2A7YA

Solution structure of the conserved hypothetical protein rv2302 from the bacterium mycobacterium tuberculosis
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
b'MHAKVGDYLVVKGTTTERHDQHAEIIEVRSADGSPPYVVRWLVNGHETTVYPGSDAVVVTATEHAEAEKRAAARAGHAAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Rv2302/MT2359
publication title Solution structure of the conserved hypothetical protein Rv2302 from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08940 DUF1918 Domain of unknown function (DUF1918)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.440 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2a7yA00
2A7YA
chains in the Genus database with same CATH superfamily
3P8DA 1M2VB 1X01A 2E5QA 4FT2A 3QYHB 1F1BB 5IAYA 1ZSZC 3RIRA 1M1KR 3C95A 2EKHA 2M51A 1VQ4A 2DJZA 2DJQA 2DTIA 3M0TA 1M1FA 1WGSA 1SG5A 1YJWT 1GXIE 1GBQA 1WQ7A 3CC7A 2CYZB 4C92E 1WXBA 2J6OA 3L1AA 3ZFJA 3S3OA 1LOJA 2DEQA 1X6BA 2R57A 1YJNT 3CC2T 4OMNA 5FU7C 4M78B 2CSIA 2NUTB 3EG0A 5HCKA 2E70A 2ZZDA 1KQ2A 2IIMA 2KXCA 1CKBA 3OYNA 1GCQA 2L3RA 4PJNA 2RO0A 2XG8D 1KJWA 3A8GB 1IB8A 1Q7YR 4RKUE 2KRMA 3CCMA 3EG9B 1AT1B 1MMDA 4KH0B 2HAXA 2BUDA 1KHCA 3MO8A 5GMKj 1J3TA 1VIEA 3CPWA 4BB7A 4JJBA 1ZLMA 3L2WA 1Y71A 4Y92A 3AHUA 2NWMA 1YJWA 4Z02A 1MMNA 2VUBA 1UGPB 3PVQA 5CKEA 4JPBW 1WZOA 4QVDA 2R58A 4XU1A 5CVIA 2GFUA 4R55A 4NL2A 3VJPA 4J7IA 4Y91A 2CH4W 1EX4A 1YJNA 3JB9F 1QMCA 4A4HA 4C8QC 7AT1B 4NS5A 2YLCA 4MMKA 1QVGA 1M1GA 4P5NA 4C92B 2ED1A 1MUZA 3JSCA 2COYA 4C8QF 4FYYB 1TSFA 5FW9A 4OB2B 1RAHB 2X9HA 4QQDA 2DIGA 5CKBA 4QQGA 4L5GA 5GAN4 3CMAQ 2XDBA 1X2QA 4CC2A 1GBRA 1A0NB 5IN1A 2CDTA 4B6MA 2LCCA 2V8KA 3IQLA 1NBEB 1JJ2S 2MWOA 1SEMA 2F2XA 1VQ8A 3QO3A 4C5IA 5HK3A 1B7TA 4IUQA 5LJ5d 1VQMQ 3ASKA 1D1BA 3QJ6A 4EIKA 5A0LA 2YWWA 4PNOA 5D6WA 2HL3A 4J6XA 3JCMg 1U06A 3FLGA 3QG1A 2CP7A 1I0CA 2RHYA 4FT4A 3G1JA 5IHNA 3SEMA 3FJ5A 3NGPA 2RHUA 1SHGA 2E41A 3V7SA 2LX7A 5GAOr 1VYUA 5KYYA 2JTEA 2CKKA 3VYHB 2J6KA 2LZ6B 3A8LB 4LDVA 4OMOA 3LX7A 3S3MA 4B9WA 4M77D 3INZA 5EG2A 4PKCC 2VXEA 4FYWB 1KHIA 4C5GA 4M7DC 2K9GA 3REBB 5GAOl 1VYVA 1KQSP 2SEMA 3GIBA 2L5QA 2C0TA 2H3JA 2PVGB 1SSFA 2QDLA 1KC8C 1TU0B 4M7DF 4OGCA 3MEAA 2X3XD 3WXMB 1KIKA 3I9QA 1X43A 2X35A 4FU6A 2P84A 1TUCA 3CMAT 5LJ5f 1X6OA 5LJ3j 1NLOC 1ZA2B 2JUFA 2VWFA 2L3PA 2DE0X 4DQ2A 4KUDK 2KDSA 2ZAEA 3DLMA 3C12A 1WA7A 2ZPFB 4N4HA 2DIQA 4RUGA 2JVVA 1UE9A 1M3CA 4PJLA 3E9GA 2IVWA 4JJCA 5GAOm 3EGDB 4HT9A 2QQAA 2PQWA 1KQSS 2ECZA 1VQOA 3CXCP 1SHFA 3SWNA 4PJOD 4C0FA 3OYAA 4RTTA 3X26B 4M77E 4E7SA 4MDXA 3C0CA 3RNJA 4IIOA 2NLUA 2CUBA 1M2VA 2RM4A 4LDWA 3THKA 4D6WA 2HMAA 5GAN5 1SPKA 1E6HA 3E2UA 4MMLA 4E47A 4RTXA 5GAMe 3M57A 2AKKA 1QQJA 4LXCA 2HKNA 3CMAA 2YHTA 5GMKh 4XTUA 4M4ZA 1YI2Q 1NYGA 1K73C 4CI0C 1TOVA 3QUIA 1YBYA 2QQ9A 2OX7A 2DF6A 2FRWA 4M78A 5CIUA 2LQ8A 1UGQB 3CXCS 1QVFP 3HP9A 4WF2A 1HYOA 5GAN3 1M30A 5IXBA 1M5Q1 1QVPA 2M0OA 3OYMA 4FSXA 2VYTA 1PG5B 3VUBA 4JRIA 2RNAA 2RJFA 3CCQA 3M56A 2LT4A 1V29B 2OTJA 3L2UA 3JCMd 1S1NA 1GCPA 4EMKA 4PJOE 5CKFA 4ATOA 2DXBA 1MV3A 1WXTA 5I22A 1NJIR 1KD1C 1RADB 3VU3C 1UECA 5GAMf 4PFPA 2LNVA 2YRVA 3URGA 3RDVA 4M77B 5CKHA 1K9MC 5IXFA 2C06A 4PJMA 3CCJQ 2M16A 1Y57A 1W2BA 1HK9A 5FWBA 3HTRA 3L2QA 3MJXA 1QVFS 4E7LA 3CCRQ 2EQKA 2LQNA 1AWOA 4JLIA 2HCKA 2DEUA 2EGAA 1KSWA 2E5KA 2CT3A 2MMPA 3HRUA 3CCVA 1PCXA 4C92A 3VRYA 1M1KC 4KH1B 4D8KA 1OU9A 4OMLA 3L42A 2AZSA 2CT4A 5CQYA 4ZGDB 5HK0A 3I56Q 3BY7A 2DL5A 2DZCA 2YUOA 4C5HA 5GAN8 1G3YA 5KE3A 2E65A 3KBGA 1M8VA 2QG9B 2W0ZA 1S72Q 4AT1B 2DL8A 4C0DB 5GMKl 2DXUA 4J9HA 4M75D 3S3NA 4C8QD 1VUBA 2DL4A 2DERA 1VQLQ 3TU4K 2LDMA 2CH4A 3QDRB 1TWBA 1Q7YC 2EYYA 3OBWA 2DETA 1M3AA 5LJ3h 5DLOA 3CCEQ 2KROA 2KT1A 2EPDA 4J7FA 1VQ7Q 4AFZC 3CCJT 3PTAA 2RK1A 3OS5A 3EFSA 1FMKA 4AFQC 3CCRT 4PLLA 3CQTA 2HKQB 1WDXA 2J05A 3A5ZB 4RTVA 5GAN6 1HSQA 4A54A 1Q86R 3PT9A 3LLRA 1R0CB 2DVJA 2QDYB 1W4SA 5GMKm 1SSHA 4RCCA 4DBHA 1ACMB 4AG1C 2DLPA 1M90R 1AWWA 4HCZA 3OYJA 3OSVA 2RI3A 3L2VA 3CC7Q 1UB4A 4JRKA 4N4IA 4M7AC 2KBTA 4ZTFA 8ATCB 3I56T 2BZXA 2GTJA 2LP5A 4M75E 1X27A 1K0SA 1LCKA 1OZ3A 4DBFA 2LT1A 4HCCA 1G3WA 2EJ9A 4M7AF 2KAFA 2RJDA 4L59A 2YSQA 1S72T 2EKOA 4D8DA 2QK0A 3JV3A 1QKWA 4ELYC 1MMGA 2LNHB 3EGDA 1BI2A 3E1SA 1G2BA 1OQKA 3CCJA 5FU6B 2M02A 2ATCB 1VQLT 3OYLA 4PJOG 3RKXA 1TS9A 1BCOA 4XTZA 2EBPA 2XK0A 3CCRA 1IO6A 1G3SA 2RB6A 4GLMA 5KYUA 2SRCA 2K2MA 2QASA 2YUQA 2VGMA 3CCET 1GFCA 3UWNA 5J3BA 4BY6C 4Z8AA 4EMGA 3UA6A 1VQ7T 4A4GA 1YJWQ 1WYXA 4LN2A 4X34A 1R0BG 3CPFA 2MIOA 4KRTA 1LJOA 4JJDA 2D0NA 3QYGB 3OW2P 3CMEA 5A2QE 1GCQC 3Q1JA 2XDPA 1B3QA 2RA2A 1OPLA 4IUTA 4J6YA 2EGEA 1S72A 2DYBA 2K2VA 4XU3A 5EC7A 2Z0WA 1NPPA 4PJJA 3LGFA 3CC7T 1TUDA 2M9UA 3OSSC 1RL2A 1VQLA 3LH0A 2QI2A 4E7HA 1K73U 1FX7A 3M0UA 2HQHA 2A08A 1OI1A 2ED0A 4DBRA 5KH6A 2BE7D 1B34A 2V8JA 4AMCA 2DTOA 2XKOC 5LJ5g 1N6AA 3NTKA 1VQ8Q 3I55A 1Y0MA 4FSSA 2RHIA 3OW2S 1I1JA 2CUDA 2JM9A 3H6ZA 3FJPA 2RI5A 1UFFA 2B8AA 4M77A 2OAUA 1IGUA 2FG0A 2DPPB 2XDDA 3JAME 2LMJA 4PFOA 4A53A 3BE3A 3HHTB 2M1HA 4BDZA 1KD1U 2ZPBB 2M0YA 2DX1A 1VQ9A 2Y4YA 1I81A 1UGRB 2HD0A 3MP8A 1OV3A 2DRKA 2BKDN 1K9MU 1IZ6A 2FEIA 3LYIA 5KCOA 2O9SA 2JW4A 1B07A 2A7YA 5GANe 3LWIA 3ME9A 2FO0A 4A4EA 1UJ0A 5M9OA 5CCAA 3HL8A 3L2RA 3HRTA 1VA7A 2FPDA 2AT1B 1UTIA 4TVRA 5CR2A 3OYGA 1M1KU 4M75G 4C8QG 2XHCA 4MZPA 3GOXA 4EMKB 1K8AR 1VIFA 2LTOA 4PJOA 1G83A 2PVOB 4CC4B 2JT4A 3DB3A 3MP6A 3MP1A 1XJWB 1VQ8T 2HNIA 5GJVB 2RH2A 1JJ2P 4PLIA 3TQ7P 2P0PA 2RHXA 1JQQA 1WJSA 1M2OA 1VQOQ 1X6GA 1KG1A 1NJIC 3UDCA 2CP2A 4JJNK 2JOYA 2QYZA 2RJCA 5GANf 2H3EB 5CK9A 3WVEB 3C4SA 2FPFA 1Q7YU 2F5TX 1VQKA 1XQHA 4OMQA 2K79A 3FRNA 1Q82U 2CP5A 4KGXB 3HFNA 2F69A 1I07A 4AG2C 2EIFA 2Y4XA 2Y90A 1LVKA 3META 1KQ1A 5DY9A 4XU2A 1Y96B 2FVUA 2QTVA 3EG2A 4WCIA 1ZHIA 2EJFA 2P0KA 1I5OB 2EQJA 2DM1A 3OS2A 1X75C 4A63B 4C0ZA 3V8JA 1D0ZA 3TREA 1TXQA 2RQUA 4M7DG 2NYSA 3JCMX 1CSKA 4BD3A 2LX9A 5GAN7 3SWNC 4F7UG 1FWZA 4LD9K 3HKSA 3OBYA 4OB1B 3VS2A 2GF7A 3CCQQ 3OS1A 1D0XA 1YCSB 3JCMh 2OTJQ 4AFSC 2P4TA 2JMCA 4C5EA 2RQVA 1WJRA 3V7RA 5D7UA 4X1VA 2DO3A 4O6JA 2D0QB 2LQWA 1MMAA 1UG1A 4M7AD 4DEYA 1VQOT 1PM3A 2PUOB 2PNIA 1O9SA 3I5RA 3JCMc 2KSSA 4N0AA 5I2MA 4M78C 2VVKA 1U1SA 1OYXA 2VXFA 2EQUA 3QKJA 4M78F 2EFIA 4OVAA 2YT6A 5KYXA 3U23A 3X20B 1Q86C 3EG1A 1ZA1B 3CCLQ 3PMIA 3CCVQ 1VQNQ 1PSEA 1UUEA 2BZYA 4EMKC 9ATCB 3OYHA 1M90C 4M75A 3VS4A 2O88A 2K3XA 4JUVA 2A0FB 3X25B 1SF9A 2DBMA 3JB9J 3H0IA 4DEXA 3UPUA 1QLYA 2CREA 1WPYA 1N9SA 3R6NA 1NEGA 4BE1A 3CCQT 4XTXA 5LL6S 3E19A 1NM7A 2OTJT 1ZUUA 5KYUB 3UF4A 4RTUA 3LW5E 4ME7A 2EVRA 1AHJB 2RK2A 4JS5A 1YP5A 1PWTA 2FL7A 4C92C 1Q81R 5GAMd 2DRMA 1NG2A 2FPEA 2GCXA 4BI4A 1UGSB 1BKBA 2MOXA 1Z9ZA 3PFSA 2DXTA 4C92F 2JMAA 3O8VA 3M55A 1PKSA 4V2SA 3CD6Q 1BI0A 5J39A 3G71Q 3NHNA 3M53A 2VB6A 4OB3B 4XAXB 5CAIA 3PIPA 1DJ7B 1RI9A 4EDUA 4BE0A 2BZ8A 3GPLA 2I0NA 3CCLT 3CCVT 1VQNT 4BUGA 2DNUA 2RMOA 3QHSA 5GAN2 3OA6A 2HDAA 3CBOA 2DD5A 4OMMA 3EH1A 3KFVA 4F7UA 3R6OA 2JN0A 2F2WA 1B34B 2X4WA 4BI3A 1I4K1 4MDWA 3BFMA 3HPWA 1RLPC 1RABB 1RACB 2PU9B 3CPWP 1WHHA 3MPUB 2PVDB 4Q5WA 1M3BA 1TH7A 3OYFA 2DK3A 1H641 2C0IA 1KK7A 4ZTJA 2LJ1A 4JZ3A 1VQ5T 3MCAB 3V8LA 2YUNA 2MWPA 3QZ9B 3EHQA 4ZGJB 3SFMA 4ZN1A 3HSBA 4XTVA 1WHMA 3CCLA 1NYFA 1VQNA 1IHWA 3MEWA 2XI9A 3V7CA 3CD6T 5LJ5j 4LUDA 3G71T 1WIEA 2WSCE 3UA7A 1NZ9A 4E6RA 2L2PA 3AT1B 2X4XA 3JRZA 2DYIA 2RPNA 4HT8A 1R8OB 4LE9A 3OYEA 3OYIA 3CMEQ 3JB9D 3CPWS 3JCMP 1Y96A 4ESRA 3OYCA 1BI1A 1ABOA 1NE8A 2L3SA 1E6GA 1Y07A 2HBWA 3JCMV 5KYNA 2E6NA 2FZCB 1HD3A 1N8RR 3EFOA 2H8HA 4CC7A 2RF0A 3LWHA 3G4SQ 4K11A 1ZQ1A 4PJOB 1H3HA 4J9DA 5KYWB 1VQ5A 1D09B 2JS0A 2CZ7B 1QW1A 1UDLA 2ZPGB 3RMSA 2LCSA 2RQTA 2DD4A 4KUIA 1T0JA 2X4YA 4E7JA 1QVGS 1N27A 4IIMA 1K8AC 2QQSA 4M7AG 1PRMC 5ECAA 3UT1A 2K7AA 3I55Q 3X24B 4KULA 3CD6A 2PTKA 3OY9A 3G71A 1JJ2A 4UC4A 2BTTA 2KVQG 2KQWA 1K9AA 2EYQA 3DB4A 3EFRA 6AT1B 1BU1A 1SKUB 1FYNA 3T9NA 5GMKe 1PHTA 2LJ0A 2F5KA 4J9FA 3CBPA 1VQ9Q 1LNXA 4XTWA 3VS3A 3EG3A 1ZSZB 5GANg 3L2ZA 3QZ5B 2KGTA 1QWEA 3NTIA 3CMET 3PNWC 1YCYA 3VRZA 4J9GA 4R56A 2RI2A 4LUEA 4C8QE 4ORZA 3FEOA 2DAQA 4QKUA 1KC8U 3VUZA 3RERA 2KI7A 1OX8A 4OB0B 2CP6A 1C6VX 2ZGWA 1K76A 3H9NA 4J9IA 3VS1A 3EH2A 5KE2A 5GMKi 3DLLA 1Q86U 4M7DD 2FZGB 4M77C 3G4ST 2RQWA 1X2KA 3OB9A 5FU7B 1NLPC 1WX6A 5I21A 2K5IA 4DOVA 1OZ2A 2K5FA 1M90U 3OS0A 2A28A 4FW2A 4M77F 4VUBA 5GJWB 4EPCA 1PKTA 2GQVA 5CO7A 3GNFB 1BYMA 3JB9I 4OGEA 2X4JA 4RTWA 1VQ6Q 4RG8A 3I55T 2ENMA 4BI8B 3A1PA 4GY5A 2C0OA 3CCSA 3MKDA 3ER0A 3M5AA 2HL5C 4OMFB 3J7AF 1VYTA 2FRYA 2KXDA 1KQSA 4JZ4A 1MNEA 2E1HA 5DM7R 5KYXB 1Q95G 1VQPA 3CBMA 1IGQA 1X69A 1VQKQ 2CP0A 1ZBXA 1G5VA 4C0DC 4JRQA 5IHKA 1VQ9T 2KYMA 1WHJA 4HVUA 4L6V5 3G4SA 2KR3A 4HA8A 1ZX6A 2COWA 2YRDA 2MCNA 4M75B 3M0QA 4PJOC 4C8QB 3SB2A 4M7DE 3TCJA 1M9SA 1YHQA 2GQIA 4F7UE 4QVZA 3G7ZA 2DKGA 3EGXB 2KNBB 3RUXA 4JRPA 1RAAB 2FB7A 2IPOB 5A0DA 4PJOF 2V1QA 3OQ5A 1JXOA 2EQMA 5LJ5h 3JCMb 4LD6A 2AZVA 4FW1A 1RUWA 4MZMA 3CXCA 1OOTA 4F16A 2GGRA 3M0RA 5C6SA 3QBYA 2NUPB 1WJQA 2J7IA 3M58A 4ZGEB 5LJ3e 4CC3A 3OYBA 1VQ6T 3HRSA 1W2BP 4ZNXA 3TVTA 4A4KA 4PL6A 2YXYA 2QQBA 2K6DA 4DBQA 2QA4A 5IT9E 2R5AA 2ZCFB 2EWNA 4E7KA 3OYYA 2F2VA 1Q81C 1U1TA 4J6WA 2QEXA 1FXXA 4FYVB 2P4RA 5AT1B 5GANd 1QWFA 3BDLA 2MPXC 5I2SA 3JB9H 3JB9G 2IG0A 3A98A 4IUPA 2E64A 2EGCA 2AK5A 2QGGA 1E7OA 1Z9QA 1VQKT 3M54A 1D3BB 3RKWA 3S6WA 2J6FA 1RAEB 3GBQA 1QP2A 1QVFA 3A8MB 4B9XA 3CC4Q 1BIBA 4M7DB 5FU6C 3LGLA 4PFZA 2WSFE 4F7UB 3KXTA 4LDUA 2BIVA 3BW1A 2RQRA 3GNGA 2ABLA 2HQEA 2O4XA 1W2BS 3OMCA 2KK4A 1OPKA 5KYWA 5KCHA 1M8MA 2KRNA 5LJ3f 2O2OA 1VQ6A 3VYGA 2JZ2A 1Y7XA 4KBMB 2JM8A 1IXDA 4N0AC 4KGVB 3OYDA 1Q82R 4NL3A 3H0FA 2KY9A 3QPHA 2K3YA 2HEQA 4OMPA 5C0MA 3CCUQ 4HXJA 1ZUYA 1ARKA 3G6EQ 2E4HA 2CZ6B 4II1A 1UEBA 4HVWA 5GAMg 2E6ZA 5GAMh 2G3RA 1K8AU 3DKMA 3ZEHA 1XNIA 1RAGB 4DOWA 4NOYA 3CC2A 3H41A 2OI3A 2RN8A 2CZ1B 1YITQ 3ULRB 2CZ0B 1AZEA 1RAFB 2FYKA 4M75C 5FWCA 2V1RA 2BE9B 5FLXE 2G6FX 2A36A 2YUPA 1RAIB 1U8RA 1ZSZA 5CQXA 1K4US 2O01E 4GBQA 3A8OB 2JXBA 4M75F 5HKCA 3KUFA 4OP0A 3FIFA 3ZBDA 4QQ6A 3CC4T 3EFOB 1TUGB 2OTLQ 2GNCA 2LVMA 1AEYA 2L0AA 4M78G 1RLQC 2DTHA 1U5SA 5I11A 3NTHA 4IUUA 1WXUA 1N8RC 1PRLC 1T3LA 3JCMJ 2GFAA 5LJ5e 2OAWA 2EYWA 4PK4A 2WSEE 2XMFA 1WFWA 1YWOA 2MYSA 1FMWA 2RHZA 3V8KA 3FC3A 4IURA 2DL7A 3NMZC 3EAEA 1T0HA 4F17A 2B86A 3MEUA 2FHDA 1D1CA 4HCKA 2YDLA 2L8DA 1BIAA 3CCUT 2MF2A 1EIFA 2WACA 3PIOA 1BBZA 1WLPB 3G6ET 4AFUC 1D1AA 1D0YA 2O31A 1MGQA 1OU8A 2QAZA 1YN8A 3VS6A 4MZTA 1XOVA 4Z88A 3CC4A 4RMOA 1YITT 2QQRA 4X9CA 1K0XA 1AWXA 2EAYA 1BK2A 4J9CA 3WVDB 3TSWA 4HCBA 1N5ZA 4E2FB 4C92G 3J81E 3QWYA 4E7IA 4C8QA 1YJ9Q 1JO8A 4F7UF 1P92A 3GLXA 3EGXA 5AYFA 4IKFA 2HZYA 3ZL7C 2YRCA 2OTLT 3EGUA 2ZPHB 1N9RA 1QP3A 4J83A 1QCOA 2DL3A 1AOJA 4X9DA 3VS5A 4M7AE 3CCUA 1YIJQ 2J06A 3G6EA 3NFCA 1VQ5Q 1VQMT 1MNDA 5GANj 3QWXX 1YFNA 3H8ZA 1ZSGA 2E10A 1EFNA 2NUPA 2GBQA 4JS4A 1YITA 2AHJB 3REAB 2DILA 2E3HA 2COZA 1AD5A 3M9QA 3OYKA 1MHNA 1SRLA 1EZZB 2VV5A 1NPRA 3BDUA 4FM4B 1UGVA 3OW2A 1G8XA 4F04B 4J9EA 2W10A 3X28B 3VS0A 4QT7A 2OTLA 1WHKA 2K3BA 1W70A 3M0PA 3E9FA 4YTLA 1D3BA 3VKIA 2D9TA 5DLQE 1H3ZA 3H0HA 3FDRA 1Q81U 2ROTA 4M7DA 4OF1A 2A37A 1YJ9T 1HXDA 2NUTA 3D7SB 4HVVA 1AVZC 3I5SA 3N5BB 1HJDA 4FCYA 2EJGA 4Y28E 1VQMA 4QVCA 4BACA 3HFOA 2JTMA 1O75A 2CGHA 2LCLA 1G3TA 4N4GA 5GAOn 2VGNA 1FMVA 4M7AB 4ELZC 3F70A 2ZPIB 3JCMe 2DMOA 3EG9A 1ZUKA 2ESWA 3A8HB 1YIJT 4RTYA 1JRIA 2HSEB 1WQWA 1NEBA 1T3SA 1V76A 2K57A 3C94A 4ZN3A 1SRMA 2XIDA 3SHWA 5IH2A 3RBBB 4C0GA 1PD0A 4A4FA 1ABQA 2EYZA 1BCMA 1UJYA 4JDSA 1QVGP 1MV0B 2XICA 2DXCA 1TG0A 1KFZA 1NJIU 1WI7A 1YJ9A 2ROLA 4XQ3A 5A0GA 3CCSQ 1JU5C 2LC4A 2PZ1A 1IREB 1UHCA 5FRNA 4KT0E 2JS2A 4BY6B 2AIRB 2D8JA 2CS7A 1YI2T 1R77A 5D6XA 1VQPQ 5GAOq 2JTFA 3M4YA 2L3QA 4RTZA 5GAOp 3JCMf 1YIJA 2D1XA 2O4XB 3M59A 4ANJA 3GP8A 1YHQQ 1PNJA 3PGGA 1ZBJA 3JCMW 1IHVA 3MEVA 4DA4A 1IRXA 3TSZA 3MHXA 2HSPA 4FL6A 2EW3A 1AZGB 2F1LA 3RKYA 2EQIA 2KRSA 1YWPA 2LQKA 3FB9A 4FIBA 1GRIA 1CKAA 1QCNA 5D6YA 3PMTA 2JNGA 4JLGA 5CKDA 1PD1A 3RR6A 5LJ3g 3VV0A 2MI6A 1N8RU 2VKNA 4E7ZA 1Q82C 4CRIA 2X51A 2GTOA 4M77G 4HKEA 5J26A 1YI2A 5L8RE 1PC0A 1JXMA 2DBKA 5L23A 3UATA 1KC8R 1QCFA 5IHIA 2EYXA 2QA4Q 4LDXA 2LJ3A 1VOMA 2FZKB 3CCST 2LRQA 5GANh 4LDYA 2QEXQ 2L89A 2I2LA 1W6XA 4O5VA 1VQ4Q 4Z89A 4FYXB 4QW2A 3RESA 2D8HA 3P8HA 1VQPT 2VC8A 1QKXA 1H92A 2V8IA 2QTXA 2VASA 4F14A 2KEAA 3QJYA 1BI3A 1WNLA 5GAMj 4M78D 3LH5A 1V1CA 3QXEB 4BDYA 3P8BB 1OEBA 2NUZA 1JB0E 1YHQT 2HQXA 4LNPA 1JBMA 4XU0A 4RCBA 2XD0A 1GFDA 1LPLA 2R5MA 4BE2A 3M0SA 3J80E 1C1AA 2DVEA 2PUKB 1OX9A 2OJ2A 2YLBA 4RG2A 2P0QA 2V26A 3QDFA 3CCMQ 2O9VA 3I35A 3GF5A 3QIIA 4J5YA 2E12A 1M4ZA 5KYYB 1K73R 1I5LA 1PSFA 4R0KA 2K5LA 1WHLA 5FRMA 3TEEA 1W1FA 8AT1B 2QGFB 2HBPA 1RI0A 2QA4T 4XK8E 3O5ZA 1BB9A 1I8FA 3I56A 1TTHB 1WHGA 3CEYA 1YJNQ 3CC2Q 2A3LA 2CP3A 2QEXT 2KMTA 2D6FA 3EHRA 1VQ4T 2MAMA 5HY6A 2DFUA 4EMHA 2KYBA 4M78E 3M4GA 4C92D 1GL5A 3OMGA 1UHFA 4J9BA 1C0MA 2RJEA 1YNZA 4XTYA 1AWJA 1H8KA 3RMQA 1OULA 3PE0A 5FROA 2AKLA 2ZPEB 1U3OA 2XU8A 2JJ9A 3JCMQ 3SDZA 1KD1R 2DA9A 2KE9A 1K1ZA 2RD1A 4M7AA 3NPFA 2K4YA 3VS7A 2QXFA 2MK5A 1K9MR 2X3WD 2DZ9A 3CCEA 2E3IA 5LJ3d 3PVLA 3SD4A 1XTDA 1VQ7A 2CSQA 1M27C 4IUVA 2KT8A 4J8OA 3SWNB 4WTOB 1JEGA 4KGZB 4GLKA 3QSUA 3CCMT
chains in the Genus database with same CATH topology
3P8DA 3OA6A 2QDYB 1N8RC 1W4SA 5GMKm 1X01A 2E5QA 4FT2A 2GFAA 3CBOA 2DD5A 3JCMJ 3QYHB 5LJ5e 4RCCA 5IAYA 2WSEE 4F7UA 4HCZA 3OYJA 3OSVA 3R6OA 2JN0A 3RIRA 3C95A 2RHZA 1B34B 2RI3A 3V8KA 2DJZA 2DTIA 4IURA 3L2VA 2X4WA 3FC3A 1VQ4A 3EAEA 1UB4A 4JRKA 4BI3A 1I4K1 1M1FA 3MEUA 4N4IA 1WGSA 2FHDA 1YJWT 4M7AC 1GXIE 4MDWA 1WQ7A 4ZTFA 3BFMA 3I56T 2L8DA 3HPWA 1BIAA 3CC7A 2CYZB 3CCUT 2PU9B 4C92E 2MF2A 1EIFA 2WACA 3L1AA 3ZFJA 4M75E 1LOJA 2PVDB 4Q5WA 3PIOA 3G6ET 3S3OA 1OZ3A 1TH7A 3OYFA 2DEQA 2LT1A 2DK3A 4HCCA 1G3WA 1MGQA 2EJ9A 2R57A 1YJNT 4M7AF 2KAFA 3CC2T 2RJDA 4L59A 1H641 1S72T 5FU7C 2EKOA 4M78B 4ZTJA 4ELYC 1VQ5T 3MCAB 4MZTA 1XOVA 3V8LA 2E70A 3CC4A 2ZZDA 2MWPA 1BI2A 4RMOA 3E1SA 3CCJA 1YITT 3OYNA 1KQ2A 5FU6B 2QQRA 3QZ9B 2L3RA 4ZGJB 4X9CA 4PJOG 3OYLA 1VQLT 3RKXA 2EAYA 4XTZA 2RO0A 3WVDB 3SFMA 4ZN1A 2XG8D 2XK0A 3CCRA 4HCBA 3HSBA 4XTVA 3A8GB 1G3SA 2RB6A 3CCLA 1VQNA 4C92G 3J81E 4E7IA 3MEWA 4RKUE 4C8QA 3CCMA 2XI9A 2HAXA 2BUDA 3V7CA 4F7UF 1KHCA 2VGMA 3CCET 3CD6T 1P92A 3MO8A 5GMKj 3UWNA 5J3BA 5LJ5j 3G71T 3GLXA 5AYFA 2WSCE 1VIEA 4BY6C 4EMGA 1NZ9A 3CPWA 4IKFA 4BB7A 1VQ7T 4A4GA 2OTLT 2X4XA 3JRZA 3L2WA 1Y71A 4X34A 4HT8A 1R8OB 3OYEA 3OYIA 3CPFA 2ZPHB 3CPWS 3JCMP 1N9RA 3JB9D 1Y96A 3AHUA 3OYCA 1BI1A 1QP3A 4J83A 1NE8A 1YJWA 4Z02A 1LJOA 2VUBA 4X9DA 1Y07A 1UGPB 3QYGB 5CKEA 3CMEA 4M7AE 5A2QE 3CCUA 3Q1JA 3JCMV 3G6EA 4QVDA 2R58A 4XU1A 3NFCA 5CVIA 2GFUA 2E6NA 4R55A 2XDPA 4NL2A 3VJPA 4J7IA 4Y91A 1VQMT 1YJNA 3JB9F 5GANj 2RA2A 3LWHA 4IUTA 4J6YA 3H8ZA 1ZQ1A 1S72A 2E10A 2K2VA 4XU3A 4PJOB 4A4HA 1NPPA 4C8QC 1VQ5A 3LGFA 3CC7T 4JS4A 2CZ7B 1QW1A 2ZPGB 4NS5A 3RMSA 2YLCA 4MMKA 1YITA 1QVGA 2AHJB 1M1GA 4P5NA 2M9UA 3OSSC 1RL2A 4C92B 2DD4A 1VQLA 3LH0A 2QI2A 4E7HA 1K73U 1FX7A 4KUIA 1OI1A 2X4YA 3M9QA 3OYKA 3JSCA 4C8QF 4E7JA 1QVGS 1N27A 1K8AC 2QQSA 4OB2B 4M7AG 1MHNA 4QQDA 2DIGA 5CKBA 5KH6A 2VV5A 1NPRA 4L5GA 4QQGA 3UT1A 5GAN4 2XDBA 3X24B 3BDUA 1B34A 4KULA 4FM4B 2V8JA 3OW2A 3OY9A 3CD6A 3G71A 1JJ2A 4UC4A 2DTOA 2XKOC 5IN1A 2KVQG 2KQWA 5LJ5g 1N6AA 3NTKA 3X28B 3I55A 2EYQA 2OTLA 3DB4A 2LCCA 2V8KA 2RHIA 3OW2S 3E9FA 4YTLA 3EFRA 1JJ2S 1D3BA 3VKIA 3H6ZA 2MWOA 2D9TA 5DLQE 1H3ZA 1VQ8A 3FJPA 2RI5A 3QO3A 4C5IA 5HK3A 2B8AA 4IUQA 3FDRA 4M77A 3T9NA 5LJ5d 1Q81U 4LD9K 2OAUA 4M7DA 5GMKe 4OF1A 3ASKA 2DPPB 1YJ9T 1HXDA 3QJ6A 2XDDA 2F5KA 3JAME 5A0LA 3N5BB 2EJGA 3CBPA 4PNOA 3HHTB 1LNXA 4J6XA 3FLGA 3QG1A 4Y28E 5D6WA 2M1HA 3JCMg 4QVCA 4XTWA 4BACA 4BDZA 1KD1U 2RHYA 3HFOA 2JTMA 2ZPBB 4FT4A 5GANg 4M7DC 3L2ZA 3QZ5B 1O75A 2CGHA 3NTIA 3CMET 3PNWC 1YCYA 1VQ9A 2LCLA 2Y4YA 1G3TA 2RHUA 4N4GA 1I81A 4R56A 1UGRB 2RI2A 4C8QE 2E41A 2HD0A 3MP8A 3V7SA 2VGNA 4M7AB 2BKDN 4ELZC 3FEOA 3F70A 1IZ6A 5GAOr 1K9MU 2ZPIB 3LYIA 2DAQA 5KCOA 3JCMe 1KC8U 3VUZA 3RERA 3A8HB 2CKKA 3VYHB 1YIJT 3A8LB 4LDVA 4OB0B 2A7YA 5GANe 2ZGWA 3LX7A 3S3MA 4B9WA 3LWIA 3ME9A 1JRIA 4M77D 4A4EA 5KE2A 5GMKi 3DLLA 1Q86U 1WQWA 3INZA 5EG2A 4M7DD 4M77C 3G4ST 4PKCC 5M9OA 5CCAA 2VXEA 1KHIA 2K57A 3C94A 3HL8A 3OB9A 5FU7B 4C5GA 4ZN3A 5GAOl 3HRTA 4A53A 5I21A 2K5IA 4DOVA 2XIDA 1OZ2A 3GIBA 2L5QA 2K5FA 2H3JA 1M90U 2PVGB 1SSFA 3OS0A 4C0GA 4TVRA 5CR2A 3OYGA 1M1KU 4A4FA 4M77F 4VUBA 1KC8C 4M75G 4C8QG 4EPCA 4M7DF 2XHCA 4OGCA 3MEAA 2GQVA 5CO7A 3GNFB 1BYMA 4JDSA 3WXMB 4MZPA 2XICA 3JB9I 2DXCA 3GOXA 4OGEA 4EMKB 2X35A 4FU6A 1NJIU 2X4JA 1VIFA 2LTOA 3CMAT 5LJ5f 1X6OA 4RG8A 5LJ3j 3I55T 1YJ9A 4PJOA 4XQ3A 5A0GA 2JUFA 2PVOB 4GY5A 4BI8B 2LC4A 3DB3A 1IREB 3MP6A 3MP1A 4KT0E 5FRNA 4BY6B 4DQ2A 1VQ8T 4KUDK 2HNIA 2KDSA 3DLMA 2CS7A 3C12A 3CCSA 1YI2T 2RH2A 2ZPFB 3ER0A 3M5AA 4N4HA 4PLIA 5D6XA 5GAOq 2DIQA 4OMFB 2JTFA 2P0PA 3J7AF 2RHXA 1WJSA 3M4YA 2JVVA 1KQSA 3E9GA 2IVWA 1KG1A 5GAOp 5GAOm 2E1HA 5DM7R 1NJIC 4HT9A 2QQAA 3JCMf 3UDCA 2O4XB 3CBMA 1VQPA 4JJNK 2JOYA 1YIJA 3M59A 2PQWA 3GP8A 2RJCA 1ZBXA 5GANf 1KQSS 1VQOA 1G5VA 4C0DC 5CK9A 4JRQA 3WVEB 1VQ9T 3C4SA 1Q7YU 4L6V5 3G4SA 2F5TX 3PGGA 3SWNA 4HA8A 4C0FA 3OYAA 3X26B 3JCMW 4PJOD 1VQKA 1XQHA 4M77E 4M75B 4MDXA 3MEVA 4PJOC 4C8QB 3SB2A 4DA4A 2NLUA 4M7DE 3TCJA 1M9SA 3FRNA 1YHQA 1Q82U 3MHXA 2RM4A 4F7UE 3HFNA 4QVZA 3G7ZA 2F69A 4LDWA 2DKGA 4FL6A 4D6WA 3RUXA 3RKYA 4JRPA 2EIFA 2FB7A 5GAN5 2Y4XA 5A0DA 2Y90A 3META 4MMLA 1KQ1A 2LQKA 4E47A 5GAMe 3FB9A 4FIBA 3M57A 4PJOF 5DY9A 3OQ5A 4XU2A 1Y96B 2FVUA 3CMAA 2EQMA 5D6YA 2YHTA 3PMTA 5GMKh 5LJ5h 2JNGA 4JLGA 5CKDA 4XTUA 1ZHIA 2EJFA 3JCMb 2P0KA 4LD6A 5LJ3g 3VV0A 2MI6A 1K73C 4CI0C 2EQJA 1N8RU 3QUIA 3OS2A 1Q82C 1X75C 4CRIA 5GAOn 4C0ZA 3V8JA 4MZMA 3CXCA 4M77G 4HKEA 3TREA 1YBYA 2QQ9A 5J26A 1YI2A 5L8RE 4M7DG 3JCMX 4BD3A 2LX9A 5GAN7 3SWNC 4F7UG 1FWZA 4M78A 5C6SA 3QBYA 2LQ8A 3HKSA 1WJQA 3OBYA 4OB1B 3M58A 1UGQB 5CIUA 4ZGEB 5LJ3e 3CXCS 3HP9A 4WF2A 2GF7A 4LDXA 3OYBA 5GAN3 3OS1A 1VQ6T 1M5Q1 1QVPA 2M0OA 3OYMA 3HRSA 4FSXA 3JCMh 2VYTA 4A4KA 4PL6A 3VUBA 4JRIA 3CCST 2QQBA 2QA4A 2LRQA 5GANh 4LDYA 5IT9E 2RJFA 3CCQA 2R5AA 2L89A 2P4TA 2I2LA 2ZCFB 3M56A 2EWNA 1WJRA 2LT4A 4O5VA 4C5EA 4E7KA 3OYYA 3V7RA 1V29B 2OTJA 4QW2A 3RESA 3L2UA 3JCMd 2DO3A 1Q81C 1U1TA 4J6WA 2D0QB 4O6JA 2QEXA 1FXXA 3P8HA 1VQPT 2VC8A 5GANd 3BDLA 2V8IA 2QTXA 4M7AD 5I2SA 4EMKA 3JB9H 4PJOE 5CKFA 1VQOT 3QJYA 3JB9G 2IG0A 1BI3A 4ATOA 2PUOB 1WNLA 2DXBA 2E64A 4IUPA 5GAMj 4M78D 1O9SA 1VQMA 3QXEB 4BDYA 3JCMc 3VU3C 1KD1C 2KSSA 3M54A 3P8BB 1D3BB 4N0AA 5I2MA 3RKWA 1VQKT 4M78C 3S6WA 5GAMf 1JB0E 1U1SA 1QP2A 1YHQT 2HQXA 1OYXA 2LNVA 2YRVA 3URGA 1JBMA 4M77B 5CKHA 1QVFA 3A8MB 4RCBA 4XU0A 4B9XA 1K9MC 1BIBA 2XD0A 4M7DB 2C06A 5FU6C 3LGLA 2VXFA 2WSFE 4F7UB 2M16A 2R5MA 2EQUA 3KXTA 4BE2A 1W2BA 1HK9A 4LDUA 3J80E 2DVEA 2BIVA 3QKJA 3BW1A 3GNGA 4M78F 2EFIA 4OVAA 3L2QA 4E7LA 1QVFS 2PUKB 2EQKA 2HQEA 3X20B 2O4XA 1Q86C 2YLBA 1W2BS 3PMIA 3OMCA 4RG2A 4JLIA 2KK4A 2P0QA 5KCHA 1PSEA 5LJ3f 1VQ6A 3VYGA 2MMPA 3HRUA 4EMKC 3OYHA 3GF5A 2JZ2A 3CCVA 4C92A 1M90C 3QIIA 4J5YA 1Y7XA 2E12A 1M4ZA 4M75A 4KBMB 1M1KC 2K3XA 4JUVA 3X25B 4N0AC 1I5LA 1PSFA 3JB9J 3OYDA 3L42A 3CC2A 5CQYA 4NL3A 3UPUA 2K5LA 4ZGDB 2KY9A 3QPHA 2K3YA 5HK0A 5FRMA 1WPYA 3TEEA 1N9SA 5C0MA 3BY7A 2DZCA 2QA4T 2HBPA 1RI0A 4C5HA 5GAN8 4BE1A 3CCQT 4XK8E 2CZ6B 4XTXA 1G3YA 4II1A 5LL6S 2E65A 3E19A 1I8FA 3KBGA 5KE3A 3I56A 1UEBA 2OTJT 3CEYA 1M8VA 2A3LA 5GAMg 2QEXT 2KMTA 2E6ZA 4C0DB 5GAMh 2D6FA 1VQ4T 2G3RA 2MAMA 3DKMA 3LW5E 4ME7A 5HY6A 3ZEHA 4EMHA 1K8AU 4M78E 1XNIA 3M4GA 1AHJB 2RK2A 4C92D 3OMGA 4DOWA 2DXUA 4NOYA 4M75D 5GMKl 4JS5A 3S3NA 4C8QD 2CZ1B 1VUBA 3L2RA 2FL7A 4C92C 2CZ0B 2RJEA 4XTYA 2FYKA 4M75C 3TU4K 5GAMd 2LDMA 3RMQA 2GCXA 4BI4A 5FLXE 1UGSB 3QDRB 5FROA 1U8RA 2ZPEB 2XU8A 1BKBA 1Q7YC 3OBWA 5CQXA 3JCMQ 2O01E 3PFSA 2DXTA 3SDZA 4C92F 3O8VA 3A8OB 3M55A 4M75F 5HKCA 5LJ3h 4V2SA 5DLOA 3KUFA 1BI0A 2RD1A 3FIFA 4OP0A 5J39A 4M7AA 3M53A 3ZBDA 2K4YA 4QQ6A 3CC4T 4OB3B 4J7FA 2QXFA 4XAXB 3CCJT 3PTAA 2RK1A 5CAIA 2LVMA 3PIPA 1DJ7B 2DZ9A 3OS5A 4M78G 3CCEA 3EFSA 5LJ3d 2DTHA 4EDUA 3CCRT 4BE0A 3SD4A 1XTDA 1VQ7A 4PLLA 3GPLA 4IUVA 4J8OA 3CCLT 3NTHA 3A5ZB 5GAN6 3CCVT 1VQNT 3SWNB 4A54A 4BUGA 3CCMT 4GLKA 3QSUA 3PT9A 3QHSA 3LLRA 4IUUA 5GAN2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A7Y A; 
#chains in the Genus database with same CATH topology
 3P8D A;  1M2V B;  1X01 A;  2E5Q A;  4FT2 A;  3QYH B;  1F1B B;  5IAY A;  1ZSZ C;  3RIR A;  1M1K R;  3C95 A;  2EKH A;  2M51 A;  1VQ4 A;  2DJZ A;  2DJQ A;  2DTI A;  3M0T A;  1M1F A;  1WGS A;  1SG5 A;  1YJW T;  1GXI E;  1GBQ A;  1WQ7 A;  3CC7 A;  2CYZ B;  4C92 E;  1WXB A;  2J6O A;  3L1A A;  3ZFJ A;  3S3O A;  1LOJ A;  2DEQ A;  1X6B A;  2R57 A;  1YJN T;  3CC2 T;  4OMN A;  5FU7 C;  4M78 B;  2CSI A;  2NUT B;  3EG0 A;  5HCK A;  2E70 A;  2ZZD A;  1KQ2 A;  2IIM A;  2KXC A;  1CKB A;  3OYN A;  1GCQ A;  2L3R A;  4PJN A;  2RO0 A;  2XG8 D;  1KJW A;  3A8G B;  1IB8 A;  1Q7Y R;  4RKU E;  2KRM A;  3CCM A;  3EG9 B;  1AT1 B;  1MMD A;  4KH0 B;  2HAX A;  2BUD A;  1KHC A;  3MO8 A;  5GMK j;  1J3T A;  1VIE A;  3CPW A;  4BB7 A;  4JJB A;  1ZLM A;  3L2W A;  1Y71 A;  4Y92 A;  3AHU A;  2NWM A;  1YJW A;  4Z02 A;  1MMN A;  2VUB A;  1UGP B;  3PVQ A;  5CKE A;  4JPB W;  1WZO A;  4QVD A;  2R58 A;  4XU1 A;  5CVI A;  2GFU A;  4R55 A;  4NL2 A;  3VJP A;  4J7I A;  4Y91 A;  2CH4 W;  1EX4 A;  1YJN A;  3JB9 F;  1QMC A;  4A4H A;  4C8Q C;  7AT1 B;  4NS5 A;  2YLC A;  4MMK A;  1QVG A;  1M1G A;  4P5N A;  4C92 B;  2ED1 A;  1MUZ A;  3JSC A;  2COY A;  4C8Q F;  4FYY B;  1TSF A;  5FW9 A;  4OB2 B;  1RAH B;  2X9H A;  4QQD A;  2DIG A;  5CKB A;  4QQG A;  4L5G A;  5GAN 4;  3CMA Q;  2XDB A;  1X2Q A;  4CC2 A;  1GBR A;  1A0N B;  5IN1 A;  2CDT A;  4B6M A;  2LCC A;  2V8K A;  3IQL A;  1NBE B;  1JJ2 S;  2MWO A;  1SEM A;  2F2X A;  1VQ8 A;  3QO3 A;  4C5I A;  5HK3 A;  1B7T A;  4IUQ A;  5LJ5 d;  1VQM Q;  3ASK A;  1D1B A;  3QJ6 A;  4EIK A;  5A0L A;  2YWW A;  4PNO A;  5D6W A;  2HL3 A;  4J6X A;  3JCM g;  1U06 A;  3FLG A;  3QG1 A;  2CP7 A;  1I0C A;  2RHY A;  4FT4 A;  3G1J A;  5IHN A;  3SEM A;  3FJ5 A;  3NGP A;  2RHU A;  1SHG A;  2E41 A;  3V7S A;  2LX7 A;  5GAO r;  1VYU A;  5KYY A;  2JTE A;  2CKK A;  3VYH B;  2J6K A;  2LZ6 B;  3A8L B;  4LDV A;  4OMO A;  3LX7 A;  3S3M A;  4B9W A;  4M77 D;  3INZ A;  5EG2 A;  4PKC C;  2VXE A;  4FYW B;  1KHI A;  4C5G A;  4M7D C;  2K9G A;  3REB B;  5GAO l;  1VYV A;  1KQS P;  2SEM A;  3GIB A;  2L5Q A;  2C0T A;  2H3J A;  2PVG B;  1SSF A;  2QDL A;  1KC8 C;  1TU0 B;  4M7D F;  4OGC A;  3MEA A;  2X3X D;  3WXM B;  1KIK A;  3I9Q A;  1X43 A;  2X35 A;  4FU6 A;  2P84 A;  1TUC A;  3CMA T;  5LJ5 f;  1X6O A;  5LJ3 j;  1NLO C;  1ZA2 B;  2JUF A;  2VWF A;  2L3P A;  2DE0 X;  4DQ2 A;  4KUD K;  2KDS A;  2ZAE A;  3DLM A;  3C12 A;  1WA7 A;  2ZPF B;  4N4H A;  2DIQ A;  4RUG A;  2JVV A;  1UE9 A;  1M3C A;  4PJL A;  3E9G A;  2IVW A;  4JJC A;  5GAO m;  3EGD B;  4HT9 A;  2QQA A;  2PQW A;  1KQS S;  2ECZ A;  1VQO A;  3CXC P;  1SHF A;  3SWN A;  4PJO D;  4C0F A;  3OYA A;  4RTT A;  3X26 B;  4M77 E;  4E7S A;  4MDX A;  3C0C A;  3RNJ A;  4IIO A;  2NLU A;  2CUB A;  1M2V A;  2RM4 A;  4LDW A;  3THK A;  4D6W A;  2HMA A;  5GAN 5;  1SPK A;  1E6H A;  3E2U A;  4MML A;  4E47 A;  4RTX A;  5GAM e;  3M57 A;  2AKK A;  1QQJ A;  4LXC A;  2HKN A;  3CMA A;  2YHT A;  5GMK h;  4XTU A;  4M4Z A;  1YI2 Q;  1NYG A;  1K73 C;  4CI0 C;  1TOV A;  3QUI A;  1YBY A;  2QQ9 A;  2OX7 A;  2DF6 A;  2FRW A;  4M78 A;  5CIU A;  2LQ8 A;  1UGQ B;  3CXC S;  1QVF P;  3HP9 A;  4WF2 A;  1HYO A;  5GAN 3;  1M30 A;  5IXB A;  1M5Q 1;  1QVP A;  2M0O A;  3OYM A;  4FSX A;  2VYT A;  1PG5 B;  3VUB A;  4JRI A;  2RNA A;  2RJF A;  3CCQ A;  3M56 A;  2LT4 A;  1V29 B;  2OTJ A;  3L2U A;  3JCM d;  1S1N A;  1GCP A;  4EMK A;  4PJO E;  5CKF A;  4ATO A;  2DXB A;  1MV3 A;  1WXT A;  5I22 A;  1NJI R;  1KD1 C;  1RAD B;  3VU3 C;  1UEC A;  5GAM f;  4PFP A;  2LNV A;  2YRV A;  3URG A;  3RDV A;  4M77 B;  5CKH A;  1K9M C;  5IXF A;  2C06 A;  4PJM A;  3CCJ Q;  2M16 A;  1Y57 A;  1W2B A;  1HK9 A;  5FWB A;  3HTR A;  3L2Q A;  3MJX A;  1QVF S;  4E7L A;  3CCR Q;  2EQK A;  2LQN A;  1AWO A;  4JLI A;  2HCK A;  2DEU A;  2EGA A;  1KSW A;  2E5K A;  2CT3 A;  2MMP A;  3HRU A;  3CCV A;  1PCX A;  4C92 A;  3VRY A;  1M1K C;  4KH1 B;  4D8K A;  1OU9 A;  4OML A;  3L42 A;  2AZS A;  2CT4 A;  5CQY A;  4ZGD B;  5HK0 A;  3I56 Q;  3BY7 A;  2DL5 A;  2DZC A;  2YUO A;  4C5H A;  5GAN 8;  1G3Y A;  5KE3 A;  2E65 A;  3KBG A;  1M8V A;  2QG9 B;  2W0Z A;  1S72 Q;  4AT1 B;  2DL8 A;  4C0D B;  5GMK l;  2DXU A;  4J9H A;  4M75 D;  3S3N A;  4C8Q D;  1VUB A;  2DL4 A;  2DER A;  1VQL Q;  3TU4 K;  2LDM A;  2CH4 A;  3QDR B;  1TWB A;  1Q7Y C;  2EYY A;  3OBW A;  2DET A;  1M3A A;  5LJ3 h;  5DLO A;  3CCE Q;  2KRO A;  2KT1 A;  2EPD A;  4J7F A;  1VQ7 Q;  4AFZ C;  3CCJ T;  3PTA A;  2RK1 A;  3OS5 A;  3EFS A;  1FMK A;  4AFQ C;  3CCR T;  4PLL A;  3CQT A;  2HKQ B;  1WDX A;  2J05 A;  3A5Z B;  4RTV A;  5GAN 6;  1HSQ A;  4A54 A;  1Q86 R;  3PT9 A;  3LLR A;  1R0C B;  2DVJ A;  2QDY B;  1W4S A;  5GMK m;  1SSH A;  4RCC A;  4DBH A;  1ACM B;  4AG1 C;  2DLP A;  1M90 R;  1AWW A;  4HCZ A;  3OYJ A;  3OSV A;  2RI3 A;  3L2V A;  3CC7 Q;  1UB4 A;  4JRK A;  4N4I A;  4M7A C;  2KBT A;  4ZTF A;  8ATC B;  3I56 T;  2BZX A;  2GTJ A;  2LP5 A;  4M75 E;  1X27 A;  1K0S A;  1LCK A;  1OZ3 A;  4DBF A;  2LT1 A;  4HCC A;  1G3W A;  2EJ9 A;  4M7A F;  2KAF A;  2RJD A;  4L59 A;  2YSQ A;  1S72 T;  2EKO A;  4D8D A;  2QK0 A;  3JV3 A;  1QKW A;  4ELY C;  1MMG A;  2LNH B;  3EGD A;  1BI2 A;  3E1S A;  1G2B A;  1OQK A;  3CCJ A;  5FU6 B;  2M02 A;  2ATC B;  1VQL T;  3OYL A;  4PJO G;  3RKX A;  1TS9 A;  1BCO A;  4XTZ A;  2EBP A;  2XK0 A;  3CCR A;  1IO6 A;  1G3S A;  2RB6 A;  4GLM A;  5KYU A;  2SRC A;  2K2M A;  2QAS A;  2YUQ A;  2VGM A;  3CCE T;  1GFC A;  3UWN A;  5J3B A;  4BY6 C;  4Z8A A;  4EMG A;  3UA6 A;  1VQ7 T;  4A4G A;  1YJW Q;  1WYX A;  4LN2 A;  4X34 A;  1R0B G;  3CPF A;  2MIO A;  4KRT A;  1LJO A;  4JJD A;  2D0N A;  3QYG B;  3OW2 P;  3CME A;  5A2Q E;  1GCQ C;  3Q1J A;  2XDP A;  1B3Q A;  2RA2 A;  1OPL A;  4IUT A;  4J6Y A;  2EGE A;  1S72 A;  2DYB A;  2K2V A;  4XU3 A;  5EC7 A;  2Z0W A;  1NPP A;  4PJJ A;  3LGF A;  3CC7 T;  1TUD A;  2M9U A;  3OSS C;  1RL2 A;  1VQL A;  3LH0 A;  2QI2 A;  4E7H A;  1K73 U;  1FX7 A;  3M0U A;  2HQH A;  2A08 A;  1OI1 A;  2ED0 A;  4DBR A;  5KH6 A;  2BE7 D;  1B34 A;  2V8J A;  4AMC A;  2DTO A;  2XKO C;  5LJ5 g;  1N6A A;  3NTK A;  1VQ8 Q;  3I55 A;  1Y0M A;  4FSS A;  2RHI A;  3OW2 S;  1I1J A;  2CUD A;  2JM9 A;  3H6Z A;  3FJP A;  2RI5 A;  1UFF A;  2B8A A;  4M77 A;  2OAU A;  1IGU A;  2FG0 A;  2DPP B;  2XDD A;  3JAM E;  2LMJ A;  4PFO A;  4A53 A;  3BE3 A;  3HHT B;  2M1H A;  4BDZ A;  1KD1 U;  2ZPB B;  2M0Y A;  2DX1 A;  1VQ9 A;  2Y4Y A;  1I81 A;  1UGR B;  2HD0 A;  3MP8 A;  1OV3 A;  2DRK A;  2BKD N;  1K9M U;  1IZ6 A;  2FEI A;  3LYI A;  5KCO A;  2O9S A;  2JW4 A;  1B07 A;  2A7Y A;  5GAN e;  3LWI A;  3ME9 A;  2FO0 A;  4A4E A;  1UJ0 A;  5M9O A;  5CCA A;  3HL8 A;  3L2R A;  3HRT A;  1VA7 A;  2FPD A;  2AT1 B;  1UTI A;  4TVR A;  5CR2 A;  3OYG A;  1M1K U;  4M75 G;  4C8Q G;  2XHC A;  4MZP A;  3GOX A;  4EMK B;  1K8A R;  1VIF A;  2LTO A;  4PJO A;  1G83 A;  2PVO B;  4CC4 B;  2JT4 A;  3DB3 A;  3MP6 A;  3MP1 A;  1XJW B;  1VQ8 T;  2HNI A;  5GJV B;  2RH2 A;  1JJ2 P;  4PLI A;  3TQ7 P;  2P0P A;  2RHX A;  1JQQ A;  1WJS A;  1M2O A;  1VQO Q;  1X6G A;  1KG1 A;  1NJI C;  3UDC A;  2CP2 A;  4JJN K;  2JOY A;  2QYZ A;  2RJC A;  5GAN f;  2H3E B;  5CK9 A;  3WVE B;  3C4S A;  2FPF A;  1Q7Y U;  2F5T X;  1VQK A;  1XQH A;  4OMQ A;  2K79 A;  3FRN A;  1Q82 U;  2CP5 A;  4KGX B;  3HFN A;  2F69 A;  1I07 A;  4AG2 C;  2EIF A;  2Y4X A;  2Y90 A;  1LVK A;  3MET A;  1KQ1 A;  5DY9 A;  4XU2 A;  1Y96 B;  2FVU A;  2QTV A;  3EG2 A;  4WCI A;  1ZHI A;  2EJF A;  2P0K A;  1I5O B;  2EQJ A;  2DM1 A;  3OS2 A;  1X75 C;  4A63 B;  4C0Z A;  3V8J A;  1D0Z A;  3TRE A;  1TXQ A;  2RQU A;  4M7D G;  2NYS A;  3JCM X;  1CSK A;  4BD3 A;  2LX9 A;  5GAN 7;  3SWN C;  4F7U G;  1FWZ A;  4LD9 K;  3HKS A;  3OBY A;  4OB1 B;  3VS2 A;  2GF7 A;  3CCQ Q;  3OS1 A;  1D0X A;  1YCS B;  3JCM h;  2OTJ Q;  4AFS C;  2P4T A;  2JMC A;  4C5E A;  2RQV A;  1WJR A;  3V7R A;  5D7U A;  4X1V A;  2DO3 A;  4O6J A;  2D0Q B;  2LQW A;  1MMA A;  1UG1 A;  4M7A D;  4DEY A;  1VQO T;  1PM3 A;  2PUO B;  2PNI A;  1O9S A;  3I5R A;  3JCM c;  2KSS A;  4N0A A;  5I2M A;  4M78 C;  2VVK A;  1U1S A;  1OYX A;  2VXF A;  2EQU A;  3QKJ A;  4M78 F;  2EFI A;  4OVA A;  2YT6 A;  5KYX A;  3U23 A;  3X20 B;  1Q86 C;  3EG1 A;  1ZA1 B;  3CCL Q;  3PMI A;  3CCV Q;  1VQN Q;  1PSE A;  1UUE A;  2BZY A;  4EMK C;  9ATC B;  3OYH A;  1M90 C;  4M75 A;  3VS4 A;  2O88 A;  2K3X A;  4JUV A;  2A0F B;  3X25 B;  1SF9 A;  2DBM A;  3JB9 J;  3H0I A;  4DEX A;  3UPU A;  1QLY A;  2CRE A;  1WPY A;  1N9S A;  3R6N A;  1NEG A;  4BE1 A;  3CCQ T;  4XTX A;  5LL6 S;  3E19 A;  1NM7 A;  2OTJ T;  1ZUU A;  5KYU B;  3UF4 A;  4RTU A;  3LW5 E;  4ME7 A;  2EVR A;  1AHJ B;  2RK2 A;  4JS5 A;  1YP5 A;  1PWT A;  2FL7 A;  4C92 C;  1Q81 R;  5GAM d;  2DRM A;  1NG2 A;  2FPE A;  2GCX A;  4BI4 A;  1UGS B;  1BKB A;  2MOX A;  1Z9Z A;  3PFS A;  2DXT A;  4C92 F;  2JMA A;  3O8V A;  3M55 A;  1PKS A;  4V2S A;  3CD6 Q;  1BI0 A;  5J39 A;  3G71 Q;  3NHN A;  3M53 A;  2VB6 A;  4OB3 B;  4XAX B;  5CAI A;  3PIP A;  1DJ7 B;  1RI9 A;  4EDU A;  4BE0 A;  2BZ8 A;  3GPL A;  2I0N A;  3CCL T;  3CCV T;  1VQN T;  4BUG A;  2DNU A;  2RMO A;  3QHS A;  5GAN 2;  3OA6 A;  2HDA A;  3CBO A;  2DD5 A;  4OMM A;  3EH1 A;  3KFV A;  4F7U A;  3R6O A;  2JN0 A;  2F2W A;  1B34 B;  2X4W A;  4BI3 A;  1I4K 1;  4MDW A;  3BFM A;  3HPW A;  1RLP C;  1RAB B;  1RAC B;  2PU9 B;  3CPW P;  1WHH A;  3MPU B;  2PVD B;  4Q5W A;  1M3B A;  1TH7 A;  3OYF A;  2DK3 A;  1H64 1;  2C0I A;  1KK7 A;  4ZTJ A;  2LJ1 A;  4JZ3 A;  1VQ5 T;  3MCA B;  3V8L A;  2YUN A;  2MWP A;  3QZ9 B;  3EHQ A;  4ZGJ B;  3SFM A;  4ZN1 A;  3HSB A;  4XTV A;  1WHM A;  3CCL A;  1NYF A;  1VQN A;  1IHW A;  3MEW A;  2XI9 A;  3V7C A;  3CD6 T;  5LJ5 j;  4LUD A;  3G71 T;  1WIE A;  2WSC E;  3UA7 A;  1NZ9 A;  4E6R A;  2L2P A;  3AT1 B;  2X4X A;  3JRZ A;  2DYI A;  2RPN A;  4HT8 A;  1R8O B;  4LE9 A;  3OYE A;  3OYI A;  3CME Q;  3JB9 D;  3CPW S;  3JCM P;  1Y96 A;  4ESR A;  3OYC A;  1BI1 A;  1ABO A;  1NE8 A;  2L3S A;  1E6G A;  1Y07 A;  2HBW A;  3JCM V;  5KYN A;  2E6N A;  2FZC B;  1HD3 A;  1N8R R;  3EFO A;  2H8H A;  4CC7 A;  2RF0 A;  3LWH A;  3G4S Q;  4K11 A;  1ZQ1 A;  4PJO B;  1H3H A;  4J9D A;  5KYW B;  1VQ5 A;  1D09 B;  2JS0 A;  2CZ7 B;  1QW1 A;  1UDL A;  2ZPG B;  3RMS A;  2LCS A;  2RQT A;  2DD4 A;  4KUI A;  1T0J A;  2X4Y A;  4E7J A;  1QVG S;  1N27 A;  4IIM A;  1K8A C;  2QQS A;  4M7A G;  1PRM C;  5ECA A;  3UT1 A;  2K7A A;  3I55 Q;  3X24 B;  4KUL A;  3CD6 A;  2PTK A;  3OY9 A;  3G71 A;  1JJ2 A;  4UC4 A;  2BTT A;  2KVQ G;  2KQW A;  1K9A A;  2EYQ A;  3DB4 A;  3EFR A;  6AT1 B;  1BU1 A;  1SKU B;  1FYN A;  3T9N A;  5GMK e;  1PHT A;  2LJ0 A;  2F5K A;  4J9F A;  3CBP A;  1VQ9 Q;  1LNX A;  4XTW A;  3VS3 A;  3EG3 A;  1ZSZ B;  5GAN g;  3L2Z A;  3QZ5 B;  2KGT A;  1QWE A;  3NTI A;  3CME T;  3PNW C;  1YCY A;  3VRZ A;  4J9G A;  4R56 A;  2RI2 A;  4LUE A;  4C8Q E;  4ORZ A;  3FEO A;  2DAQ A;  4QKU A;  1KC8 U;  3VUZ A;  3RER A;  2KI7 A;  1OX8 A;  4OB0 B;  2CP6 A;  1C6V X;  2ZGW A;  1K76 A;  3H9N A;  4J9I A;  3VS1 A;  3EH2 A;  5KE2 A;  5GMK i;  3DLL A;  1Q86 U;  4M7D D;  2FZG B;  4M77 C;  3G4S T;  2RQW A;  1X2K A;  3OB9 A;  5FU7 B;  1NLP C;  1WX6 A;  5I21 A;  2K5I A;  4DOV A;  1OZ2 A;  2K5F A;  1M90 U;  3OS0 A;  2A28 A;  4FW2 A;  4M77 F;  4VUB A;  5GJW B;  4EPC A;  1PKT A;  2GQV A;  5CO7 A;  3GNF B;  1BYM A;  3JB9 I;  4OGE A;  2X4J A;  4RTW A;  1VQ6 Q;  4RG8 A;  3I55 T;  2ENM A;  4BI8 B;  3A1P A;  4GY5 A;  2C0O A;  3CCS A;  3MKD A;  3ER0 A;  3M5A A;  2HL5 C;  4OMF B;  3J7A F;  1VYT A;  2FRY A;  2KXD A;  1KQS A;  4JZ4 A;  1MNE A;  2E1H A;  5DM7 R;  5KYX B;  1Q95 G;  1VQP A;  3CBM A;  1IGQ A;  1X69 A;  1VQK Q;  2CP0 A;  1ZBX A;  1G5V A;  4C0D C;  4JRQ A;  5IHK A;  1VQ9 T;  2KYM A;  1WHJ A;  4HVU A;  4L6V 5;  3G4S A;  2KR3 A;  4HA8 A;  1ZX6 A;  2COW A;  2YRD A;  2MCN A;  4M75 B;  3M0Q A;  4PJO C;  4C8Q B;  3SB2 A;  4M7D E;  3TCJ A;  1M9S A;  1YHQ A;  2GQI A;  4F7U E;  4QVZ A;  3G7Z A;  2DKG A;  3EGX B;  2KNB B;  3RUX A;  4JRP A;  1RAA B;  2FB7 A;  2IPO B;  5A0D A;  4PJO F;  2V1Q A;  3OQ5 A;  1JXO A;  2EQM A;  5LJ5 h;  3JCM b;  4LD6 A;  2AZV A;  4FW1 A;  1RUW A;  4MZM A;  3CXC A;  1OOT A;  4F16 A;  2GGR A;  3M0R A;  5C6S A;  3QBY A;  2NUP B;  1WJQ A;  2J7I A;  3M58 A;  4ZGE B;  5LJ3 e;  4CC3 A;  3OYB A;  1VQ6 T;  3HRS A;  1W2B P;  4ZNX A;  3TVT A;  4A4K A;  4PL6 A;  2YXY A;  2QQB A;  2K6D A;  4DBQ A;  2QA4 A;  5IT9 E;  2R5A A;  2ZCF B;  2EWN A;  4E7K A;  3OYY A;  2F2V A;  1Q81 C;  1U1T A;  4J6W A;  2QEX A;  1FXX A;  4FYV B;  2P4R A;  5AT1 B;  5GAN d;  1QWF A;  3BDL A;  2MPX C;  5I2S A;  3JB9 H;  3JB9 G;  2IG0 A;  3A98 A;  4IUP A;  2E64 A;  2EGC A;  2AK5 A;  2QGG A;  1E7O A;  1Z9Q A;  1VQK T;  3M54 A;  1D3B B;  3RKW A;  3S6W A;  2J6F A;  1RAE B;  3GBQ A;  1QP2 A;  1QVF A;  3A8M B;  4B9X A;  3CC4 Q;  1BIB A;  4M7D B;  5FU6 C;  3LGL A;  4PFZ A;  2WSF E;  4F7U B;  3KXT A;  4LDU A;  2BIV A;  3BW1 A;  2RQR A;  3GNG A;  2ABL A;  2HQE A;  2O4X A;  1W2B S;  3OMC A;  2KK4 A;  1OPK A;  5KYW A;  5KCH A;  1M8M A;  2KRN A;  5LJ3 f;  2O2O A;  1VQ6 A;  3VYG A;  2JZ2 A;  1Y7X A;  4KBM B;  2JM8 A;  1IXD A;  4N0A C;  4KGV B;  3OYD A;  1Q82 R;  4NL3 A;  3H0F A;  2KY9 A;  3QPH A;  2K3Y A;  2HEQ A;  4OMP A;  5C0M A;  3CCU Q;  4HXJ A;  1ZUY A;  1ARK A;  3G6E Q;  2E4H A;  2CZ6 B;  4II1 A;  1UEB A;  4HVW A;  5GAM g;  2E6Z A;  5GAM h;  2G3R A;  1K8A U;  3DKM A;  3ZEH A;  1XNI A;  1RAG B;  4DOW A;  4NOY A;  3CC2 A;  3H41 A;  2OI3 A;  2RN8 A;  2CZ1 B;  1YIT Q;  3ULR B;  2CZ0 B;  1AZE A;  1RAF B;  2FYK A;  4M75 C;  5FWC A;  2V1R A;  2BE9 B;  5FLX E;  2G6F X;  2A36 A;  2YUP A;  1RAI B;  1U8R A;  1ZSZ A;  5CQX A;  1K4U S;  2O01 E;  4GBQ A;  3A8O B;  2JXB A;  4M75 F;  5HKC A;  3KUF A;  4OP0 A;  3FIF A;  3ZBD A;  4QQ6 A;  3CC4 T;  3EFO B;  1TUG B;  2OTL Q;  2GNC A;  2LVM A;  1AEY A;  2L0A A;  4M78 G;  1RLQ C;  2DTH A;  1U5S A;  5I11 A;  3NTH A;  4IUU A;  1WXU A;  1N8R C;  1PRL C;  1T3L A;  3JCM J;  2GFA A;  5LJ5 e;  2OAW A;  2EYW A;  4PK4 A;  2WSE E;  2XMF A;  1WFW A;  1YWO A;  2MYS A;  1FMW A;  2RHZ A;  3V8K A;  3FC3 A;  4IUR A;  2DL7 A;  3NMZ C;  3EAE A;  1T0H A;  4F17 A;  2B86 A;  3MEU A;  2FHD A;  1D1C A;  4HCK A;  2YDL A;  2L8D A;  1BIA A;  3CCU T;  2MF2 A;  1EIF A;  2WAC A;  3PIO A;  1BBZ A;  1WLP B;  3G6E T;  4AFU C;  1D1A A;  1D0Y A;  2O31 A;  1MGQ A;  1OU8 A;  2QAZ A;  1YN8 A;  3VS6 A;  4MZT A;  1XOV A;  4Z88 A;  3CC4 A;  4RMO A;  1YIT T;  2QQR A;  4X9C A;  1K0X A;  1AWX A;  2EAY A;  1BK2 A;  4J9C A;  3WVD B;  3TSW A;  4HCB A;  1N5Z A;  4E2F B;  4C92 G;  3J81 E;  3QWY A;  4E7I A;  4C8Q A;  1YJ9 Q;  1JO8 A;  4F7U F;  1P92 A;  3GLX A;  3EGX A;  5AYF A;  4IKF A;  2HZY A;  3ZL7 C;  2YRC A;  2OTL T;  3EGU A;  2ZPH B;  1N9R A;  1QP3 A;  4J83 A;  1QCO A;  2DL3 A;  1AOJ A;  4X9D A;  3VS5 A;  4M7A E;  3CCU A;  1YIJ Q;  2J06 A;  3G6E A;  3NFC A;  1VQ5 Q;  1VQM T;  1MND A;  5GAN j;  3QWX X;  1YFN A;  3H8Z A;  1ZSG A;  2E10 A;  1EFN A;  2NUP A;  2GBQ A;  4JS4 A;  1YIT A;  2AHJ B;  3REA B;  2DIL A;  2E3H A;  2COZ A;  1AD5 A;  3M9Q A;  3OYK A;  1MHN A;  1SRL A;  1EZZ B;  2VV5 A;  1NPR A;  3BDU A;  4FM4 B;  1UGV A;  3OW2 A;  1G8X A;  4F04 B;  4J9E A;  2W10 A;  3X28 B;  3VS0 A;  4QT7 A;  2OTL A;  1WHK A;  2K3B A;  1W70 A;  3M0P A;  3E9F A;  4YTL A;  1D3B A;  3VKI A;  2D9T A;  5DLQ E;  1H3Z A;  3H0H A;  3FDR A;  1Q81 U;  2ROT A;  4M7D A;  4OF1 A;  2A37 A;  1YJ9 T;  1HXD A;  2NUT A;  3D7S B;  4HVV A;  1AVZ C;  3I5S A;  3N5B B;  1HJD A;  4FCY A;  2EJG A;  4Y28 E;  1VQM A;  4QVC A;  4BAC A;  3HFO A;  2JTM A;  1O75 A;  2CGH A;  2LCL A;  1G3T A;  4N4G A;  5GAO n;  2VGN A;  1FMV A;  4M7A B;  4ELZ C;  3F70 A;  2ZPI B;  3JCM e;  2DMO A;  3EG9 A;  1ZUK A;  2ESW A;  3A8H B;  1YIJ T;  4RTY A;  1JRI A;  2HSE B;  1WQW A;  1NEB A;  1T3S A;  1V76 A;  2K57 A;  3C94 A;  4ZN3 A;  1SRM A;  2XID A;  3SHW A;  5IH2 A;  3RBB B;  4C0G A;  1PD0 A;  4A4F A;  1ABQ A;  2EYZ A;  1BCM A;  1UJY A;  4JDS A;  1QVG P;  1MV0 B;  2XIC A;  2DXC A;  1TG0 A;  1KFZ A;  1NJI U;  1WI7 A;  1YJ9 A;  2ROL A;  4XQ3 A;  5A0G A;  3CCS Q;  1JU5 C;  2LC4 A;  2PZ1 A;  1IRE B;  1UHC A;  5FRN A;  4KT0 E;  2JS2 A;  4BY6 B;  2AIR B;  2D8J A;  2CS7 A;  1YI2 T;  1R77 A;  5D6X A;  1VQP Q;  5GAO q;  2JTF A;  3M4Y A;  2L3Q A;  4RTZ A;  5GAO p;  3JCM f;  1YIJ A;  2D1X A;  2O4X B;  3M59 A;  4ANJ A;  3GP8 A;  1YHQ Q;  1PNJ A;  3PGG A;  1ZBJ A;  3JCM W;  1IHV A;  3MEV A;  4DA4 A;  1IRX A;  3TSZ A;  3MHX A;  2HSP A;  4FL6 A;  2EW3 A;  1AZG B;  2F1L A;  3RKY A;  2EQI A;  2KRS A;  1YWP A;  2LQK A;  3FB9 A;  4FIB A;  1GRI A;  1CKA A;  1QCN A;  5D6Y A;  3PMT A;  2JNG A;  4JLG A;  5CKD A;  1PD1 A;  3RR6 A;  5LJ3 g;  3VV0 A;  2MI6 A;  1N8R U;  2VKN A;  4E7Z A;  1Q82 C;  4CRI A;  2X51 A;  2GTO A;  4M77 G;  4HKE A;  5J26 A;  1YI2 A;  5L8R E;  1PC0 A;  1JXM A;  2DBK A;  5L23 A;  3UAT A;  1KC8 R;  1QCF A;  5IHI A;  2EYX A;  2QA4 Q;  4LDX A;  2LJ3 A;  1VOM A;  2FZK B;  3CCS T;  2LRQ A;  5GAN h;  4LDY A;  2QEX Q;  2L89 A;  2I2L A;  1W6X A;  4O5V A;  1VQ4 Q;  4Z89 A;  4FYX B;  4QW2 A;  3RES A;  2D8H A;  3P8H A;  1VQP T;  2VC8 A;  1QKX A;  1H92 A;  2V8I A;  2QTX A;  2VAS A;  4F14 A;  2KEA A;  3QJY A;  1BI3 A;  1WNL A;  5GAM j;  4M78 D;  3LH5 A;  1V1C A;  3QXE B;  4BDY A;  3P8B B;  1OEB A;  2NUZ A;  1JB0 E;  1YHQ T;  2HQX A;  4LNP A;  1JBM A;  4XU0 A;  4RCB A;  2XD0 A;  1GFD A;  1LPL A;  2R5M A;  4BE2 A;  3M0S A;  3J80 E;  1C1A A;  2DVE A;  2PUK B;  1OX9 A;  2OJ2 A;  2YLB A;  4RG2 A;  2P0Q A;  2V26 A;  3QDF A;  3CCM Q;  2O9V A;  3I35 A;  3GF5 A;  3QII A;  4J5Y A;  2E12 A;  1M4Z A;  5KYY B;  1K73 R;  1I5L A;  1PSF A;  4R0K A;  2K5L A;  1WHL A;  5FRM A;  3TEE A;  1W1F A;  8AT1 B;  2QGF B;  2HBP A;  1RI0 A;  2QA4 T;  4XK8 E;  3O5Z A;  1BB9 A;  1I8F A;  3I56 A;  1TTH B;  1WHG A;  3CEY A;  1YJN Q;  3CC2 Q;  2A3L A;  2CP3 A;  2QEX T;  2KMT A;  2D6F A;  3EHR A;  1VQ4 T;  2MAM A;  5HY6 A;  2DFU A;  4EMH A;  2KYB A;  4M78 E;  3M4G A;  4C92 D;  1GL5 A;  3OMG A;  1UHF A;  4J9B A;  1C0M A;  2RJE A;  1YNZ A;  4XTY A;  1AWJ A;  1H8K A;  3RMQ A;  1OUL A;  3PE0 A;  5FRO A;  2AKL A;  2ZPE B;  1U3O A;  2XU8 A;  2JJ9 A;  3JCM Q;  3SDZ A;  1KD1 R;  2DA9 A;  2KE9 A;  1K1Z A;  2RD1 A;  4M7A A;  3NPF A;  2K4Y A;  3VS7 A;  2QXF A;  2MK5 A;  1K9M R;  2X3W D;  2DZ9 A;  3CCE A;  2E3I A;  5LJ3 d;  3PVL A;  3SD4 A;  1XTD A;  1VQ7 A;  2CSQ A;  1M27 C;  4IUV A;  2KT8 A;  4J8O A;  3SWN B;  4WTO B;  1JEG A;  4KGZ B;  4GLK A;  3QSU A;  3CCM T; 
#chains in the Genus database with same CATH homology
 3P8D A;  3OA6 A;  2QDY B;  1N8R C;  1W4S A;  5GMK m;  1X01 A;  2E5Q A;  4FT2 A;  2GFA A;  3CBO A;  2DD5 A;  3JCM J;  3QYH B;  5LJ5 e;  4RCC A;  5IAY A;  2WSE E;  4F7U A;  4HCZ A;  3OYJ A;  3OSV A;  3R6O A;  2JN0 A;  3RIR A;  3C95 A;  2RHZ A;  1B34 B;  2RI3 A;  3V8K A;  2DJZ A;  2DTI A;  4IUR A;  3L2V A;  2X4W A;  3FC3 A;  1VQ4 A;  3EAE A;  1UB4 A;  4JRK A;  4BI3 A;  1I4K 1;  1M1F A;  3MEU A;  4N4I A;  1WGS A;  2FHD A;  1YJW T;  4M7A C;  1GXI E;  4MDW A;  1WQ7 A;  4ZTF A;  3BFM A;  3I56 T;  2L8D A;  3HPW A;  1BIA A;  3CC7 A;  2CYZ B;  3CCU T;  2PU9 B;  4C92 E;  2MF2 A;  1EIF A;  2WAC A;  3L1A A;  3ZFJ A;  4M75 E;  1LOJ A;  2PVD B;  4Q5W A;  3PIO A;  3G6E T;  3S3O A;  1OZ3 A;  1TH7 A;  3OYF A;  2DEQ A;  2LT1 A;  2DK3 A;  4HCC A;  1G3W A;  1MGQ A;  2EJ9 A;  2R57 A;  1YJN T;  4M7A F;  2KAF A;  3CC2 T;  2RJD A;  4L59 A;  1H64 1;  1S72 T;  5FU7 C;  2EKO A;  4M78 B;  4ZTJ A;  4ELY C;  1VQ5 T;  3MCA B;  4MZT A;  1XOV A;  3V8L A;  2E70 A;  3CC4 A;  2ZZD A;  2MWP A;  1BI2 A;  4RMO A;  3E1S A;  3CCJ A;  1YIT T;  3OYN A;  1KQ2 A;  5FU6 B;  2QQR A;  3QZ9 B;  2L3R A;  4ZGJ B;  4X9C A;  4PJO G;  3OYL A;  1VQL T;  3RKX A;  2EAY A;  4XTZ A;  2RO0 A;  3WVD B;  3SFM A;  4ZN1 A;  2XG8 D;  2XK0 A;  3CCR A;  4HCB A;  3HSB A;  4XTV A;  3A8G B;  1G3S A;  2RB6 A;  3CCL A;  1VQN A;  4C92 G;  3J81 E;  4E7I A;  3MEW A;  4RKU E;  4C8Q A;  3CCM A;  2XI9 A;  2HAX A;  2BUD A;  3V7C A;  4F7U F;  1KHC A;  2VGM A;  3CCE T;  3CD6 T;  1P92 A;  3MO8 A;  5GMK j;  3UWN A;  5J3B A;  5LJ5 j;  3G71 T;  3GLX A;  5AYF A;  2WSC E;  1VIE A;  4BY6 C;  4EMG A;  1NZ9 A;  3CPW A;  4IKF A;  4BB7 A;  1VQ7 T;  4A4G A;  2OTL T;  2X4X A;  3JRZ A;  3L2W A;  1Y71 A;  4X34 A;  4HT8 A;  1R8O B;  3OYE A;  3OYI A;  3CPF A;  2ZPH B;  3CPW S;  3JCM P;  1N9R A;  3JB9 D;  1Y96 A;  3AHU A;  3OYC A;  1BI1 A;  1QP3 A;  4J83 A;  1NE8 A;  1YJW A;  4Z02 A;  1LJO A;  2VUB A;  4X9D A;  1Y07 A;  1UGP B;  3QYG B;  5CKE A;  3CME A;  4M7A E;  5A2Q E;  3CCU A;  3Q1J A;  3JCM V;  3G6E A;  4QVD A;  2R58 A;  4XU1 A;  3NFC A;  5CVI A;  2GFU A;  2E6N A;  4R55 A;  2XDP A;  4NL2 A;  3VJP A;  4J7I A;  4Y91 A;  1VQM T;  1YJN A;  3JB9 F;  5GAN j;  2RA2 A;  3LWH A;  4IUT A;  4J6Y A;  3H8Z A;  1ZQ1 A;  1S72 A;  2E10 A;  2K2V A;  4XU3 A;  4PJO B;  4A4H A;  1NPP A;  4C8Q C;  1VQ5 A;  3LGF A;  3CC7 T;  4JS4 A;  2CZ7 B;  1QW1 A;  2ZPG B;  4NS5 A;  3RMS A;  2YLC A;  4MMK A;  1YIT A;  1QVG A;  2AHJ B;  1M1G A;  4P5N A;  2M9U A;  3OSS C;  1RL2 A;  4C92 B;  2DD4 A;  1VQL A;  3LH0 A;  2QI2 A;  4E7H A;  1K73 U;  1FX7 A;  4KUI A;  1OI1 A;  2X4Y A;  3M9Q A;  3OYK A;  3JSC A;  4C8Q F;  4E7J A;  1QVG S;  1N27 A;  1K8A C;  2QQS A;  4OB2 B;  4M7A G;  1MHN A;  4QQD A;  2DIG A;  5CKB A;  5KH6 A;  2VV5 A;  1NPR A;  4L5G A;  4QQG A;  3UT1 A;  5GAN 4;  2XDB A;  3X24 B;  3BDU A;  1B34 A;  4KUL A;  4FM4 B;  2V8J A;  3OW2 A;  3OY9 A;  3CD6 A;  3G71 A;  1JJ2 A;  4UC4 A;  2DTO A;  2XKO C;  5IN1 A;  2KVQ G;  2KQW A;  5LJ5 g;  1N6A A;  3NTK A;  3X28 B;  3I55 A;  2EYQ A;  2OTL A;  3DB4 A;  2LCC A;  2V8K A;  2RHI A;  3OW2 S;  3E9F A;  4YTL A;  3EFR A;  1JJ2 S;  1D3B A;  3VKI A;  3H6Z A;  2MWO A;  2D9T A;  5DLQ E;  1H3Z A;  1VQ8 A;  3FJP A;  2RI5 A;  3QO3 A;  4C5I A;  5HK3 A;  2B8A A;  4IUQ A;  3FDR A;  4M77 A;  3T9N A;  5LJ5 d;  1Q81 U;  4LD9 K;  2OAU A;  4M7D A;  5GMK e;  4OF1 A;  3ASK A;  2DPP B;  1YJ9 T;  1HXD A;  3QJ6 A;  2XDD A;  2F5K A;  3JAM E;  5A0L A;  3N5B B;  2EJG A;  3CBP A;  4PNO A;  3HHT B;  1LNX A;  4J6X A;  3FLG A;  3QG1 A;  4Y28 E;  5D6W A;  2M1H A;  3JCM g;  4QVC A;  4XTW A;  4BAC A;  4BDZ A;  1KD1 U;  2RHY A;  3HFO A;  2JTM A;  2ZPB B;  4FT4 A;  5GAN g;  4M7D C;  3L2Z A;  3QZ5 B;  1O75 A;  2CGH A;  3NTI A;  3CME T;  3PNW C;  1YCY A;  1VQ9 A;  2LCL A;  2Y4Y A;  1G3T A;  2RHU A;  4N4G A;  1I81 A;  4R56 A;  1UGR B;  2RI2 A;  4C8Q E;  2E41 A;  2HD0 A;  3MP8 A;  3V7S A;  2VGN A;  4M7A B;  2BKD N;  4ELZ C;  3FEO A;  3F70 A;  1IZ6 A;  5GAO r;  1K9M U;  2ZPI B;  3LYI A;  2DAQ A;  5KCO A;  3JCM e;  1KC8 U;  3VUZ A;  3RER A;  3A8H B;  2CKK A;  3VYH B;  1YIJ T;  3A8L B;  4LDV A;  4OB0 B;  2A7Y A;  5GAN e;  2ZGW A;  3LX7 A;  3S3M A;  4B9W A;  3LWI A;  3ME9 A;  1JRI A;  4M77 D;  4A4E A;  5KE2 A;  5GMK i;  3DLL A;  1Q86 U;  1WQW A;  3INZ A;  5EG2 A;  4M7D D;  4M77 C;  3G4S T;  4PKC C;  5M9O A;  5CCA A;  2VXE A;  1KHI A;  2K57 A;  3C94 A;  3HL8 A;  3OB9 A;  5FU7 B;  4C5G A;  4ZN3 A;  5GAO l;  3HRT A;  4A53 A;  5I21 A;  2K5I A;  4DOV A;  2XID A;  1OZ2 A;  3GIB A;  2L5Q A;  2K5F A;  2H3J A;  1M90 U;  2PVG B;  1SSF A;  3OS0 A;  4C0G A;  4TVR A;  5CR2 A;  3OYG A;  1M1K U;  4A4F A;  4M77 F;  4VUB A;  1KC8 C;  4M75 G;  4C8Q G;  4EPC A;  4M7D F;  2XHC A;  4OGC A;  3MEA A;  2GQV A;  5CO7 A;  3GNF B;  1BYM A;  4JDS A;  3WXM B;  4MZP A;  2XIC A;  3JB9 I;  2DXC A;  3GOX A;  4OGE A;  4EMK B;  2X35 A;  4FU6 A;  1NJI U;  2X4J A;  1VIF A;  2LTO A;  3CMA T;  5LJ5 f;  1X6O A;  4RG8 A;  5LJ3 j;  3I55 T;  1YJ9 A;  4PJO A;  4XQ3 A;  5A0G A;  2JUF A;  2PVO B;  4GY5 A;  4BI8 B;  2LC4 A;  3DB3 A;  1IRE B;  3MP6 A;  3MP1 A;  4KT0 E;  5FRN A;  4BY6 B;  4DQ2 A;  1VQ8 T;  4KUD K;  2HNI A;  2KDS A;  3DLM A;  2CS7 A;  3C12 A;  3CCS A;  1YI2 T;  2RH2 A;  2ZPF B;  3ER0 A;  3M5A A;  4N4H A;  4PLI A;  5D6X A;  5GAO q;  2DIQ A;  4OMF B;  2JTF A;  2P0P A;  3J7A F;  2RHX A;  1WJS A;  3M4Y A;  2JVV A;  1KQS A;  3E9G A;  2IVW A;  1KG1 A;  5GAO p;  5GAO m;  2E1H A;  5DM7 R;  1NJI C;  4HT9 A;  2QQA A;  3JCM f;  3UDC A;  2O4X B;  3CBM A;  1VQP A;  4JJN K;  2JOY A;  1YIJ A;  3M59 A;  2PQW A;  3GP8 A;  2RJC A;  1ZBX A;  5GAN f;  1KQS S;  1VQO A;  1G5V A;  4C0D C;  5CK9 A;  4JRQ A;  3WVE B;  1VQ9 T;  3C4S A;  1Q7Y U;  4L6V 5;  3G4S A;  2F5T X;  3PGG A;  3SWN A;  4HA8 A;  4C0F A;  3OYA A;  3X26 B;  3JCM W;  4PJO D;  1VQK A;  1XQH A;  4M77 E;  4M75 B;  4MDX A;  3MEV A;  4PJO C;  4C8Q B;  3SB2 A;  4DA4 A;  2NLU A;  4M7D E;  3TCJ A;  1M9S A;  3FRN A;  1YHQ A;  1Q82 U;  3MHX A;  2RM4 A;  4F7U E;  3HFN A;  4QVZ A;  3G7Z A;  2F69 A;  4LDW A;  2DKG A;  4FL6 A;  4D6W A;  3RUX A;  3RKY A;  4JRP A;  2EIF A;  2FB7 A;  5GAN 5;  2Y4X A;  5A0D A;  2Y90 A;  3MET A;  4MML A;  1KQ1 A;  2LQK A;  4E47 A;  5GAM e;  3FB9 A;  4FIB A;  3M57 A;  4PJO F;  5DY9 A;  3OQ5 A;  4XU2 A;  1Y96 B;  2FVU A;  3CMA A;  2EQM A;  5D6Y A;  2YHT A;  3PMT A;  5GMK h;  5LJ5 h;  2JNG A;  4JLG A;  5CKD A;  4XTU A;  1ZHI A;  2EJF A;  3JCM b;  2P0K A;  4LD6 A;  5LJ3 g;  3VV0 A;  2MI6 A;  1K73 C;  4CI0 C;  2EQJ A;  1N8R U;  3QUI A;  3OS2 A;  1Q82 C;  1X75 C;  4CRI A;  5GAO n;  4C0Z A;  3V8J A;  4MZM A;  3CXC A;  4M77 G;  4HKE A;  3TRE A;  1YBY A;  2QQ9 A;  5J26 A;  1YI2 A;  5L8R E;  4M7D G;  3JCM X;  4BD3 A;  2LX9 A;  5GAN 7;  3SWN C;  4F7U G;  1FWZ A;  4M78 A;  5C6S A;  3QBY A;  2LQ8 A;  3HKS A;  1WJQ A;  3OBY A;  4OB1 B;  3M58 A;  1UGQ B;  5CIU A;  4ZGE B;  5LJ3 e;  3CXC S;  3HP9 A;  4WF2 A;  2GF7 A;  4LDX A;  3OYB A;  5GAN 3;  3OS1 A;  1VQ6 T;  1M5Q 1;  1QVP A;  2M0O A;  3OYM A;  3HRS A;  4FSX A;  3JCM h;  2VYT A;  4A4K A;  4PL6 A;  3VUB A;  4JRI A;  3CCS T;  2QQB A;  2QA4 A;  2LRQ A;  5GAN h;  4LDY A;  5IT9 E;  2RJF A;  3CCQ A;  2R5A A;  2L89 A;  2P4T A;  2I2L A;  2ZCF B;  3M56 A;  2EWN A;  1WJR A;  2LT4 A;  4O5V A;  4C5E A;  4E7K A;  3OYY A;  3V7R A;  1V29 B;  2OTJ A;  4QW2 A;  3RES A;  3L2U A;  3JCM d;  2DO3 A;  1Q81 C;  1U1T A;  4J6W A;  2D0Q B;  4O6J A;  2QEX A;  1FXX A;  3P8H A;  1VQP T;  2VC8 A;  5GAN d;  3BDL A;  2V8I A;  2QTX A;  4M7A D;  5I2S A;  4EMK A;  3JB9 H;  4PJO E;  5CKF A;  1VQO T;  3QJY A;  3JB9 G;  2IG0 A;  1BI3 A;  4ATO A;  2PUO B;  1WNL A;  2DXB A;  2E64 A;  4IUP A;  5GAM j;  4M78 D;  1O9S A;  1VQM A;  3QXE B;  4BDY A;  3JCM c;  3VU3 C;  1KD1 C;  2KSS A;  3M54 A;  3P8B B;  1D3B B;  4N0A A;  5I2M A;  3RKW A;  1VQK T;  4M78 C;  3S6W A;  5GAM f;  1JB0 E;  1U1S A;  1QP2 A;  1YHQ T;  2HQX A;  1OYX A;  2LNV A;  2YRV A;  3URG A;  1JBM A;  4M77 B;  5CKH A;  1QVF A;  3A8M B;  4RCB A;  4XU0 A;  4B9X A;  1K9M C;  1BIB A;  2XD0 A;  4M7D B;  2C06 A;  5FU6 C;  3LGL A;  2VXF A;  2WSF E;  4F7U B;  2M16 A;  2R5M A;  2EQU A;  3KXT A;  4BE2 A;  1W2B A;  1HK9 A;  4LDU A;  3J80 E;  2DVE A;  2BIV A;  3QKJ A;  3BW1 A;  3GNG A;  4M78 F;  2EFI A;  4OVA A;  3L2Q A;  4E7L A;  1QVF S;  2PUK B;  2EQK A;  2HQE A;  3X20 B;  2O4X A;  1Q86 C;  2YLB A;  1W2B S;  3PMI A;  3OMC A;  4RG2 A;  4JLI A;  2KK4 A;  2P0Q A;  5KCH A;  1PSE A;  5LJ3 f;  1VQ6 A;  3VYG A;  2MMP A;  3HRU A;  4EMK C;  3OYH A;  3GF5 A;  2JZ2 A;  3CCV A;  4C92 A;  1M90 C;  3QII A;  4J5Y A;  1Y7X A;  2E12 A;  1M4Z A;  4M75 A;  4KBM B;  1M1K C;  2K3X A;  4JUV A;  3X25 B;  4N0A C;  1I5L A;  1PSF A;  3JB9 J;  3OYD A;  3L42 A;  3CC2 A;  5CQY A;  4NL3 A;  3UPU A;  2K5L A;  4ZGD B;  2KY9 A;  3QPH A;  2K3Y A;  5HK0 A;  5FRM A;  1WPY A;  3TEE A;  1N9S A;  5C0M A;  3BY7 A;  2DZC A;  2QA4 T;  2HBP A;  1RI0 A;  4C5H A;  5GAN 8;  4BE1 A;  3CCQ T;  4XK8 E;  2CZ6 B;  4XTX A;  1G3Y A;  4II1 A;  5LL6 S;  2E65 A;  3E19 A;  1I8F A;  3KBG A;  5KE3 A;  3I56 A;  1UEB A;  2OTJ T;  3CEY A;  1M8V A;  2A3L A;  5GAM g;  2QEX T;  2KMT A;  2E6Z A;  4C0D B;  5GAM h;  2D6F A;  1VQ4 T;  2G3R A;  2MAM A;  3DKM A;  3LW5 E;  4ME7 A;  5HY6 A;  3ZEH A;  4EMH A;  1K8A U;  4M78 E;  1XNI A;  3M4G A;  1AHJ B;  2RK2 A;  4C92 D;  3OMG A;  4DOW A;  2DXU A;  4NOY A;  4M75 D;  5GMK l;  4JS5 A;  3S3N A;  4C8Q D;  2CZ1 B;  1VUB A;  3L2R A;  2FL7 A;  4C92 C;  2CZ0 B;  2RJE A;  4XTY A;  2FYK A;  4M75 C;  3TU4 K;  5GAM d;  2LDM A;  3RMQ A;  2GCX A;  4BI4 A;  5FLX E;  1UGS B;  3QDR B;  5FRO A;  1U8R A;  2ZPE B;  2XU8 A;  1BKB A;  1Q7Y C;  3OBW A;  5CQX A;  3JCM Q;  2O01 E;  3PFS A;  2DXT A;  3SDZ A;  4C92 F;  3O8V A;  3A8O B;  3M55 A;  4M75 F;  5HKC A;  5LJ3 h;  4V2S A;  5DLO A;  3KUF A;  1BI0 A;  2RD1 A;  3FIF A;  4OP0 A;  5J39 A;  4M7A A;  3M53 A;  3ZBD A;  2K4Y A;  4QQ6 A;  3CC4 T;  4OB3 B;  4J7F A;  2QXF A;  4XAX B;  3CCJ T;  3PTA A;  2RK1 A;  5CAI A;  2LVM A;  3PIP A;  1DJ7 B;  2DZ9 A;  3OS5 A;  4M78 G;  3CCE A;  3EFS A;  5LJ3 d;  2DTH A;  4EDU A;  3CCR T;  4BE0 A;  3SD4 A;  1XTD A;  1VQ7 A;  4PLL A;  3GPL A;  4IUV A;  4J8O A;  3CCL T;  3NTH A;  3A5Z B;  5GAN 6;  3CCV T;  1VQN T;  3SWN B;  4A54 A;  4BUG A;  3CCM T;  4GLK A;  3QSU A;  3PT9 A;  3QHS A;  3LLR A;  4IUU A;  5GAN 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...