2A7YA

Solution structure of the conserved hypothetical protein rv2302 from the bacterium mycobacterium tuberculosis
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
b'MHAKVGDYLVVKGTTTERHDQHAEIIEVRSADGSPPYVVRWLVNGHETTVYPGSDAVVVTATEHAEAEKRAAARAGHAAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Rv2302/MT2359
molecule tags Structural genomics, unknown function
source organism Mycobacterium tuberculosis
publication title Solution structure of the conserved hypothetical protein Rv2302 from Mycobacterium tuberculosis.
pubmed doi rcsb
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08940 DUF1918 Domain of unknown function (DUF1918)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.440 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2a7yA00
2A7YA
chains in the Genus database with same CATH superfamily
3CXCS 3G71A 3M54A 4LUDA 4E7SA 2AIRB 5GAOm 4CC4B 2YUPA 2Z0WA 1KC8U 3HRSA 2P4TA 4JLIA 4KBMB 2LCSA 4KULA 4KRTA 2COWA 4C92A 5KYXA 3MCAB 5GJWB 3MEAA 1S72T 2K5LA 3BW1A 2DL8A 1GCQA 1ZSZC 2JM9A 1NBEB 1SHGA 3VRZA 4M7AE 1W2BS 3I56T 3QZ9B 3OMCA 4WF2A 3CC4A 1WLPB 3LGLA 2VVKA 3UT1A 4ZN3A 3TQ7P 1IGUA 4F7UA 4AFSC 3HL8A 2OTLT 4M7AD 1U1SA 2LC4A 5GAN6 3HRUA 1W2BP 3CC7A 2M51A 4GBQA 4GLKA 1N8RC 4J9IA 4NOYA 2JVVA 4E47A 1BCMA 4GLMA 1AWWA 3E9FA 4M7DC 1YIJQ 3EFOA 5GAN3 2JZ2A 4J9HA 4QVZA 2KXCA 4JRQA 4OB3B 3C4SA 1G83A 2DTHA 5FW9A 3MO8A 1IHWA 1PRLC 2DNUA 2KI7A 1Y96B 4RMOA 1Q81U 1YHQA 2VGNA 2O9VA 2W0ZA 4F7UE 2ZPHB 2QTVA 2DL7A 3PVQA 1VQNQ 1AWXA 1G8XA 2DTOA 3PNWC 2DBKA 1H3HA 3OBWA 2HSPA 3JB9I 2L89A 4EMKC 3CMET 2B86A 4OMQA 1D1AA 5IT9E 3L42A 5HKCA 2DF6A 4J9DA 3G4ST 2WSEE 1M30A 2CDTA 2D9TA 7AT1B 1OOTA 3CCVQ 2LX9A 4M75E 4C0DC 4HCBA 4J7FA 3OYYA 1D0YA 2O01E 3WXMB 1GCQC 3QBYA 1RAEB 1KC8R 1K76A 4OP0A 3X26B 1QLYA 2RJFA 2XMFA 4M75D 3C94A 4M7DD 2CH4A 4OMNA 2EAYA 2RF0A 3OYEA 3ULRB 3META 3VU3C 1JEGA 3AT1B 4JRPA 2F69A 2WSCE 1KD1C 2KRMA 2A36A 2LNHB 1M90R 1PHTA 4RG2A 3CCQA 4MDXA 1W1FA 3CD6T 2KGTA 3QUIA 1WXTA 4K11A 3VS5A 2DE0X 3CBOA 4E7IA 4FSSA 4XAXB 5KYYB 2KT1A 1KHIA 3TCJA 1UJYA 2CZ7B 1KQ2A 2K6DA 3TU4K 2X4YA 1VQPA 3OSVA 4PK4A 1SKUB 3EGDA 2GF7A 4ANJA 1YN8A 2KRSA 4ORZA 1GFCA 3J7AF 1VYTA 1NPPA 2CKKA 1YI2T 1X01A 3RESA 2D1XA 2KRNA 3VUBA 1LVKA 3V8LA 2WACA 4E7HA 2RI2A 3JB9F 4E7KA 1A0NB 4X9DA 3CCMQ 2DYBA 2Y90A 1X6BA 4M77B 1PRMC 1R8OB 3QKJA 2H8HA 2L2PA 3QDRB 3HTRA 5C0MA 2MPXC 3JCMf 2DETA 4MDWA 2DPPB 1I07A 1UGPB 4M78A 3EG9B 2DMOA 2MOXA 3UWNA 2ABLA 3LH0A 4BE1A 1QCOA 5CO7A 2ED0A 2CT4A 3AHUA 1T0HA 2L3RA 3CC4Q 4C92C 3FB9A 1VQ4T 4FW2A 1VQOQ 1IB8A 4E6RA 2E4HA 3REAB 2F2VA 3JSCA 2CH4W 4JJCA 1OV3A 2G6FX 2RM4A 5IXBA 3OW2P 1IGQA 1JJ2P 2YDLA 3VS6A 2LJ0A 2PUKB 3V8JA 3VS7A 2LP5A 5FU7B 2XU8A 3HP9A 1YNZA 2L3SA 2X9HA 1Y0MA 1KC8C 1M3AA 1UFFA 3L2VA 4II1A 5IHNA 3E19A 3G4SA 3OY9A 2QI2A 2NYSA 3RKYA 5GAMg 1KQSA 2HBPA 1SG5A 3JB9H 1SF9A 2CS7A 4CC2A 1GRIA 1RAAB 4HCZA 2KVQG 2CYZB 4EMGA 1VQ4Q 2LZ6B 1D3BB 2EYWA 4HVWA 1T3SA 2QQSA 1G3YA 1O75A 2RMOA 3PMIA 4J9FA 2QEXA 4E7ZA 2DZCA 3RR6A 1VQKT 3EG9A 3MEUA 1MMGA 1D0XA 2X35A 1TG0A 4QW2A 1WA7A 4M4ZA 2DXUA 5AT1B 1K9MC 1VYVA 4DBRA 1WJSA 1U8RA 2ZPFB 4KUDK 1TS9A 4ZN1A 3CCEQ 3MPUB 2KR3A 3IQLA 1YIJT 2RO0A 3QJ6A 1YJWA 1VQ6A 4M75F 2NUPA 4A54A 3CCUQ 5DY9A 3H41A 3WVDB 1VQ9Q 3EG1A 4AT1B 3M0UA 1TXQA 2E12A 5A0LA 3KUFA 1G3TA 1U5SA 2KK4A 3CEYA 1TTHB 2QXFA 4C5HA 3QZ5B 1B34A 4Z02A 3RERA 1OZ2A 3OQ5A 2P0QA 2HZYA 1N27A 1VQ7Q 2M02A 1P92A 4JZ3A 3NTKA 4HT8A 1WQWA 5L8RE 1XQHA 2XHCA 1LJOA 3WVEB 3CBMA 4XU2A 3MP6A 1QVFS 1KFZA 1PM3A 3ME9A 4M75B 3M53A 4M7AB 2HAXA 1D1CA 2JNGA 1IHVA 3OYDA 3OW2A 2CZ6B 2HQEA 1N8RU 1RAIB 2H3JA 5LL6S 2KXDA 2YUQA 4N4GA 1AZEA 2KNBB 2VXFA 3VS2A 2V8IA 1H641 3EGUA 1B07A 2FPDA 1NJIU 2LVMA 4CRIA 2YLCA 4WTOB 2R57A 2E70A 1BYMA 2DA9A 2AT1B 4Z89A 3OYIA 3RIRA 3LWIA 3CC7T 2ZZDA 2QEXT 1X27A 4J9GA 1IREB 3OYLA 1KK7A 2LQKA 1PSFA 8ATCB 5GAN8 1G3SA 1JJ2S 2DYIA 3FJPA 2D6FA 2K3XA 5D6XA 3OYGA 3I56A 1H92A 2RD1A 2YUOA 4M7DB 2M1HA 5KE3A 1N6AA 1K1ZA 4LE9A 2BUDA 2GCXA 4M75G 1I8FA 2BZYA 2GTJA 2RPNA 4XTZA 2G3RA 3ASKA 3OS5A 2DD4A 3A8LB 1QWEA 2L3PA 3JCMP 3JRZA 2X3WD 5GAOl 1YIJA 4C92D 4RUGA 3CCRT 1S1NA 5LJ3g 5FRMA 2E6NA 2BZXA 2V8KA 3JV3A 2HEQA 1OEBA 1I1JA 1YCYA 4DEYA 4J6YA 4M78B 2RH2A 2P84A 3EAEA 4Y92A 3OSSC 4OMFB 1RI9A 4IUUA 1Q82C 4A63B 3Q1JA 4QT7A 3FDRA 1K73C 1SSHA 1YJ9T 1K8AR 3R6OA 3CCJT 4JZ4A 1CSKA 3NTIA 2RHZA 1VA7A 4M77A 5CKBA 3JB9G 5CKFA 1YJWQ 1VQ6Q 2BIVA 3F70A 4PJOA 4E7LA 4C5IA 1WNLA 1G5VA 2QQAA 4ELZC 5J3BA 4IUVA 3INZA 5FWCA 2COYA 2GTOA 3V8KA 2Y4XA 3JB9D 2OTJA 5GAOq 4QVDA 3G6EA 1TUDA 1EX4A 1GBQA 1T0JA 5CCAA 4Y91A 3CCET 2V8JA 2L8DA 3EGDB 4IURA 2CT3A 2ESWA 1AHJB 1VQNT 1HD3A 3UPUA 3QSUA 3HFOA 2GBQA 3EHRA 3JCMW 5FU6C 5J39A 1U3OA 1NLPC 4X34A 3RBBB 4M77G 2XDDA 1RL2A 2RNAA 2HDAA 2RHUA 4A4GA 2DXBA 1LNXA 3NGPA 4EPCA 3E2UA 4IUTA 3OMGA 2A08A 3OS1A 1U1TA 3G6ET 4BD3A 1YP5A 4J83A 5GMKm 1AEYA 4A53A 5KYWB 1VQ7T 3M5AA 2XIDA 2NWMA 1T3LA 5I2SA 3H0IA 1EZZB 4LDVA 2J6OA 4FW1A 5IHKA 1XTDA 4PFOA 5GMKi 4JJNK 1RAFB 2YRVA 5ECAA 1ZX6A 4DBHA 1GCPA 5GAOp 1FYNA 3O5ZA 3ZL7C 2HBWA 2GQVA 4N4HA 5GJVB 3EGXA 3CMAT 1UGSB 2A3LA 1ZLMA 4OGEA 4XTUA 4PJOG 1D09B 4C92F 3HKSA 2IIMA 3A1PA 2OTLQ 2PTKA 2BE9B 1NYFA 5KCOA 4VUBA 3OYHA 2HQXA 1LPLA 2L5QA 3VS3A 5EC7A 1SRLA 2D0NA 5GAMf 3UA6A 3SFMA 2QEXQ 3I5RA 1PKSA 3VYGA 4OB0B 4BI4A 1N9SA 2CGHA 1KQSP 4DOVA 4A4HA 1ABOA 4R55A 3CMAA 2OAUA 4OB1B 3EH1A 3LW5E 5CKHA 2HNIA 2DX1A 4ZGEB 5GANe 2GNCA 5GMKh 5I21A 3GNGA 1R77A 5GAMh 4C8QA 2ZPBB 3GBQA 1YJNA 3HSBA 3M4GA 1NZ9A 4ZNXA 3CCJA 1W6XA 1MV0B 2K2VA 2XG8D 1ABQA 4IIMA 2CSIA 4M78F 2QQBA 3JB9J 4OB2B 1RAHB 3A98A 2MWPA 3ER0A 4O6JA 4Q5WA 1JJ2A 1MV3A 3C95A 1X2KA 4OMLA 1YWPA 1WFWA 2FEIA 2KROA 1G2BA 1WYXA 1NE8A 1JQQA 1WHGA 2GQIA 3OYCA 2MF2A 3CCRA 2HQHA 5FU7C 2IVWA 1UGVA 3CCLA 5I11A 2FRYA 2O4XB 3SD4A 5GAOn 1AWJA 2ENMA 2CP0A 3HRTA 4M7DF 1OI1A 1AD5A 3OB9A 3NMZC 8AT1B 1MMDA 3GOXA 4M77D 5IAYA 2VC8A 3RKXA 3CCQQ 1GL5A 2RB6A 5KCHA 1H8KA 2EKHA 1UDLA 1M1KU 1BKBA 1WZOA 4JUVA 3CCJQ 3LWHA 2YXYA 1VIFA 1YJNQ 4C92B 4RTWA 1BIBA 1KSWA 1JXOA 3CC7Q 1X6GA 2FYKA 2LJ1A 2SRCA 4KGXB 3QJYA 1VUBA 1GBRA 4MZMA 2KE9A 4C8QG 2B8AA 1MMAA 4BY6B 5CK9A 4XU1A 2QG9B 1NM7A 3T9NA 3BDUA 3G7ZA 1YWOA 3A8GB 3JCMc 3GLXA 3PGGA 3HFNA 3UATA 2DM1A 2FB7A 3OYJA 4ZTJA 1NJIC 5A0DA 3V7RA 3DB4A 2X51A 1FMVA 1JB0E 1HJDA 3SWNA 5GAMe 3JAME 1D3BA 2JS2A 4RTYA 1WXBA 3LX7A 3EHQA 2OTLA 1VOMA 1OPKA 2A7YA 1I5OB 2V26A 3PT9A 4BE0A 3S3MA 2AZSA 3G71Q 4PLLA 2DEUA 1TWBA 3I35A 1BI2A 2O9SA 1M27C 3M0RA 4AMCA 1YITA 4C0DB 3E9GA 3EFRA 4M78D 2LTOA 4Y28E 4BI8B 4FU6A 3PMTA 3A8MB 4HCKA 4PJMA 1UTIA 5FROA 1J3TA 4L5GA 1YJWT 3QPHA 3H9NA 1VQ6T 1OYXA 2VGMA 2KDSA 3CCLT 2AK5A 2ROLA 2COZA 2HKQB 2V1QA 2F5KA 1OPLA 2V1RA 1VYUA 1JBMA 2RHYA 3L2QA 1TOVA 2NUTA 4NL3A 2VYTA 4OF1A 4ME7A 1VQLA 2DJQA 4FCYA 4X9CA 1E7OA 4M77F 3SWNB 1MNDA 1OULA 4PFPA 1W70A 2LT4A 3HPWA 3VKIA 2FPFA 4M78G 4CC3A 1GFDA 2ZGWA 1PD1A 4C8QC 2QTXA 2K5IA 1ARKA 2OAWA 1AWOA 3NTHA 1QWFA 2C0OA 1C0MA 1ZA1B 2K2MA 1SHFA 3CXCA 1QMCA 5IXFA 4O5VA 2PZ1A 2K7AA 3KBGA 1B34B 1BI3A 1TU0B 3X24B 1Q7YC 1NLOC 4M7AC 2FZGB 2X4JA 1XJWB 2C06A 2FRWA 1OX9A 3QDFA 1WHKA 4QQDA 2K4YA 1M1FA 4HA8A 2RQWA 2MMPA 4N0AC 2HSEB 5KYUA 3P8DA 1LOJA 2XICA 2NUPB 4EMKA 4ZGDB 5LJ3j 3GP8A 4MMLA 5GAMj 1VQMT 2JJ9A 2EGCA 1B7TA 5GMKj 3ZBDA 2KSSA 1K0XA 2JXBA 3NPFA 1PG5B 5GAMd 1SRMA 1VQKA 1UHCA 4XU3A 1WJRA 4AFUC 2ZCFB 3I55T 1Y71A 4D8DA 4PKCC 3PIPA 5A2QE 3PVLA 3QYHB 1VQPT 2CP3A 5LJ5e 4P5NA 1VQ5A 3M57A 3MEWA 3HHTB 2QYZA 2Y4YA 3CPFA 2LJ3A 3TSWA 1QCNA 2JMCA 2MI6A 4IUQA 4LD6A 5LJ5h 5GANh 2J06A 1VQ5T 3JCMh 2YHTA 3VJPA 2XKOC 3CCSA 3RMQA 2E3IA 1VQMQ 1I0CA 1R0CB 3I55A 3VUZA 4PJOE 3JCMX 1N5ZA 4XTXA 2YLBA 2DERA 2DVEA 2X3XD 4EMHA 1KJWA 5CKDA 1ZQ1A 4KUIA 2RK2A 1VQOA 4J9BA 4PNOA 2LQWA 4LDWA 4RTTA 4F14A 2DLPA 3JCMJ 5KYUB 2YT6A 4JS5A 4FT4A 1MHNA 1TUCA 3H0FA 3OA6A 3OYAA 5D6WA 4R0KA 2W10A 4FYWB 2EPDA 2X4WA 4LN2A 2CREA 2ZPIB 3PTAA 4PJOC 4LD9K 1U06A 5CR2A 1XOVA 1QW1A 1W2BA 3L1AA 3H8ZA 3M0PA 2NUZA 2J6FA 4AG2C 1ACMB 1PNJA 3EGXB 1WJQA 4BB7A 1BIAA 3CCQT 3GNFB 2ED1A 3V7CA 5LJ5j 3A5ZB 4FSXA 1YBYA 1W4SA 2DVJA 3VS0A 1XNIA 5LJ5g 3M59A 2QDLA 1Q81R 1RI0A 3M58A 3LH5A 5FRNA 5I2MA 2QGFB 3EFOB 4J6XA 2JTFA 1K8AC 3V7SA 3CQTA 1YI2A 1Y7XA 5GMKe 2EGEA 2JTMA 3SDZA 2QAZA 2ZAEA 1B3QA 2LCLA 4RTVA 4M7AF 1D1BA 2AZVA 1BU1A 1GXIE 2HKNA 4B9XA 2LDMA 1I81A 4B9WA 1YJ9A 2EQUA 4LNPA 3DLMA 1YITT 1WX6A 1X2QA 4PFZA 4B6MA 2KT8A 3CC4T 2A0FB 2MAMA 4FYXB 2VUBA 1SEMA 1CKBA 3SHWA 2H3EB 2FO0A 4BUGA 2K5FA 4DQ2A 5GANd 5KYNA 3EG0A 3QHSA 3J81E 3G4SQ 3CC2T 1SSFA 2DFUA 5GAN2 4DBFA 5CVIA 2CP2A 2L0AA 2PVOB 4XTYA 1IXDA 2E6ZA 5GANj 1E6GA 5M9OA 4D6WA 3TEEA 3H6ZA 3LYIA 3VS1A 1VIEA 2EQKA 3A8HB 2I2LA 2PUOB 2DTIA 3OS2A 1UHFA 2EIFA 2M9UA 4PJLA 3VS4A 2OX7A 2MWOA 3SEMA 3LGFA 1ZHIA 1M1KR 4PL6A 1Q81C 5IN1A 3UF4A 5L23A 4WCIA 2LMJA 3C12A 1VQ5Q 3FIFA 4BE2A 1Q82R 1BI0A 4NL2A 3CPWS 3CD6Q 5LJ5d 1G3WA 3OYFA 3EG2A 5IHIA 4C0ZA 4PJOD 2F2XA 4FYVB 4MMKA 1R0BG 3MHXA 1RABB 2D0QB 2RQUA 3JCMV 1NG2A 2O4XA 4FL6A 3SB2A 1UGQB 2OI3A 2LQ8A 2DIQA 2RJEA 3JCMb 1CKAA 3J80E 5GANg 2LX7A 4JPBW 1I4K1 5I22A 4KH0B 1V76A 5LJ5f 1IZ6A 4XTWA 1TH7A 2K3BA 4OGCA 2VXEA 4OMPA 1X75C 2O31A 1ZSGA 2DIGA 3MEVA 4LDUA 4M75C 2EJFA 1FX7A 1Q86R 1KQSS 2XD0A 4L59A 2MK5A 2KQWA 4XQ3A 2KYMA 2RA2A 5HY6A 4PLIA 1M8VA 3ZEHA 1VQ9A 4RKUE 4XU0A 2BKDN 4EDUA 2E64A 4JS4A 3FJ5A 4HT9A 3OYBA 1Q95G 5FLXE 4M7AA 2M16A 1KD1U 4ZGJB 3DLLA 2CUBA 2PU9B 2DL4A 4AG1C 4HKEA 1MMNA 1H3ZA 3JCMQ 2L3QA 1RLQC 1K8AU 4PJJA 4FT2A 5EG2A 3THKA 2ATCB 2JW4A 3U23A 3L2WA 1Q7YU 4L6V5 2CP5A 4XK8E 4KH1B 2K3YA 2JUFA 3RKWA 3OYMA 1E6HA 2ZPEB 2EGAA 2YRCA 3MP8A 1S72A 1ZBXA 1UG1A 1C1AA 2CZ0B 4IIOA 2M0YA 1OX8A 1MNEA 1UB4A 2CP7A 1F1BB 4KT0E 3SWNC 5KYXB 2A37A 1VQ4A 5HK0A 4CI0C 5IH2A 2GFAA 2MIOA 4C0FA 3G71T 4ATOA 4LUEA 2EJ9A 3D7SB 2HL5C 4E2FB 3QG1A 2O88A 2D8JA 3QWXX 1D0ZA 2F1LA 2DJZA 3P8HA 2QA4Q 5DM7R 3TREA 4C8QE 1V1CA 2DAQA 3M4YA 2EYQA 3EH2A 2EJGA 1WHLA 2DBMA 2BTTA 2OTJQ 1NEBA 3I5SA 5KYWA 3CC2Q 2KBTA 4C8QD 2FHDA 2E5QA 5GAOr 2EQIA 1WIEA 2DILA 1AVZC 1QP3A 1ZUKA 1YI2Q 2KYBA 2WSFE 1JU5C 3FRNA 5KH6A 4OMOA 3A8OB 4FM4B 1QCFA 1O9SA 4M7AG 1LCKA 4C8QF 3DB3A 2YRDA 1DJ7B 1VQ8A 3L2ZA 2A28A 2AHJB 2LNVA 2K57A 3S6WA 4M7DA 3X25B 3CCMT 1ZBJA 2JOYA 3C0CA 2VASA 3EFSA 2LRQA 4LDXA 2M0OA 4BACA 2MCNA 3CMEQ 4HVVA 3TSZA 4JDSA 4QQGA 5CIUA 5J26A 1YJ9Q 2RHIA 1NEGA 2E10A 1M1KC 2PVDB 1PD0A 4KGVB 1Z9ZA 2EYYA 3M0QA 3CCST 4A4FA 2JMAA 2KY9A 2I0NA 3QXEB 2EQJA 2EWNA 1S72Q 3P8BB 2JM8A 1ZSZB 2LCCA 4RG8A 3CCUT 1QVFA 1QP2A 4HXJA 1Q7YR 2O2OA 1MUZA 4MZTA 1M2VA 4OVAA 5AYFA 3CXCP 3MJXA 2YSQA 1KHCA 1VQ7A 4C92E 1QVFP 2R5MA 1HXDA 3QO3A 3GF5A 3M9QA 2EBPA 2GGRA 1K4US 4ESRA 1FWZA 1N9RA 1YFNA 2CP6A 6AT1B 2AKLA 2VKNA 2VV5A 2EW3A 2DL3A 2LQNA 3RNJA 3I55Q 4RCCA 4DEXA 2EYXA 1NJIR 2VB6A 2JT4A 1M8MA 4FYYB 1VQMA 3CCSQ 2QQ9A 2J05A 2NLUA 5CKEA 3CCLQ 2QGGA 3KFVA 2ZPGB 3BFMA 3QWYA 5C6SA 1Q86C 1FXXA 2E41A 1PC0A 2MYSA 3VYHB 4BI3A 4JRKA 4TVRA 1WXUA 2DD5A 1QVGA 4C5GA 1EIFA 1M3BA 1UJ0A 1UE9A 1KD1R 2DEQA 5GAN5 4HCCA 4RCBA 2FL7A 4RTZA 5GAN4 4M77C 5D7UA 2XDBA 2R58A 1RADB 4M77E 1VQKQ 4QQ6A 4QVCA 3RMSA 1KIKA 3CMEA 1I5LA 4A4KA 3JCMg 4DBQA 1UGRB 4DA4A 4F04B 3M0TA 1C6VX 1YHQT 1QVPA 5KYYA 1FMKA 3M55A 1X6OA 1HYOA 1QVGS 1VQLT 1Y57A 2K9GA 2RI5A 2K79A 2PVGB 1K0SA 4M75A 4J9CA 2NUTB 2FVUA 5KE2A 1RLPC 2RQRA 1PKTA 1M90C 2F5TX 1MGQA 2J6KA 2D8HA 2C0TA 4F7UG 2QQRA 5GMKl 5DLOA 4E7JA 3CC2A 3OYKA 4M78C 2HCKA 1WI7A 4N4IA 3M56A 1BK2A 4FIBA 4LDYA 1KG1A 4EMKB 1SPKA 3H0HA 2JTEA 2PNIA 2DO3A 2YWWA 3DKMA 1YHQQ 1WGSA 2XI9A 1OQKA 1OZ3A 1UEBA 1OU9A 1VQLQ 1ZUUA 5CQXA 5LJ3e 2DRKA 3L2RA 4M7DG 3JCMe 3CPWA 2E5KA 1QQJA 3OW2S 1WQ7A 4V2SA 1JO8A 3VV0A 2P4RA 1BBZA 1QKWA 3OYNA 3OS0A 5HCKA 4Z8AA 3RDVA 4HVUA 2DXTA 3FLGA 1BCOA 2ROTA 3L2UA 5FU6B 1M2VB 1IO6A 1NYGA 1YITQ 3QYGB 1PCXA 1WHHA 1YJNT 2QASA 4IUPA 3G6EQ 2E1HA 3X20B 4F17A 3E1SA 4MZPA 2DL5A 4D8KA 5FWBA 1Q82U 1Q86U 2QA4T 1WDXA 1K73R 3MKDA 3RUXA 2GFUA 1FMWA 4ZTFA 3VRYA 1Z9QA 4BDZA 2DKGA 2KAFA 1IRXA 1M1GA 2KEAA 1TUGB 3BDLA 2BZ8A 1M4ZA 3LLRA 4J9EA 4XTVA 2FZKB 2YUNA 1WHMA 4ELYC 1ZA2B 1RACB 3CCMA 3REBB 4OMMA 2BE7D 1HK9A 5LJ3d 1M2OA 2QK0A 2DK3A 1VQOT 1AT1B 4LXCA 1BB9A 4NS5A 4PJOF 4YTLA 2DXCA 3OBYA 2ECZA 4J6WA 1VQ8Q 3FC3A 3CCVT 2RI3A 1K9AA 4BDYA 2FG0A 5LJ3h 5A0GA 1UECA 2DZ9A 2HL3A 4A4EA 5LJ3f 4QKUA 1WHJA 1Y07A 1VQPQ 2E65A 3FEOA 3UDCA 4C8QB 2KMTA 3O8VA 3I56Q 2FPEA 1QVGP 5HK3A 2F2WA 4EIKA 2RJCA 3URGA 2E3HA 4KGZB 1PSEA 2EVRA 2RJDA 4C0GA 5D6YA 1QKXA 4AFQC 2P0KA 4J8OA 1NPRA 5GANf 1N8RR 4PJNA 3QIIA 4R56A 4F16A 5CAIA 2RQTA 5GAN7 2QDYB 3S3NA 1WPYA 1KQ1A 2R5AA 4JJDA 1X69A 4JRIA 1VQ8T 1ZUYA 2IG0A 3MP1A 4UC4A 2JN0A 3PE0A 2CSQA 4F7UF 3NFCA 2RHXA 4C5EA 4DOWA 4Z88A 2EKOA 2P0PA 9ATCB 2X4XA 1X43A 4N0AA 2HMAA 1AOJA 1HSQA 3BY7A 2CZ1B 3CCUA 3KXTA 1M5Q1 3CMAQ 2VWFA 1M90U 1RAGB 1RUWA 3CCVA 3S3OA 1Y96A 1M3CA 1OU8A 1ZSZA 3CCRQ 1VQ9T 2EQMA 1YCSB 4J7IA 2XK0A 2HD0A 3M0SA 3ZFJA 4C92G 3CD6A 4RTUA 2EYZA 2JS0A 4M78E 1K9MR 2FZCB 3N5BB 3JCMd 3I9QA 2XDPA 4J5YA 3PIOA 1VQNA 1PWTA 3GPLA 2C0IA 3CCEA 4BY6C 3R6NA 4F7UB 3CPWP 2CUDA 1AZGB 2PQWA 4IKFA 2RK1A 2AKKA 2OTJT 1K9MU 3PFSA 1TSFA 2LT1A 1M9SA 1JRIA 2J7IA 2RN8A 5DLQE 4M7DE 1BI1A 2IPOB 4RTXA 3GIBA 1K73U 3G1JA 3EG3A 1JXMA 3TVTA 4JLGA 3BE3A 2EFIA 2RQVA 2DRMA 5CQYA 4GY5A 2QA4A 3UA7A 4PJOB 3NHNA 1EFNA 4JJBA 2OJ2A 4X1VA 1V29B 2SEMA 4AFZC 4CC7A 3CBPA 1UUEA 3X28B
chains in the Genus database with same CATH topology
4EMKA 3CC7T 2ZZDA 3CXCS 2QEXT 3G71A 2KY9A 4ZGDB 3M54A 5LJ3j 3GP8A 1IREB 3QXEB 3OYLA 5GAOm 2LQKA 1PSFA 2EQJA 4MMLA 2EWNA 5GAMj 5GAN8 3P8BB 1G3SA 3HRSA 1VQMT 1KC8U 1JJ2S 2P4TA 4JLIA 4KBMB 2LCCA 4KULA 4RG8A 5GMKj 3CCUT 1QVFA 1QP2A 3FJPA 2D6FA 4C92A 2K3XA 3ZBDA 2KSSA 3MCAB 5D6XA 4MZTA 3OYGA 3I56A 4OVAA 5GAMd 3MEAA 5AYFA 1S72T 1VQKA 2K5LA 2RD1A 3BW1A 4XU3A 1KHCA 1VQ7A 4M7DB 2M1HA 4C92E 1WJRA 2R5MA 5KE3A 1HXDA 1N6AA 3QO3A 2ZCFB 2BUDA 2GCXA 3I55T 4M75G 1Y71A 3PIPA 4PKCC 3GF5A 3M9QA 1I8FA 4XTZA 4M7AE 1W2BS 2G3RA 3ASKA 3OS5A 2DD4A 3QZ9B 5A2QE 3OMCA 3A8LB 3I56T 3QYHB 1VQPT 1FWZA 1N9RA 4WF2A 3JCMP 3CC4A 5LJ5e 3JRZA 2VV5A 5GAOl 4P5NA 1YIJA 4C92D 3CCRT 1VQ5A 3M57A 3LGLA 3UT1A 5LJ3g 4RCCA 3MEWA 5FRMA 4ZN3A 3HHTB 2E6NA 4F7UA 1VQMA 2V8KA 3HL8A 2Y4YA 3CPFA 2OTLT 4M7AD 1U1SA 2LC4A 2QQ9A 5GAN6 2NLUA 5CKEA 1YCYA 3HRUA 2MI6A 4IUQA 4LD6A 5LJ5h 5GANh 4J6YA 3JCMh 1VQ5T 2YHTA 4M78B 3CC7A 2RH2A 2ZPGB 3VJPA 3BFMA 2XKOC 5C6SA 1Q86C 3EAEA 4JS4A 4GLKA 3OSSC 3CCSA 1N8RC 4NOYA 1FXXA 2E41A 2JVVA 4IUUA 4OMFB 1Q82C 3RMQA 3VYHB 4E47A 3Q1JA 1K73C 3FDRA 3E9FA 4BI3A 4JRKA 3I55A 3VUZA 4M7DC 1YJ9T 4TVRA 4PJOE 3JCMX 5GAN3 2DD5A 3R6OA 2JZ2A 3CCJT 4C5GA 4XTXA 1EIFA 1QVGA 2YLBA 4QVZA 2DVEA 2RHZA 3NTIA 4M77A 5CKBA 4EMHA 4OB3B 5CKFA 5CKDA 4JRQA 3C4SA 2BIVA 1ZQ1A 3F70A 2DEQA 4KUIA 5GAN5 2RK2A 2DTHA 1VQOA 3MO8A 4RCBA 4HCCA 4PJOA 2FL7A 4E7LA 4C5IA 1WNLA 4PNOA 1Y96B 4RMOA 2QQAA 4ELZC 5GAN4 1G5VA 4LDWA 4M77C 4IUVA 5J3BA 3INZA 1Q81U 1YHQA 2XDBA 2R58A 3JCMJ 2VGNA 4M77E 4JS5A 4A4FA 4FT4A 3V8KA 4F7UE 4QQ6A 1MHNA 2Y4XA 2ZPHB 4QVCA 3OA6A 3JB9D 3RMSA 3OYAA 2OTJA 5D6WA 3CMEA 5GAOq 1I5LA 4QVDA 4A4KA 2X4WA 3JCMg 1UGRB 2DTOA 2ZPIB 3PNWC 3G6EA 4DA4A 5CCAA 3OBWA 1YHQT 4Y91A 3CCET 2V8JA 1QVPA 3PTAA 2L8DA 3X28B 3JB9I 4PJOC 3M55A 1X6OA 2L89A 1QVGS 1VQLT 4IURA 4LD9K 1AHJB 4EMKC 3CMET 5CR2A 1VQNT 1XOVA 1QW1A 1W2BA 3UPUA 3L1AA 3QSUA 2RI5A 3H8ZA 5IT9E 3HFOA 3L42A 3JCMW 5HKCA 2PVGB 5FU6C 5J39A 4M75A 4X34A 4M77G 2XDDA 1RL2A 3G4ST 2WSEE 2FVUA 2D9TA 2RHUA 5KE2A 4A4GA 4BB7A 1WJQA 2DXBA 1LNXA 1M90C 1BIAA 2LX9A 4M75E 4C0DC 4EPCA 4J7FA 4HCBA 4IUTA 3OMGA 3GNFB 3CCQT 2F5TX 1MGQA 3V7CA 3OS1A 1U1TA 3OYYA 5LJ5j 3A5ZB 3G6ET 4FSXA 2O01E 1YBYA 3WXMB 2QQRA 4BD3A 4F7UG 5GMKl 5DLOA 1W4SA 3QBYA 4E7JA 3CC2A 4J83A 3OYKA 5GMKm 4A53A 1XNIA 4OP0A 3M59A 3X26B 5LJ5g 1VQ7T 3M5AA 2XIDA 2RJFA 4M78C 5I2SA 4M75D 1RI0A 4LDVA 3C94A 4N4IA 3M58A 4M7DD 3M56A 5FRNA 1XTDA 4FIBA 5I2MA 4LDYA 4J6XA 1KG1A 2EAYA 2JTFA 4EMKB 3V7SA 5GMKi 1K8AC 4JJNK 2YRVA 1YI2A 3OYEA 3META 3VU3C 1Y7XA 4JRPA 2DO3A 2F69A 2WSCE 5GMKe 3DKMA 5GAOp 1WGSA 2XI9A 1KD1C 1OZ3A 2JTMA 3SDZA 1UEBA 2GQVA 4N4HA 3CMAT 1UGSB 2A3LA 2LCLA 4OGEA 5CQXA 4XTUA 4PJOG 4RG2A 5LJ3e 3CCQA 4M7AF 3L2RA 4MDXA 3CD6T 4C92F 3HKSA 3QUIA 4M7DG 3JCMe 3CPWA 3OW2S 5KCOA 1GXIE 1WQ7A 3CBOA 4V2SA 4VUBA 4B9XA 3OYHA 3VV0A 2HQXA 2LDMA 4E7IA 4XAXB 2L5QA 5GAMf 1KHIA 3TCJA 1I81A 4B9WA 1YJ9A 3SFMA 3OYNA 2EQUA 3DLMA 1YITT 2CZ7B 3OS0A 3VYGA 1KQ2A 3TU4K 2X4YA 4OB0B 3CC4T 2MAMA 4BI4A 1VQPA 1N9SA 2DXTA 3FLGA 2CGHA 3OSVA 2VUBA 4DOVA 4A4HA 4BUGA 3L2UA 2K5FA 5FU6B 2GF7A 4DQ2A 4R55A 2OAUA 3CMAA 5GANd 4OB1B 3QHSA 3J81E 3CC2T 1SSFA 3LW5E 5GAN2 5CKHA 2HNIA 3QYGB 5CVIA 4ZGEB 3J7AF 1NPPA 2CKKA 1YJNT 2PVOB 1YI2T 4XTYA 4IUPA 5GANe 2E6ZA 2E1HA 5GANj 5GMKh 1X01A 3X20B 4D6WA 5M9OA 3TEEA 3H6ZA 3LYIA 3RESA 3GNGA 5I21A 3E1SA 4MZPA 5GAMh 1Q82U 1VIEA 3VUBA 2EQKA 2ZPBB 3V8LA 4C8QA 2WACA 3A8HB 2I2LA 1Q86U 4E7HA 2PUOB 2RI2A 3JB9F 1YJNA 3HSBA 2QA4T 3M4GA 1NZ9A 2DTIA 3OS2A 3CCJA 2K2VA 2EIFA 2XG8D 4E7KA 3RUXA 2M9UA 2GFUA 4X9DA 2MWOA 3LGFA 1ZHIA 4PL6A 4ZTFA 1Q81C 2Y90A 4BDZA 2DKGA 4M77B 2KAFA 4M78F 5IN1A 2QQBA 3JB9J 4OB2B 1M1GA 2MWPA 1R8OB 3QKJA 3ER0A 4O6JA 3C12A 3QDRB 4Q5WA 1JJ2A 3BDLA 3FIFA 3C95A 5C0MA 4BE2A 3JCMf 1M4ZA 4MDWA 3LLRA 2DPPB 4XTVA 1NE8A 1BI0A 4ELYC 4NL2A 3CPWS 3OYCA 1UGPB 4M78A 2MF2A 3UWNA 5LJ5d 1G3WA 3OYFA 3CCRA 4C0ZA 4PJOD 3CCMA 5FU7C 1HK9A 2IVWA 5LJ3d 4MMKA 3CCLA 3LH0A 4BE1A 2O4XB 3SD4A 5GAOn 2DK3A 5CO7A 3MHXA 1VQOT 3HRTA 3AHUA 2D0QB 4M7DF 1OI1A 3JCMV 3OB9A 2O4XA 4FL6A 4NS5A 4PJOF 4YTLA 2DXCA 3OBYA 3SB2A 1UGQB 4J6WA 3GOXA 2L3RA 3FC3A 4M77D 2LQ8A 4C92C 3FB9A 3CCVT 2DIQA 2RJEA 2VC8A 5IAYA 3JCMb 1VQ4T 2RI3A 3RKXA 4BDYA 3J80E 5GANg 3JSCA 2RB6A 1I4K1 5LJ3h 5A0GA 5KCHA 5LJ5f 1IZ6A 2DZ9A 4XTWA 1TH7A 4OGCA 2VXEA 2RM4A 1M1KU 1BKBA 5LJ3f 4A4EA 4JUVA 3LWHA 1Y07A 2E65A 1VIFA 1X75C 2DIGA 3FEOA 3MEVA 3UDCA 4C8QB 2KMTA 3O8VA 4C92B 4LDUA 4M75C 1BIBA 2EJFA 1FX7A 2FYKA 2PUKB 5HK3A 3V8JA 1KQSS 2XD0A 4L59A 3QJYA 2RJCA 1VUBA 2XU8A 3HP9A 5FU7B 3URGA 2KQWA 4XQ3A 2RA2A 5HY6A 1PSEA 4MZMA 4C8QG 1KC8C 2B8AA 2RJDA 3L2VA 4C0GA 4PLIA 5D6YA 1M8VA 4II1A 2P0KA 4BY6B 4XU1A 3ZEHA 5CK9A 3E19A 4J8OA 1VQ9A 3G4SA 3T9NA 3BDUA 3OY9A 1NPRA 5GANf 3G7ZA 3A8GB 2QI2A 4RKUE 4XU0A 2BKDN 3JCMc 2E64A 3GLXA 3QIIA 3RKYA 4EDUA 5CAIA 5GAMg 5GAN7 4R56A 2QDYB 3OYBA 4HT9A 3S3NA 3PGGA 1KQSA 5FLXE 2HBPA 1WPYA 3JB9H 2M16A 3HFNA 4M7AA 1KD1U 4ZGJB 1KQ1A 2CS7A 2FB7A 2R5AA 3OYJA 3DLLA 4ZTJA 2PU9B 4JRIA 4HCZA 1NJIC 5A0DA 2KVQG 4HKEA 1VQ8T 1H3ZA 3MP1A 2CYZB 2IG0A 3DB4A 3V7RA 4EMGA 3JCMQ 1JB0E 1D3BB 4UC4A 1K8AU 4FT2A 2JN0A 5EG2A 3L2WA 3SWNA 5GAMe 3JAME 1Q7YU 4L6V5 2QQSA 1G3YA 1D3BA 1O75A 4XK8E 4F7UF 2K3YA 3LX7A 2RHXA 3NFCA 4C5EA 3PMIA 2JUFA 3RKWA 4DOWA 3OYMA 2QEXA 2OTLA 2EKOA 2P0PA 2ZPEB 2DZCA 2A7YA 3MP8A 2X4XA 1ZBXA 1S72A 1VQKT 3PT9A 4BE0A 4N0AA 3MEUA 3S3MA 2X35A 3BY7A 2CZ0B 4PLLA 2CZ1B 1BI2A 4QW2A 3CCUA 2DXUA 3KXTA 1UB4A 1M5Q1 1YITA 1M90U 1K9MC 4C0DB 4KT0E 3E9GA 3SWNC 1VQ4A 3CCVA 3EFRA 5HK0A 4M78D 1WJSA 4CI0C 3S3OA 1Y96A 1U8RA 2GFAA 2ZPFB 4KUDK 2LTOA 4Y28E 4ZN1A 4C0FA 3G71T 4ATOA 2EJ9A 4FU6A 4BI8B 3PMTA 1YIJT 2RO0A 3A8MB 2EQMA 3QG1A 1VQ9T 4J7IA 2XK0A 2HD0A 3QJ6A 5FROA 4L5GA 3ZFJA 1YJWA 1YJWT 3QPHA 1VQ6T 1VQ6A 2DJZA 3P8HA 4M75F 4C92G 5DM7R 1OYXA 2VGMA 2KDSA 3CCLT 3CD6A 3TREA 4C8QE 4A54A 2DAQA 4M78E 5DY9A 3WVDB 3M4YA 2EYQA 2EJGA 2F5KA 2E12A 3N5BB 3JCMd 1JBMA 5A0LA 3KUFA 2XDPA 1G3TA 2RHYA 4J5YA 3PIOA 1VQNA 2KK4A 3L2QA 3CEYA 3GPLA 4NL3A 2QXFA 4C5HA 2VYTA 3JB9G 4OF1A 3QZ5B 4C8QD 1B34A 3CCEA 2FHDA 4ME7A 2E5QA 4Z02A 4BY6C 1VQLA 4F7UB 3RERA 1OZ2A 3OQ5A 5GAOr 2P0QA 1N27A 4X9CA 2PQWA 3LWIA 1QP3A 2RK1A 4M77F 2LT4A 1P92A 3SWNB 4IKFA 3VKIA 2OTJT 2WSFE 3HPWA 3NTKA 4HT8A 3FRNA 1WQWA 5L8RE 1XQHA 3PFSA 5KH6A 1K9MU 2XHCA 2LT1A 1M9SA 3A8OB 4FM4B 4M78G 1JRIA 1LJOA 5DLQE 1O9SA 3WVEB 2ZGWA 4M7AG 3CBMA 4XU2A 3MP6A 4C8QF 1QVFS 4M7DE 3DB3A 4C8QC 1BI1A 2QTXA 3ME9A 1DJ7B 2K5IA 3M53A 4M75B 4M7AB 3L2ZA 1VQ8A 2HAXA 3NTHA 2AHJB 3GIBA 2JNGA 2LNVA 3OYDA 3OW2A 2CZ6B 1K73U 2K57A 3S6WA 4M7DA 3X25B 2HQEA 4JLGA 3CCMT 3CXCA 1N8RU 2EFIA 2JOYA 4O5VA 2H3JA 5LL6S 3EFSA 3KBGA 2LRQA 4N4GA 1B34B 1BI3A 2M0OA 5CQYA 3X24B 4GY5A 1Q7YC 2QA4A 4LDXA 2VXFA 4M7AC 4BACA 2V8IA 1H641 2X4JA 4JDSA 4QQGA 5CIUA 5J26A 2C06A 4PJOB 1NJIU 2RHIA 2LVMA 4CRIA 2E10A 4QQDA 2YLCA 1M1KC 2K4YA 1M1FA 2PVDB 1V29B 4HA8A 2MMPA 2R57A 4N0AC 3CCST 3P8DA 2E70A 1BYMA 1LOJA 3CBPA 2XICA 3OYIA 3RIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A7Y A; 
#chains in the Genus database with same CATH topology
 3CXC S;  3G71 A;  3M54 A;  4LUD A;  4E7S A;  2AIR B;  5GAO m;  4CC4 B;  2YUP A;  2Z0W A;  1KC8 U;  3HRS A;  2P4T A;  4JLI A;  4KBM B;  2LCS A;  4KUL A;  4KRT A;  2COW A;  4C92 A;  5KYX A;  3MCA B;  5GJW B;  3MEA A;  1S72 T;  2K5L A;  3BW1 A;  2DL8 A;  1GCQ A;  1ZSZ C;  2JM9 A;  1NBE B;  1SHG A;  3VRZ A;  4M7A E;  1W2B S;  3I56 T;  3QZ9 B;  3OMC A;  4WF2 A;  3CC4 A;  1WLP B;  3LGL A;  2VVK A;  3UT1 A;  4ZN3 A;  3TQ7 P;  1IGU A;  4F7U A;  4AFS C;  3HL8 A;  2OTL T;  4M7A D;  1U1S A;  2LC4 A;  5GAN 6;  3HRU A;  1W2B P;  3CC7 A;  2M51 A;  4GBQ A;  4GLK A;  1N8R C;  4J9I A;  4NOY A;  2JVV A;  4E47 A;  1BCM A;  4GLM A;  1AWW A;  3E9F A;  4M7D C;  1YIJ Q;  3EFO A;  5GAN 3;  2JZ2 A;  4J9H A;  4QVZ A;  2KXC A;  4JRQ A;  4OB3 B;  3C4S A;  1G83 A;  2DTH A;  5FW9 A;  3MO8 A;  1IHW A;  1PRL C;  2DNU A;  2KI7 A;  1Y96 B;  4RMO A;  1Q81 U;  1YHQ A;  2VGN A;  2O9V A;  2W0Z A;  4F7U E;  2ZPH B;  2QTV A;  2DL7 A;  3PVQ A;  1VQN Q;  1AWX A;  1G8X A;  2DTO A;  3PNW C;  2DBK A;  1H3H A;  3OBW A;  2HSP A;  3JB9 I;  2L89 A;  4EMK C;  3CME T;  2B86 A;  4OMQ A;  1D1A A;  5IT9 E;  3L42 A;  5HKC A;  2DF6 A;  4J9D A;  3G4S T;  2WSE E;  1M30 A;  2CDT A;  2D9T A;  7AT1 B;  1OOT A;  3CCV Q;  2LX9 A;  4M75 E;  4C0D C;  4HCB A;  4J7F A;  3OYY A;  1D0Y A;  2O01 E;  3WXM B;  1GCQ C;  3QBY A;  1RAE B;  1KC8 R;  1K76 A;  4OP0 A;  3X26 B;  1QLY A;  2RJF A;  2XMF A;  4M75 D;  3C94 A;  4M7D D;  2CH4 A;  4OMN A;  2EAY A;  2RF0 A;  3OYE A;  3ULR B;  3MET A;  3VU3 C;  1JEG A;  3AT1 B;  4JRP A;  2F69 A;  2WSC E;  1KD1 C;  2KRM A;  2A36 A;  2LNH B;  1M90 R;  1PHT A;  4RG2 A;  3CCQ A;  4MDX A;  1W1F A;  3CD6 T;  2KGT A;  3QUI A;  1WXT A;  4K11 A;  3VS5 A;  2DE0 X;  3CBO A;  4E7I A;  4FSS A;  4XAX B;  5KYY B;  2KT1 A;  1KHI A;  3TCJ A;  1UJY A;  2CZ7 B;  1KQ2 A;  2K6D A;  3TU4 K;  2X4Y A;  1VQP A;  3OSV A;  4PK4 A;  1SKU B;  3EGD A;  2GF7 A;  4ANJ A;  1YN8 A;  2KRS A;  4ORZ A;  1GFC A;  3J7A F;  1VYT A;  1NPP A;  2CKK A;  1YI2 T;  1X01 A;  3RES A;  2D1X A;  2KRN A;  3VUB A;  1LVK A;  3V8L A;  2WAC A;  4E7H A;  2RI2 A;  3JB9 F;  4E7K A;  1A0N B;  4X9D A;  3CCM Q;  2DYB A;  2Y90 A;  1X6B A;  4M77 B;  1PRM C;  1R8O B;  3QKJ A;  2H8H A;  2L2P A;  3QDR B;  3HTR A;  5C0M A;  2MPX C;  3JCM f;  2DET A;  4MDW A;  2DPP B;  1I07 A;  1UGP B;  4M78 A;  3EG9 B;  2DMO A;  2MOX A;  3UWN A;  2ABL A;  3LH0 A;  4BE1 A;  1QCO A;  5CO7 A;  2ED0 A;  2CT4 A;  3AHU A;  1T0H A;  2L3R A;  3CC4 Q;  4C92 C;  3FB9 A;  1VQ4 T;  4FW2 A;  1VQO Q;  1IB8 A;  4E6R A;  2E4H A;  3REA B;  2F2V A;  3JSC A;  2CH4 W;  4JJC A;  1OV3 A;  2G6F X;  2RM4 A;  5IXB A;  3OW2 P;  1IGQ A;  1JJ2 P;  2YDL A;  3VS6 A;  2LJ0 A;  2PUK B;  3V8J A;  3VS7 A;  2LP5 A;  5FU7 B;  2XU8 A;  3HP9 A;  1YNZ A;  2L3S A;  2X9H A;  1Y0M A;  1KC8 C;  1M3A A;  1UFF A;  3L2V A;  4II1 A;  5IHN A;  3E19 A;  3G4S A;  3OY9 A;  2QI2 A;  2NYS A;  3RKY A;  5GAM g;  1KQS A;  2HBP A;  1SG5 A;  3JB9 H;  1SF9 A;  2CS7 A;  4CC2 A;  1GRI A;  1RAA B;  4HCZ A;  2KVQ G;  2CYZ B;  4EMG A;  1VQ4 Q;  2LZ6 B;  1D3B B;  2EYW A;  4HVW A;  1T3S A;  2QQS A;  1G3Y A;  1O75 A;  2RMO A;  3PMI A;  4J9F A;  2QEX A;  4E7Z A;  2DZC A;  3RR6 A;  1VQK T;  3EG9 A;  3MEU A;  1MMG A;  1D0X A;  2X35 A;  1TG0 A;  4QW2 A;  1WA7 A;  4M4Z A;  2DXU A;  5AT1 B;  1K9M C;  1VYV A;  4DBR A;  1WJS A;  1U8R A;  2ZPF B;  4KUD K;  1TS9 A;  4ZN1 A;  3CCE Q;  3MPU B;  2KR3 A;  3IQL A;  1YIJ T;  2RO0 A;  3QJ6 A;  1YJW A;  1VQ6 A;  4M75 F;  2NUP A;  4A54 A;  3CCU Q;  5DY9 A;  3H41 A;  3WVD B;  1VQ9 Q;  3EG1 A;  4AT1 B;  3M0U A;  1TXQ A;  2E12 A;  5A0L A;  3KUF A;  1G3T A;  1U5S A;  2KK4 A;  3CEY A;  1TTH B;  2QXF A;  4C5H A;  3QZ5 B;  1B34 A;  4Z02 A;  3RER A;  1OZ2 A;  3OQ5 A;  2P0Q A;  2HZY A;  1N27 A;  1VQ7 Q;  2M02 A;  1P92 A;  4JZ3 A;  3NTK A;  4HT8 A;  1WQW A;  5L8R E;  1XQH A;  2XHC A;  1LJO A;  3WVE B;  3CBM A;  4XU2 A;  3MP6 A;  1QVF S;  1KFZ A;  1PM3 A;  3ME9 A;  4M75 B;  3M53 A;  4M7A B;  2HAX A;  1D1C A;  2JNG A;  1IHV A;  3OYD A;  3OW2 A;  2CZ6 B;  2HQE A;  1N8R U;  1RAI B;  2H3J A;  5LL6 S;  2KXD A;  2YUQ A;  4N4G A;  1AZE A;  2KNB B;  2VXF A;  3VS2 A;  2V8I A;  1H64 1;  3EGU A;  1B07 A;  2FPD A;  1NJI U;  2LVM A;  4CRI A;  2YLC A;  4WTO B;  2R57 A;  2E70 A;  1BYM A;  2DA9 A;  2AT1 B;  4Z89 A;  3OYI A;  3RIR A;  3LWI A;  3CC7 T;  2ZZD A;  2QEX T;  1X27 A;  4J9G A;  1IRE B;  3OYL A;  1KK7 A;  2LQK A;  1PSF A;  8ATC B;  5GAN 8;  1G3S A;  1JJ2 S;  2DYI A;  3FJP A;  2D6F A;  2K3X A;  5D6X A;  3OYG A;  3I56 A;  1H92 A;  2RD1 A;  2YUO A;  4M7D B;  2M1H A;  5KE3 A;  1N6A A;  1K1Z A;  4LE9 A;  2BUD A;  2GCX A;  4M75 G;  1I8F A;  2BZY A;  2GTJ A;  2RPN A;  4XTZ A;  2G3R A;  3ASK A;  3OS5 A;  2DD4 A;  3A8L B;  1QWE A;  2L3P A;  3JCM P;  3JRZ A;  2X3W D;  5GAO l;  1YIJ A;  4C92 D;  4RUG A;  3CCR T;  1S1N A;  5LJ3 g;  5FRM A;  2E6N A;  2BZX A;  2V8K A;  3JV3 A;  2HEQ A;  1OEB A;  1I1J A;  1YCY A;  4DEY A;  4J6Y A;  4M78 B;  2RH2 A;  2P84 A;  3EAE A;  4Y92 A;  3OSS C;  4OMF B;  1RI9 A;  4IUU A;  1Q82 C;  4A63 B;  3Q1J A;  4QT7 A;  3FDR A;  1K73 C;  1SSH A;  1YJ9 T;  1K8A R;  3R6O A;  3CCJ T;  4JZ4 A;  1CSK A;  3NTI A;  2RHZ A;  1VA7 A;  4M77 A;  5CKB A;  3JB9 G;  5CKF A;  1YJW Q;  1VQ6 Q;  2BIV A;  3F70 A;  4PJO A;  4E7L A;  4C5I A;  1WNL A;  1G5V A;  2QQA A;  4ELZ C;  5J3B A;  4IUV A;  3INZ A;  5FWC A;  2COY A;  2GTO A;  3V8K A;  2Y4X A;  3JB9 D;  2OTJ A;  5GAO q;  4QVD A;  3G6E A;  1TUD A;  1EX4 A;  1GBQ A;  1T0J A;  5CCA A;  4Y91 A;  3CCE T;  2V8J A;  2L8D A;  3EGD B;  4IUR A;  2CT3 A;  2ESW A;  1AHJ B;  1VQN T;  1HD3 A;  3UPU A;  3QSU A;  3HFO A;  2GBQ A;  3EHR A;  3JCM W;  5FU6 C;  5J39 A;  1U3O A;  1NLP C;  4X34 A;  3RBB B;  4M77 G;  2XDD A;  1RL2 A;  2RNA A;  2HDA A;  2RHU A;  4A4G A;  2DXB A;  1LNX A;  3NGP A;  4EPC A;  3E2U A;  4IUT A;  3OMG A;  2A08 A;  3OS1 A;  1U1T A;  3G6E T;  4BD3 A;  1YP5 A;  4J83 A;  5GMK m;  1AEY A;  4A53 A;  5KYW B;  1VQ7 T;  3M5A A;  2XID A;  2NWM A;  1T3L A;  5I2S A;  3H0I A;  1EZZ B;  4LDV A;  2J6O A;  4FW1 A;  5IHK A;  1XTD A;  4PFO A;  5GMK i;  4JJN K;  1RAF B;  2YRV A;  5ECA A;  1ZX6 A;  4DBH A;  1GCP A;  5GAO p;  1FYN A;  3O5Z A;  3ZL7 C;  2HBW A;  2GQV A;  4N4H A;  5GJV B;  3EGX A;  3CMA T;  1UGS B;  2A3L A;  1ZLM A;  4OGE A;  4XTU A;  4PJO G;  1D09 B;  4C92 F;  3HKS A;  2IIM A;  3A1P A;  2OTL Q;  2PTK A;  2BE9 B;  1NYF A;  5KCO A;  4VUB A;  3OYH A;  2HQX A;  1LPL A;  2L5Q A;  3VS3 A;  5EC7 A;  1SRL A;  2D0N A;  5GAM f;  3UA6 A;  3SFM A;  2QEX Q;  3I5R A;  1PKS A;  3VYG A;  4OB0 B;  4BI4 A;  1N9S A;  2CGH A;  1KQS P;  4DOV A;  4A4H A;  1ABO A;  4R55 A;  3CMA A;  2OAU A;  4OB1 B;  3EH1 A;  3LW5 E;  5CKH A;  2HNI A;  2DX1 A;  4ZGE B;  5GAN e;  2GNC A;  5GMK h;  5I21 A;  3GNG A;  1R77 A;  5GAM h;  4C8Q A;  2ZPB B;  3GBQ A;  1YJN A;  3HSB A;  3M4G A;  1NZ9 A;  4ZNX A;  3CCJ A;  1W6X A;  1MV0 B;  2K2V A;  2XG8 D;  1ABQ A;  4IIM A;  2CSI A;  4M78 F;  2QQB A;  3JB9 J;  4OB2 B;  1RAH B;  3A98 A;  2MWP A;  3ER0 A;  4O6J A;  4Q5W A;  1JJ2 A;  1MV3 A;  3C95 A;  1X2K A;  4OML A;  1YWP A;  1WFW A;  2FEI A;  2KRO A;  1G2B A;  1WYX A;  1NE8 A;  1JQQ A;  1WHG A;  2GQI A;  3OYC A;  2MF2 A;  3CCR A;  2HQH A;  5FU7 C;  2IVW A;  1UGV A;  3CCL A;  5I11 A;  2FRY A;  2O4X B;  3SD4 A;  5GAO n;  1AWJ A;  2ENM A;  2CP0 A;  3HRT A;  4M7D F;  1OI1 A;  1AD5 A;  3OB9 A;  3NMZ C;  8AT1 B;  1MMD A;  3GOX A;  4M77 D;  5IAY A;  2VC8 A;  3RKX A;  3CCQ Q;  1GL5 A;  2RB6 A;  5KCH A;  1H8K A;  2EKH A;  1UDL A;  1M1K U;  1BKB A;  1WZO A;  4JUV A;  3CCJ Q;  3LWH A;  2YXY A;  1VIF A;  1YJN Q;  4C92 B;  4RTW A;  1BIB A;  1KSW A;  1JXO A;  3CC7 Q;  1X6G A;  2FYK A;  2LJ1 A;  2SRC A;  4KGX B;  3QJY A;  1VUB A;  1GBR A;  4MZM A;  2KE9 A;  4C8Q G;  2B8A A;  1MMA A;  4BY6 B;  5CK9 A;  4XU1 A;  2QG9 B;  1NM7 A;  3T9N A;  3BDU A;  3G7Z A;  1YWO A;  3A8G B;  3JCM c;  3GLX A;  3PGG A;  3HFN A;  3UAT A;  2DM1 A;  2FB7 A;  3OYJ A;  4ZTJ A;  1NJI C;  5A0D A;  3V7R A;  3DB4 A;  2X51 A;  1FMV A;  1JB0 E;  1HJD A;  3SWN A;  5GAM e;  3JAM E;  1D3B A;  2JS2 A;  4RTY A;  1WXB A;  3LX7 A;  3EHQ A;  2OTL A;  1VOM A;  1OPK A;  2A7Y A;  1I5O B;  2V26 A;  3PT9 A;  4BE0 A;  3S3M A;  2AZS A;  3G71 Q;  4PLL A;  2DEU A;  1TWB A;  3I35 A;  1BI2 A;  2O9S A;  1M27 C;  3M0R A;  4AMC A;  1YIT A;  4C0D B;  3E9G A;  3EFR A;  4M78 D;  2LTO A;  4Y28 E;  4BI8 B;  4FU6 A;  3PMT A;  3A8M B;  4HCK A;  4PJM A;  1UTI A;  5FRO A;  1J3T A;  4L5G A;  1YJW T;  3QPH A;  3H9N A;  1VQ6 T;  1OYX A;  2VGM A;  2KDS A;  3CCL T;  2AK5 A;  2ROL A;  2COZ A;  2HKQ B;  2V1Q A;  2F5K A;  1OPL A;  2V1R A;  1VYU A;  1JBM A;  2RHY A;  3L2Q A;  1TOV A;  2NUT A;  4NL3 A;  2VYT A;  4OF1 A;  4ME7 A;  1VQL A;  2DJQ A;  4FCY A;  4X9C A;  1E7O A;  4M77 F;  3SWN B;  1MND A;  1OUL A;  4PFP A;  1W70 A;  2LT4 A;  3HPW A;  3VKI A;  2FPF A;  4M78 G;  4CC3 A;  1GFD A;  2ZGW A;  1PD1 A;  4C8Q C;  2QTX A;  2K5I A;  1ARK A;  2OAW A;  1AWO A;  3NTH A;  1QWF A;  2C0O A;  1C0M A;  1ZA1 B;  2K2M A;  1SHF A;  3CXC A;  1QMC A;  5IXF A;  4O5V A;  2PZ1 A;  2K7A A;  3KBG A;  1B34 B;  1BI3 A;  1TU0 B;  3X24 B;  1Q7Y C;  1NLO C;  4M7A C;  2FZG B;  2X4J A;  1XJW B;  2C06 A;  2FRW A;  1OX9 A;  3QDF A;  1WHK A;  4QQD A;  2K4Y A;  1M1F A;  4HA8 A;  2RQW A;  2MMP A;  4N0A C;  2HSE B;  5KYU A;  3P8D A;  1LOJ A;  2XIC A;  2NUP B;  4EMK A;  4ZGD B;  5LJ3 j;  3GP8 A;  4MML A;  5GAM j;  1VQM T;  2JJ9 A;  2EGC A;  1B7T A;  5GMK j;  3ZBD A;  2KSS A;  1K0X A;  2JXB A;  3NPF A;  1PG5 B;  5GAM d;  1SRM A;  1VQK A;  1UHC A;  4XU3 A;  1WJR A;  4AFU C;  2ZCF B;  3I55 T;  1Y71 A;  4D8D A;  4PKC C;  3PIP A;  5A2Q E;  3PVL A;  3QYH B;  1VQP T;  2CP3 A;  5LJ5 e;  4P5N A;  1VQ5 A;  3M57 A;  3MEW A;  3HHT B;  2QYZ A;  2Y4Y A;  3CPF A;  2LJ3 A;  3TSW A;  1QCN A;  2JMC A;  2MI6 A;  4IUQ A;  4LD6 A;  5LJ5 h;  5GAN h;  2J06 A;  1VQ5 T;  3JCM h;  2YHT A;  3VJP A;  2XKO C;  3CCS A;  3RMQ A;  2E3I A;  1VQM Q;  1I0C A;  1R0C B;  3I55 A;  3VUZ A;  4PJO E;  3JCM X;  1N5Z A;  4XTX A;  2YLB A;  2DER A;  2DVE A;  2X3X D;  4EMH A;  1KJW A;  5CKD A;  1ZQ1 A;  4KUI A;  2RK2 A;  1VQO A;  4J9B A;  4PNO A;  2LQW A;  4LDW A;  4RTT A;  4F14 A;  2DLP A;  3JCM J;  5KYU B;  2YT6 A;  4JS5 A;  4FT4 A;  1MHN A;  1TUC A;  3H0F A;  3OA6 A;  3OYA A;  5D6W A;  4R0K A;  2W10 A;  4FYW B;  2EPD A;  2X4W A;  4LN2 A;  2CRE A;  2ZPI B;  3PTA A;  4PJO C;  4LD9 K;  1U06 A;  5CR2 A;  1XOV A;  1QW1 A;  1W2B A;  3L1A A;  3H8Z A;  3M0P A;  2NUZ A;  2J6F A;  4AG2 C;  1ACM B;  1PNJ A;  3EGX B;  1WJQ A;  4BB7 A;  1BIA A;  3CCQ T;  3GNF B;  2ED1 A;  3V7C A;  5LJ5 j;  3A5Z B;  4FSX A;  1YBY A;  1W4S A;  2DVJ A;  3VS0 A;  1XNI A;  5LJ5 g;  3M59 A;  2QDL A;  1Q81 R;  1RI0 A;  3M58 A;  3LH5 A;  5FRN A;  5I2M A;  2QGF B;  3EFO B;  4J6X A;  2JTF A;  1K8A C;  3V7S A;  3CQT A;  1YI2 A;  1Y7X A;  5GMK e;  2EGE A;  2JTM A;  3SDZ A;  2QAZ A;  2ZAE A;  1B3Q A;  2LCL A;  4RTV A;  4M7A F;  1D1B A;  2AZV A;  1BU1 A;  1GXI E;  2HKN A;  4B9X A;  2LDM A;  1I81 A;  4B9W A;  1YJ9 A;  2EQU A;  4LNP A;  3DLM A;  1YIT T;  1WX6 A;  1X2Q A;  4PFZ A;  4B6M A;  2KT8 A;  3CC4 T;  2A0F B;  2MAM A;  4FYX B;  2VUB A;  1SEM A;  1CKB A;  3SHW A;  2H3E B;  2FO0 A;  4BUG A;  2K5F A;  4DQ2 A;  5GAN d;  5KYN A;  3EG0 A;  3QHS A;  3J81 E;  3G4S Q;  3CC2 T;  1SSF A;  2DFU A;  5GAN 2;  4DBF A;  5CVI A;  2CP2 A;  2L0A A;  2PVO B;  4XTY A;  1IXD A;  2E6Z A;  5GAN j;  1E6G A;  5M9O A;  4D6W A;  3TEE A;  3H6Z A;  3LYI A;  3VS1 A;  1VIE A;  2EQK A;  3A8H B;  2I2L A;  2PUO B;  2DTI A;  3OS2 A;  1UHF A;  2EIF A;  2M9U A;  4PJL A;  3VS4 A;  2OX7 A;  2MWO A;  3SEM A;  3LGF A;  1ZHI A;  1M1K R;  4PL6 A;  1Q81 C;  5IN1 A;  3UF4 A;  5L23 A;  4WCI A;  2LMJ A;  3C12 A;  1VQ5 Q;  3FIF A;  4BE2 A;  1Q82 R;  1BI0 A;  4NL2 A;  3CPW S;  3CD6 Q;  5LJ5 d;  1G3W A;  3OYF A;  3EG2 A;  5IHI A;  4C0Z A;  4PJO D;  2F2X A;  4FYV B;  4MMK A;  1R0B G;  3MHX A;  1RAB B;  2D0Q B;  2RQU A;  3JCM V;  1NG2 A;  2O4X A;  4FL6 A;  3SB2 A;  1UGQ B;  2OI3 A;  2LQ8 A;  2DIQ A;  2RJE A;  3JCM b;  1CKA A;  3J80 E;  5GAN g;  2LX7 A;  4JPB W;  1I4K 1;  5I22 A;  4KH0 B;  1V76 A;  5LJ5 f;  1IZ6 A;  4XTW A;  1TH7 A;  2K3B A;  4OGC A;  2VXE A;  4OMP A;  1X75 C;  2O31 A;  1ZSG A;  2DIG A;  3MEV A;  4LDU A;  4M75 C;  2EJF A;  1FX7 A;  1Q86 R;  1KQS S;  2XD0 A;  4L59 A;  2MK5 A;  2KQW A;  4XQ3 A;  2KYM A;  2RA2 A;  5HY6 A;  4PLI A;  1M8V A;  3ZEH A;  1VQ9 A;  4RKU E;  4XU0 A;  2BKD N;  4EDU A;  2E64 A;  4JS4 A;  3FJ5 A;  4HT9 A;  3OYB A;  1Q95 G;  5FLX E;  4M7A A;  2M16 A;  1KD1 U;  4ZGJ B;  3DLL A;  2CUB A;  2PU9 B;  2DL4 A;  4AG1 C;  4HKE A;  1MMN A;  1H3Z A;  3JCM Q;  2L3Q A;  1RLQ C;  1K8A U;  4PJJ A;  4FT2 A;  5EG2 A;  3THK A;  2ATC B;  2JW4 A;  3U23 A;  3L2W A;  1Q7Y U;  4L6V 5;  2CP5 A;  4XK8 E;  4KH1 B;  2K3Y A;  2JUF A;  3RKW A;  3OYM A;  1E6H A;  2ZPE B;  2EGA A;  2YRC A;  3MP8 A;  1S72 A;  1ZBX A;  1UG1 A;  1C1A A;  2CZ0 B;  4IIO A;  2M0Y A;  1OX8 A;  1MNE A;  1UB4 A;  2CP7 A;  1F1B B;  4KT0 E;  3SWN C;  5KYX B;  2A37 A;  1VQ4 A;  5HK0 A;  4CI0 C;  5IH2 A;  2GFA A;  2MIO A;  4C0F A;  3G71 T;  4ATO A;  4LUE A;  2EJ9 A;  3D7S B;  2HL5 C;  4E2F B;  3QG1 A;  2O88 A;  2D8J A;  3QWX X;  1D0Z A;  2F1L A;  2DJZ A;  3P8H A;  2QA4 Q;  5DM7 R;  3TRE A;  4C8Q E;  1V1C A;  2DAQ A;  3M4Y A;  2EYQ A;  3EH2 A;  2EJG A;  1WHL A;  2DBM A;  2BTT A;  2OTJ Q;  1NEB A;  3I5S A;  5KYW A;  3CC2 Q;  2KBT A;  4C8Q D;  2FHD A;  2E5Q A;  5GAO r;  2EQI A;  1WIE A;  2DIL A;  1AVZ C;  1QP3 A;  1ZUK A;  1YI2 Q;  2KYB A;  2WSF E;  1JU5 C;  3FRN A;  5KH6 A;  4OMO A;  3A8O B;  4FM4 B;  1QCF A;  1O9S A;  4M7A G;  1LCK A;  4C8Q F;  3DB3 A;  2YRD A;  1DJ7 B;  1VQ8 A;  3L2Z A;  2A28 A;  2AHJ B;  2LNV A;  2K57 A;  3S6W A;  4M7D A;  3X25 B;  3CCM T;  1ZBJ A;  2JOY A;  3C0C A;  2VAS A;  3EFS A;  2LRQ A;  4LDX A;  2M0O A;  4BAC A;  2MCN A;  3CME Q;  4HVV A;  3TSZ A;  4JDS A;  4QQG A;  5CIU A;  5J26 A;  1YJ9 Q;  2RHI A;  1NEG A;  2E10 A;  1M1K C;  2PVD B;  1PD0 A;  4KGV B;  1Z9Z A;  2EYY A;  3M0Q A;  3CCS T;  4A4F A;  2JMA A;  2KY9 A;  2I0N A;  3QXE B;  2EQJ A;  2EWN A;  1S72 Q;  3P8B B;  2JM8 A;  1ZSZ B;  2LCC A;  4RG8 A;  3CCU T;  1QVF A;  1QP2 A;  4HXJ A;  1Q7Y R;  2O2O A;  1MUZ A;  4MZT A;  1M2V A;  4OVA A;  5AYF A;  3CXC P;  3MJX A;  2YSQ A;  1KHC A;  1VQ7 A;  4C92 E;  1QVF P;  2R5M A;  1HXD A;  3QO3 A;  3GF5 A;  3M9Q A;  2EBP A;  2GGR A;  1K4U S;  4ESR A;  1FWZ A;  1N9R A;  1YFN A;  2CP6 A;  6AT1 B;  2AKL A;  2VKN A;  2VV5 A;  2EW3 A;  2DL3 A;  2LQN A;  3RNJ A;  3I55 Q;  4RCC A;  4DEX A;  2EYX A;  1NJI R;  2VB6 A;  2JT4 A;  1M8M A;  4FYY B;  1VQM A;  3CCS Q;  2QQ9 A;  2J05 A;  2NLU A;  5CKE A;  3CCL Q;  2QGG A;  3KFV A;  2ZPG B;  3BFM A;  3QWY A;  5C6S A;  1Q86 C;  1FXX A;  2E41 A;  1PC0 A;  2MYS A;  3VYH B;  4BI3 A;  4JRK A;  4TVR A;  1WXU A;  2DD5 A;  1QVG A;  4C5G A;  1EIF A;  1M3B A;  1UJ0 A;  1UE9 A;  1KD1 R;  2DEQ A;  5GAN 5;  4HCC A;  4RCB A;  2FL7 A;  4RTZ A;  5GAN 4;  4M77 C;  5D7U A;  2XDB A;  2R58 A;  1RAD B;  4M77 E;  1VQK Q;  4QQ6 A;  4QVC A;  3RMS A;  1KIK A;  3CME A;  1I5L A;  4A4K A;  3JCM g;  4DBQ A;  1UGR B;  4DA4 A;  4F04 B;  3M0T A;  1C6V X;  1YHQ T;  1QVP A;  5KYY A;  1FMK A;  3M55 A;  1X6O A;  1HYO A;  1QVG S;  1VQL T;  1Y57 A;  2K9G A;  2RI5 A;  2K79 A;  2PVG B;  1K0S A;  4M75 A;  4J9C A;  2NUT B;  2FVU A;  5KE2 A;  1RLP C;  2RQR A;  1PKT A;  1M90 C;  2F5T X;  1MGQ A;  2J6K A;  2D8H A;  2C0T A;  4F7U G;  2QQR A;  5GMK l;  5DLO A;  4E7J A;  3CC2 A;  3OYK A;  4M78 C;  2HCK A;  1WI7 A;  4N4I A;  3M56 A;  1BK2 A;  4FIB A;  4LDY A;  1KG1 A;  4EMK B;  1SPK A;  3H0H A;  2JTE A;  2PNI A;  2DO3 A;  2YWW A;  3DKM A;  1YHQ Q;  1WGS A;  2XI9 A;  1OQK A;  1OZ3 A;  1UEB A;  1OU9 A;  1VQL Q;  1ZUU A;  5CQX A;  5LJ3 e;  2DRK A;  3L2R A;  4M7D G;  3JCM e;  3CPW A;  2E5K A;  1QQJ A;  3OW2 S;  1WQ7 A;  4V2S A;  1JO8 A;  3VV0 A;  2P4R A;  1BBZ A;  1QKW A;  3OYN A;  3OS0 A;  5HCK A;  4Z8A A;  3RDV A;  4HVU A;  2DXT A;  3FLG A;  1BCO A;  2ROT A;  3L2U A;  5FU6 B;  1M2V B;  1IO6 A;  1NYG A;  1YIT Q;  3QYG B;  1PCX A;  1WHH A;  1YJN T;  2QAS A;  4IUP A;  3G6E Q;  2E1H A;  3X20 B;  4F17 A;  3E1S A;  4MZP A;  2DL5 A;  4D8K A;  5FWB A;  1Q82 U;  1Q86 U;  2QA4 T;  1WDX A;  1K73 R;  3MKD A;  3RUX A;  2GFU A;  1FMW A;  4ZTF A;  3VRY A;  1Z9Q A;  4BDZ A;  2DKG A;  2KAF A;  1IRX A;  1M1G A;  2KEA A;  1TUG B;  3BDL A;  2BZ8 A;  1M4Z A;  3LLR A;  4J9E A;  4XTV A;  2FZK B;  2YUN A;  1WHM A;  4ELY C;  1ZA2 B;  1RAC B;  3CCM A;  3REB B;  4OMM A;  2BE7 D;  1HK9 A;  5LJ3 d;  1M2O A;  2QK0 A;  2DK3 A;  1VQO T;  1AT1 B;  4LXC A;  1BB9 A;  4NS5 A;  4PJO F;  4YTL A;  2DXC A;  3OBY A;  2ECZ A;  4J6W A;  1VQ8 Q;  3FC3 A;  3CCV T;  2RI3 A;  1K9A A;  4BDY A;  2FG0 A;  5LJ3 h;  5A0G A;  1UEC A;  2DZ9 A;  2HL3 A;  4A4E A;  5LJ3 f;  4QKU A;  1WHJ A;  1Y07 A;  1VQP Q;  2E65 A;  3FEO A;  3UDC A;  4C8Q B;  2KMT A;  3O8V A;  3I56 Q;  2FPE A;  1QVG P;  5HK3 A;  2F2W A;  4EIK A;  2RJC A;  3URG A;  2E3H A;  4KGZ B;  1PSE A;  2EVR A;  2RJD A;  4C0G A;  5D6Y A;  1QKX A;  4AFQ C;  2P0K A;  4J8O A;  1NPR A;  5GAN f;  1N8R R;  4PJN A;  3QII A;  4R56 A;  4F16 A;  5CAI A;  2RQT A;  5GAN 7;  2QDY B;  3S3N A;  1WPY A;  1KQ1 A;  2R5A A;  4JJD A;  1X69 A;  4JRI A;  1VQ8 T;  1ZUY A;  2IG0 A;  3MP1 A;  4UC4 A;  2JN0 A;  3PE0 A;  2CSQ A;  4F7U F;  3NFC A;  2RHX A;  4C5E A;  4DOW A;  4Z88 A;  2EKO A;  2P0P A;  9ATC B;  2X4X A;  1X43 A;  4N0A A;  2HMA A;  1AOJ A;  1HSQ A;  3BY7 A;  2CZ1 B;  3CCU A;  3KXT A;  1M5Q 1;  3CMA Q;  2VWF A;  1M90 U;  1RAG B;  1RUW A;  3CCV A;  3S3O A;  1Y96 A;  1M3C A;  1OU8 A;  1ZSZ A;  3CCR Q;  1VQ9 T;  2EQM A;  1YCS B;  4J7I A;  2XK0 A;  2HD0 A;  3M0S A;  3ZFJ A;  4C92 G;  3CD6 A;  4RTU A;  2EYZ A;  2JS0 A;  4M78 E;  1K9M R;  2FZC B;  3N5B B;  3JCM d;  3I9Q A;  2XDP A;  4J5Y A;  3PIO A;  1VQN A;  1PWT A;  3GPL A;  2C0I A;  3CCE A;  4BY6 C;  3R6N A;  4F7U B;  3CPW P;  2CUD A;  1AZG B;  2PQW A;  4IKF A;  2RK1 A;  2AKK A;  2OTJ T;  1K9M U;  3PFS A;  1TSF A;  2LT1 A;  1M9S A;  1JRI A;  2J7I A;  2RN8 A;  5DLQ E;  4M7D E;  1BI1 A;  2IPO B;  4RTX A;  3GIB A;  1K73 U;  3G1J A;  3EG3 A;  1JXM A;  3TVT A;  4JLG A;  3BE3 A;  2EFI A;  2RQV A;  2DRM A;  5CQY A;  4GY5 A;  2QA4 A;  3UA7 A;  4PJO B;  3NHN A;  1EFN A;  4JJB A;  2OJ2 A;  4X1V A;  1V29 B;  2SEM A;  4AFZ C;  4CC7 A;  3CBP A;  1UUE A;  3X28 B; 
#chains in the Genus database with same CATH homology
 4EMK A;  3CC7 T;  2ZZD A;  3CXC S;  2QEX T;  3G71 A;  2KY9 A;  4ZGD B;  3M54 A;  5LJ3 j;  3GP8 A;  1IRE B;  3QXE B;  3OYL A;  5GAO m;  2LQK A;  1PSF A;  2EQJ A;  4MML A;  2EWN A;  5GAM j;  5GAN 8;  3P8B B;  1G3S A;  3HRS A;  1VQM T;  1KC8 U;  1JJ2 S;  2P4T A;  4JLI A;  4KBM B;  2LCC A;  4KUL A;  4RG8 A;  5GMK j;  3CCU T;  1QVF A;  1QP2 A;  3FJP A;  2D6F A;  4C92 A;  2K3X A;  3ZBD A;  2KSS A;  3MCA B;  5D6X A;  4MZT A;  3OYG A;  3I56 A;  4OVA A;  5GAM d;  3MEA A;  5AYF A;  1S72 T;  1VQK A;  2K5L A;  2RD1 A;  3BW1 A;  4XU3 A;  1KHC A;  1VQ7 A;  4M7D B;  2M1H A;  4C92 E;  1WJR A;  2R5M A;  5KE3 A;  1HXD A;  1N6A A;  3QO3 A;  2ZCF B;  2BUD A;  2GCX A;  3I55 T;  4M75 G;  1Y71 A;  3PIP A;  4PKC C;  3GF5 A;  3M9Q A;  1I8F A;  4XTZ A;  4M7A E;  1W2B S;  2G3R A;  3ASK A;  3OS5 A;  2DD4 A;  3QZ9 B;  5A2Q E;  3OMC A;  3A8L B;  3I56 T;  3QYH B;  1VQP T;  1FWZ A;  1N9R A;  4WF2 A;  3JCM P;  3CC4 A;  5LJ5 e;  3JRZ A;  2VV5 A;  5GAO l;  4P5N A;  1YIJ A;  4C92 D;  3CCR T;  1VQ5 A;  3M57 A;  3LGL A;  3UT1 A;  5LJ3 g;  4RCC A;  3MEW A;  5FRM A;  4ZN3 A;  3HHT B;  2E6N A;  4F7U A;  1VQM A;  2V8K A;  3HL8 A;  2Y4Y A;  3CPF A;  2OTL T;  4M7A D;  1U1S A;  2LC4 A;  2QQ9 A;  5GAN 6;  2NLU A;  5CKE A;  1YCY A;  3HRU A;  2MI6 A;  4IUQ A;  4LD6 A;  5LJ5 h;  5GAN h;  4J6Y A;  3JCM h;  1VQ5 T;  2YHT A;  4M78 B;  3CC7 A;  2RH2 A;  2ZPG B;  3VJP A;  3BFM A;  2XKO C;  5C6S A;  1Q86 C;  3EAE A;  4JS4 A;  4GLK A;  3OSS C;  3CCS A;  1N8R C;  4NOY A;  1FXX A;  2E41 A;  2JVV A;  4IUU A;  4OMF B;  1Q82 C;  3RMQ A;  3VYH B;  4E47 A;  3Q1J A;  1K73 C;  3FDR A;  3E9F A;  4BI3 A;  4JRK A;  3I55 A;  3VUZ A;  4M7D C;  1YJ9 T;  4TVR A;  4PJO E;  3JCM X;  5GAN 3;  2DD5 A;  3R6O A;  2JZ2 A;  3CCJ T;  4C5G A;  4XTX A;  1EIF A;  1QVG A;  2YLB A;  4QVZ A;  2DVE A;  2RHZ A;  3NTI A;  4M77 A;  5CKB A;  4EMH A;  4OB3 B;  5CKF A;  5CKD A;  4JRQ A;  3C4S A;  2BIV A;  1ZQ1 A;  3F70 A;  2DEQ A;  4KUI A;  5GAN 5;  2RK2 A;  2DTH A;  1VQO A;  3MO8 A;  4RCB A;  4HCC A;  4PJO A;  2FL7 A;  4E7L A;  4C5I A;  1WNL A;  4PNO A;  1Y96 B;  4RMO A;  2QQA A;  4ELZ C;  5GAN 4;  1G5V A;  4LDW A;  4M77 C;  4IUV A;  5J3B A;  3INZ A;  1Q81 U;  1YHQ A;  2XDB A;  2R58 A;  3JCM J;  2VGN A;  4M77 E;  4JS5 A;  4A4F A;  4FT4 A;  3V8K A;  4F7U E;  4QQ6 A;  1MHN A;  2Y4X A;  2ZPH B;  4QVC A;  3OA6 A;  3JB9 D;  3RMS A;  3OYA A;  2OTJ A;  5D6W A;  3CME A;  5GAO q;  1I5L A;  4QVD A;  4A4K A;  2X4W A;  3JCM g;  1UGR B;  2DTO A;  2ZPI B;  3PNW C;  3G6E A;  4DA4 A;  5CCA A;  3OBW A;  1YHQ T;  4Y91 A;  3CCE T;  2V8J A;  1QVP A;  3PTA A;  2L8D A;  3X28 B;  3JB9 I;  4PJO C;  3M55 A;  1X6O A;  2L89 A;  1QVG S;  1VQL T;  4IUR A;  4LD9 K;  1AHJ B;  4EMK C;  3CME T;  5CR2 A;  1VQN T;  1XOV A;  1QW1 A;  1W2B A;  3UPU A;  3L1A A;  3QSU A;  2RI5 A;  3H8Z A;  5IT9 E;  3HFO A;  3L42 A;  3JCM W;  5HKC A;  2PVG B;  5FU6 C;  5J39 A;  4M75 A;  4X34 A;  4M77 G;  2XDD A;  1RL2 A;  3G4S T;  2WSE E;  2FVU A;  2D9T A;  2RHU A;  5KE2 A;  4A4G A;  4BB7 A;  1WJQ A;  2DXB A;  1LNX A;  1M90 C;  1BIA A;  2LX9 A;  4M75 E;  4C0D C;  4EPC A;  4J7F A;  4HCB A;  4IUT A;  3OMG A;  3GNF B;  3CCQ T;  2F5T X;  1MGQ A;  3V7C A;  3OS1 A;  1U1T A;  3OYY A;  5LJ5 j;  3A5Z B;  3G6E T;  4FSX A;  2O01 E;  1YBY A;  3WXM B;  2QQR A;  4BD3 A;  4F7U G;  5GMK l;  5DLO A;  1W4S A;  3QBY A;  4E7J A;  3CC2 A;  4J83 A;  3OYK A;  5GMK m;  4A53 A;  1XNI A;  4OP0 A;  3M59 A;  3X26 B;  5LJ5 g;  1VQ7 T;  3M5A A;  2XID A;  2RJF A;  4M78 C;  5I2S A;  4M75 D;  1RI0 A;  4LDV A;  3C94 A;  4N4I A;  3M58 A;  4M7D D;  3M56 A;  5FRN A;  1XTD A;  4FIB A;  5I2M A;  4LDY A;  4J6X A;  1KG1 A;  2EAY A;  2JTF A;  4EMK B;  3V7S A;  5GMK i;  1K8A C;  4JJN K;  2YRV A;  1YI2 A;  3OYE A;  3MET A;  3VU3 C;  1Y7X A;  4JRP A;  2DO3 A;  2F69 A;  2WSC E;  5GMK e;  3DKM A;  5GAO p;  1WGS A;  2XI9 A;  1KD1 C;  1OZ3 A;  2JTM A;  3SDZ A;  1UEB A;  2GQV A;  4N4H A;  3CMA T;  1UGS B;  2A3L A;  2LCL A;  4OGE A;  5CQX A;  4XTU A;  4PJO G;  4RG2 A;  5LJ3 e;  3CCQ A;  4M7A F;  3L2R A;  4MDX A;  3CD6 T;  4C92 F;  3HKS A;  3QUI A;  4M7D G;  3JCM e;  3CPW A;  3OW2 S;  5KCO A;  1GXI E;  1WQ7 A;  3CBO A;  4V2S A;  4VUB A;  4B9X A;  3OYH A;  3VV0 A;  2HQX A;  2LDM A;  4E7I A;  4XAX B;  2L5Q A;  5GAM f;  1KHI A;  3TCJ A;  1I81 A;  4B9W A;  1YJ9 A;  3SFM A;  3OYN A;  2EQU A;  3DLM A;  1YIT T;  2CZ7 B;  3OS0 A;  3VYG A;  1KQ2 A;  3TU4 K;  2X4Y A;  4OB0 B;  3CC4 T;  2MAM A;  4BI4 A;  1VQP A;  1N9S A;  2DXT A;  3FLG A;  2CGH A;  3OSV A;  2VUB A;  4DOV A;  4A4H A;  4BUG A;  3L2U A;  2K5F A;  5FU6 B;  2GF7 A;  4DQ2 A;  4R55 A;  2OAU A;  3CMA A;  5GAN d;  4OB1 B;  3QHS A;  3J81 E;  3CC2 T;  1SSF A;  3LW5 E;  5GAN 2;  5CKH A;  2HNI A;  3QYG B;  5CVI A;  4ZGE B;  3J7A F;  1NPP A;  2CKK A;  1YJN T;  2PVO B;  1YI2 T;  4XTY A;  4IUP A;  5GAN e;  2E6Z A;  2E1H A;  5GAN j;  5GMK h;  1X01 A;  3X20 B;  4D6W A;  5M9O A;  3TEE A;  3H6Z A;  3LYI A;  3RES A;  3GNG A;  5I21 A;  3E1S A;  4MZP A;  5GAM h;  1Q82 U;  1VIE A;  3VUB A;  2EQK A;  2ZPB B;  3V8L A;  4C8Q A;  2WAC A;  3A8H B;  2I2L A;  1Q86 U;  4E7H A;  2PUO B;  2RI2 A;  3JB9 F;  1YJN A;  3HSB A;  2QA4 T;  3M4G A;  1NZ9 A;  2DTI A;  3OS2 A;  3CCJ A;  2K2V A;  2EIF A;  2XG8 D;  4E7K A;  3RUX A;  2M9U A;  2GFU A;  4X9D A;  2MWO A;  3LGF A;  1ZHI A;  4PL6 A;  4ZTF A;  1Q81 C;  2Y90 A;  4BDZ A;  2DKG A;  4M77 B;  2KAF A;  4M78 F;  5IN1 A;  2QQB A;  3JB9 J;  4OB2 B;  1M1G A;  2MWP A;  1R8O B;  3QKJ A;  3ER0 A;  4O6J A;  3C12 A;  3QDR B;  4Q5W A;  1JJ2 A;  3BDL A;  3FIF A;  3C95 A;  5C0M A;  4BE2 A;  3JCM f;  1M4Z A;  4MDW A;  3LLR A;  2DPP B;  4XTV A;  1NE8 A;  1BI0 A;  4ELY C;  4NL2 A;  3CPW S;  3OYC A;  1UGP B;  4M78 A;  2MF2 A;  3UWN A;  5LJ5 d;  1G3W A;  3OYF A;  3CCR A;  4C0Z A;  4PJO D;  3CCM A;  5FU7 C;  1HK9 A;  2IVW A;  5LJ3 d;  4MMK A;  3CCL A;  3LH0 A;  4BE1 A;  2O4X B;  3SD4 A;  5GAO n;  2DK3 A;  5CO7 A;  3MHX A;  1VQO T;  3HRT A;  3AHU A;  2D0Q B;  4M7D F;  1OI1 A;  3JCM V;  3OB9 A;  2O4X A;  4FL6 A;  4NS5 A;  4PJO F;  4YTL A;  2DXC A;  3OBY A;  3SB2 A;  1UGQ B;  4J6W A;  3GOX A;  2L3R A;  3FC3 A;  4M77 D;  2LQ8 A;  4C92 C;  3FB9 A;  3CCV T;  2DIQ A;  2RJE A;  2VC8 A;  5IAY A;  3JCM b;  1VQ4 T;  2RI3 A;  3RKX A;  4BDY A;  3J80 E;  5GAN g;  3JSC A;  2RB6 A;  1I4K 1;  5LJ3 h;  5A0G A;  5KCH A;  5LJ5 f;  1IZ6 A;  2DZ9 A;  4XTW A;  1TH7 A;  4OGC A;  2VXE A;  2RM4 A;  1M1K U;  1BKB A;  5LJ3 f;  4A4E A;  4JUV A;  3LWH A;  1Y07 A;  2E65 A;  1VIF A;  1X75 C;  2DIG A;  3FEO A;  3MEV A;  3UDC A;  4C8Q B;  2KMT A;  3O8V A;  4C92 B;  4LDU A;  4M75 C;  1BIB A;  2EJF A;  1FX7 A;  2FYK A;  2PUK B;  5HK3 A;  3V8J A;  1KQS S;  2XD0 A;  4L59 A;  3QJY A;  2RJC A;  1VUB A;  2XU8 A;  3HP9 A;  5FU7 B;  3URG A;  2KQW A;  4XQ3 A;  2RA2 A;  5HY6 A;  1PSE A;  4MZM A;  4C8Q G;  1KC8 C;  2B8A A;  2RJD A;  3L2V A;  4C0G A;  4PLI A;  5D6Y A;  1M8V A;  4II1 A;  2P0K A;  4BY6 B;  4XU1 A;  3ZEH A;  5CK9 A;  3E19 A;  4J8O A;  1VQ9 A;  3G4S A;  3T9N A;  3BDU A;  3OY9 A;  1NPR A;  5GAN f;  3G7Z A;  3A8G B;  2QI2 A;  4RKU E;  4XU0 A;  2BKD N;  3JCM c;  2E64 A;  3GLX A;  3QII A;  3RKY A;  4EDU A;  5CAI A;  5GAM g;  5GAN 7;  4R56 A;  2QDY B;  3OYB A;  4HT9 A;  3S3N A;  3PGG A;  1KQS A;  5FLX E;  2HBP A;  1WPY A;  3JB9 H;  2M16 A;  3HFN A;  4M7A A;  1KD1 U;  4ZGJ B;  1KQ1 A;  2CS7 A;  2FB7 A;  2R5A A;  3OYJ A;  3DLL A;  4ZTJ A;  2PU9 B;  4JRI A;  4HCZ A;  1NJI C;  5A0D A;  2KVQ G;  4HKE A;  1VQ8 T;  1H3Z A;  3MP1 A;  2CYZ B;  2IG0 A;  3DB4 A;  3V7R A;  4EMG A;  3JCM Q;  1JB0 E;  1D3B B;  4UC4 A;  1K8A U;  4FT2 A;  2JN0 A;  5EG2 A;  3L2W A;  3SWN A;  5GAM e;  3JAM E;  1Q7Y U;  4L6V 5;  2QQS A;  1G3Y A;  1D3B A;  1O75 A;  4XK8 E;  4F7U F;  2K3Y A;  3LX7 A;  2RHX A;  3NFC A;  4C5E A;  3PMI A;  2JUF A;  3RKW A;  4DOW A;  3OYM A;  2QEX A;  2OTL A;  2EKO A;  2P0P A;  2ZPE B;  2DZC A;  2A7Y A;  3MP8 A;  2X4X A;  1ZBX A;  1S72 A;  1VQK T;  3PT9 A;  4BE0 A;  4N0A A;  3MEU A;  3S3M A;  2X35 A;  3BY7 A;  2CZ0 B;  4PLL A;  2CZ1 B;  1BI2 A;  4QW2 A;  3CCU A;  2DXU A;  3KXT A;  1UB4 A;  1M5Q 1;  1YIT A;  1M90 U;  1K9M C;  4C0D B;  4KT0 E;  3E9G A;  3SWN C;  1VQ4 A;  3CCV A;  3EFR A;  5HK0 A;  4M78 D;  1WJS A;  4CI0 C;  3S3O A;  1Y96 A;  1U8R A;  2GFA A;  2ZPF B;  4KUD K;  2LTO A;  4Y28 E;  4ZN1 A;  4C0F A;  3G71 T;  4ATO A;  2EJ9 A;  4FU6 A;  4BI8 B;  3PMT A;  1YIJ T;  2RO0 A;  3A8M B;  2EQM A;  3QG1 A;  1VQ9 T;  4J7I A;  2XK0 A;  2HD0 A;  3QJ6 A;  5FRO A;  4L5G A;  3ZFJ A;  1YJW A;  1YJW T;  3QPH A;  1VQ6 T;  1VQ6 A;  2DJZ A;  3P8H A;  4M75 F;  4C92 G;  5DM7 R;  1OYX A;  2VGM A;  2KDS A;  3CCL T;  3CD6 A;  3TRE A;  4C8Q E;  4A54 A;  2DAQ A;  4M78 E;  5DY9 A;  3WVD B;  3M4Y A;  2EYQ A;  2EJG A;  2F5K A;  2E12 A;  3N5B B;  3JCM d;  1JBM A;  5A0L A;  3KUF A;  2XDP A;  1G3T A;  2RHY A;  4J5Y A;  3PIO A;  1VQN A;  2KK4 A;  3L2Q A;  3CEY A;  3GPL A;  4NL3 A;  2QXF A;  4C5H A;  2VYT A;  3JB9 G;  4OF1 A;  3QZ5 B;  4C8Q D;  1B34 A;  3CCE A;  2FHD A;  4ME7 A;  2E5Q A;  4Z02 A;  4BY6 C;  1VQL A;  4F7U B;  3RER A;  1OZ2 A;  3OQ5 A;  5GAO r;  2P0Q A;  1N27 A;  4X9C A;  2PQW A;  3LWI A;  1QP3 A;  2RK1 A;  4M77 F;  2LT4 A;  1P92 A;  3SWN B;  4IKF A;  3VKI A;  2OTJ T;  2WSF E;  3HPW A;  3NTK A;  4HT8 A;  3FRN A;  1WQW A;  5L8R E;  1XQH A;  3PFS A;  5KH6 A;  1K9M U;  2XHC A;  2LT1 A;  1M9S A;  3A8O B;  4FM4 B;  4M78 G;  1JRI A;  1LJO A;  5DLQ E;  1O9S A;  3WVE B;  2ZGW A;  4M7A G;  3CBM A;  4XU2 A;  3MP6 A;  4C8Q F;  1QVF S;  4M7D E;  3DB3 A;  4C8Q C;  1BI1 A;  2QTX A;  3ME9 A;  1DJ7 B;  2K5I A;  3M53 A;  4M75 B;  4M7A B;  3L2Z A;  1VQ8 A;  2HAX A;  3NTH A;  2AHJ B;  3GIB A;  2JNG A;  2LNV A;  3OYD A;  3OW2 A;  2CZ6 B;  1K73 U;  2K57 A;  3S6W A;  4M7D A;  3X25 B;  2HQE A;  4JLG A;  3CCM T;  3CXC A;  1N8R U;  2EFI A;  2JOY A;  4O5V A;  2H3J A;  5LL6 S;  3EFS A;  3KBG A;  2LRQ A;  4N4G A;  1B34 B;  1BI3 A;  2M0O A;  5CQY A;  3X24 B;  4GY5 A;  1Q7Y C;  2QA4 A;  4LDX A;  2VXF A;  4M7A C;  4BAC A;  2V8I A;  1H64 1;  2X4J A;  4JDS A;  4QQG A;  5CIU A;  5J26 A;  2C06 A;  4PJO B;  1NJI U;  2RHI A;  2LVM A;  4CRI A;  2E10 A;  4QQD A;  2YLC A;  1M1K C;  2K4Y A;  1M1F A;  2PVD B;  1V29 B;  4HA8 A;  2MMP A;  2R57 A;  4N0A C;  3CCS T;  3P8D A;  2E70 A;  1BYM A;  1LOJ A;  3CBP A;  2XIC A;  3OYI A;  3RIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...