQA 3DFUA 2EJTA 4L76A 4LXQA 5K0CA 3OPYI 1WDLA 2P4HX 2JDID 1ADFA 2EF0A 3AT1A 3ET5A 4LRSB 5BOVA 1Z5PA 3ETGA 3EVNA 3BD9A 3IMEA 5EJ2A 5IVIA 1DEOA 1P44A 1ECGA 2VQEB 2NU8B 1ZNXA 2WY2D 2HRRA 1IZ9A 2PK3A 3WOVA 4FDUA 3ZWNA 4Q9NA 2J3MA 1K8ZB 4WNAA 1VPWA 1FQOA 2YASA 3MM4A 4INOA 1QX4A 1XLTC 2B1JA 4MO9A 1YZUA 2D2XA 3RAPR 1Q0TA 1I32A 2IIPA 1N77A 2AKAB 5IM5A 2BTOA 1UKBA 4MS4B 3BIOA 2WPNA 4FHFA 4LWPA 5CGZA 1PT5A 1I0ZA 5FAXA 4DLKA 4PLFA 4UKDA 1AKYA 5GGXA 3TRFA 5DYIA 4MQ5A 4B09A 2BMDA 4EVRA 4Z54A 4XQGA 1TZJA 4YFYA 4HUQB 1N5DA 1GVHA 4PE5B 5HS6A 1EI9A 2VTKA 2GRUA 4CCYA 3LSTA 3U44B 5IYZB 3ADDA 2H2IA 4ND7A 4PZAA 3H13A 2YV5A 4FGLA 2H8KA 1I6KA 5TDHA 3SQOA 4BGUA 5C37A 3ESCA 3AF4A 4L22A 5AVVA 4GXTA 5LQAA 2GLTA 1RJFA 2AYXA 3E7XA 4B9EA 3TTYA 2EGHA 3T7TA 4BV2A 4UBNA 5BMVB 4UQOA 5HJEA 1Y5IA 3LQ1A 4II2A 2EEPA 2EG5A 4WJKB 1A0OA 3KJGA 2WHQA 4I50A 3NBXX 5I3CA 2HYDA 3AKDA 4N1AA 3T15A 1L7RA 1EX9A 3FF1A 3TSOA 4BRZA 3FW1A 2WZDA 4XWGA 4R98A 3T9FA 5C1OA 2WABA 3D0QA 5JH7F 1MLDA 4WQMA 1P2FA 4OBXA 1IBSA 3PVZA 3V2IA 3GL9A 3EYAA 3ZLTA 1X0VA 4DJAA 4YIKA 3IFSA 3IDAA 5FKJA 2ZU0C 3DDSA 3NAGA 4H4EA 3G1TA 4HBGA 4JU8A 1P4HA 2RKBA 4FCVA 1A9XB 1CUDA 1YL7A 1XZFA 3JVEA 4GR4A 3TRJA 2G5PA 5I8WA 4XASA 1KL7A 3DKIA 1DTEA 1FFXA 4I5EA 5EJ6A 1W2HA 1AZTA 2R2AA 4MV1A 2BMVA 1GSAA 2DM6A 1P1CA 1TD1A 2VL7A 2JZOA 4HRYA 4OK5A 5ESRA 5JQGB 2WWHA 3L04A 3CX7A 3P0JA 3GMSA 4POOA 4DV6B 4R2WA 1S8OA 5J5CA 3HMKA 2FN9A 2VQSA 3PT5A 5FBWB 2M6LA 4EKYA 1C50A 4P3PA 2XOKD 5CT6A 3KR9A 3AQIA 4WI1A 1W25A 5I9TA 4JUIA 4WY5A 4EZBA 2WUEA 3FZQA 4TKMA 1A9SA 1U7XA 2FYTA 3C3XA 1X39A 4P98A 1JFRA 1I3MA 3ZVLA 2O0JA 1N2OA 4F3YA 2V7PA 3HABA 4CUKA 4DQKA 3M2PA 4FDMA 1R9NA 1MQ9A 2BY4A 2PGDA 3QLVC 3UNXA 1II8A 4YJGA 1X38A 2BDUA 4MKXA 1R10A 4IPTA 1KP2A 1SURA 3CT4A 4JC5A 4B17A 1JU3A 4KWTA 4QDXA 3LY9A 1BRTA 2I34A 1EB9A 4HTFA 3D5QA 1C29B 1G7RA 3I5MA 2NVOA 4QQRA 3VYSB 3MCWA 4D6XA 3WLNA 4ZXFA 3V2GA 1ZCAA 5B6JA 2Q5IA 1A1VA 1A69A 2GHIA 3NIBA 2WICA 3E61A 4G5FA 3KOYA 2VYND 2X7JA 3ZDRA 4CCAA 3E0QA 4P81A 2IIVA 4H1HA 3H5VA 4Y2PA 2IYWA 5FT9A 3B6EA 5K4GA 4N76A 2C57A 2AFVA 4GVPA 1V8PA 4ZAVA 2Q3LA 2VHTA 2ZRAA 1LSSA 4OLBA 2JH9A 1IG3A 2A4MA 3MRTA 3L3BA 1MDFA 1SVNA 4V39A 1YFZA 3GNLA 2VQ6A 3IHLA 4DR5B 1H2XA 3M6FA 4DNQA 5J5VA 1KMCA 5EUBA 2DWUA 1A4UA 4KAAA 4XUDA 4H7PA 4EF6A 1OTXA 1J25A 1GIAA 1OGIA 2AFHA 2IXDA 2JVKA 3KB6A 4EVIA 3DOHA 4UHKA 3QHPA 1V37A 3I52A 3YASA 4OXRA 3ADKA 1ZICA 3UFBA 4DTIA 2QZ4A 3TJRA 4A26A 1FP7A 1FTSA 4DXAA 2IGTA 3C85A 3AR4A 2FWNA 3RLIA 2IS6A 2VF8A 2H4ZA 1R8JA 5EIWA 5ETJA 1FMCA 1U3DA 2O0KA 3W4JA 1ZA1A 2VHVA 4WXMA 3ZWKA 4GU5A 1R0BA 4JKIA 1RHKA 4CUZA 4L74A 4WOBA 2XYQA 3FWYA 3IT0A 3IURA 4CODB 5AQ1A 5BV7A 4RJ2A 5DPMA 5T64A 1KYTA 4GYKA 1G8YA 1S0UA 2D5LA 1M6YA 2G8LA 4LX8A 5CU7A 2UUBB 2ZQ5A 3AVXA 4ITVA 5EMLA 3RROA 3L1VA 2ZBRA 4V24A 4Q19A 2XYGA 3NOVA 3I5UA 1SIBE 4HWKA 4MCAA 2W48A 1YMQA 2ZBGA 4PY2A 3GLHB 5JISA 1K6EA 2RE8A 4EG4A 2H11A 2LGJA 2Q9AA 5B1HA 4UBMA 4FDTA 1MO6A 5LL6P 2PWZA 1RACA 1MEEA 2W8BB 3EA0A 4WAUA 2EDAA 3Q1LA 5BSRA 3QX9A 1P9NA 3TAXA 3JQ9C 4HQNA 1XTBA 5MDHA 1UBGA 2FMIA 2FX2A 1T1EA 3I0ZA 4FMBB 3S4YA 1OSNA 1KQOA 2JLWA 2LCQA 2H29A 3UK6A 3KR1A 4N9WA 1QVWA 1G6HA 3KJIA 1BMQA 3QPCA 4M0PA 3C7CB 3SWWA 4OP3A 1XRRA 3GGPA 2CK3D 1XRSB 2CXQA 4JP5A 4ZT3A 2PUWA 1L3IA 5A9SB 4YJDA 3L7DA 3VI3B 1E4OA 3S1AB 1J00A 1Z56C 3G1UA 1PEAA 2VP5A 4IZHA 1UBLS 2C83A 3TM4A 1NBIA 1J2UA 4IIEA 4RYLA 4A27A 2BSAA 4IHKA 5K8VA 1ZH4A 3CRW1 5DSZA 3KL2A 2OM2A 4PO3X 3FCXA 4CDMA 1RKUA 2YZKA 5CIQA 4MDEA 3K09A 4TZKA 3F97A 3TLXA 2C98A 2ZE5A 3M33A 1PZMA 3A36A 4MR9B 4XPZA 3RF6A 3I5XA 3GJ4A 1DFHA 2BHLA 2XOXA 4B6RA 1OZFA 1NKVA 3F6YA 3L93A 3L41A 4B74A 4P3NA 5DM0A 3HVHA 3MTIA 3MYRA 1U2QA 3RRBA 3BL5A