2A88A

Crystal structure of a pantothenate synthetase, apo enzyme in c2 space group
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
276
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGADDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
publication title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 89
structure length 276
sequence length 287
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a88A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a88A01
3H9CA 5TGTA 1Q15A 5H7XA 2J5BA 3INNA 4I6JA 2A84A 1QRTA 2Z08A 4KPUB 3PRHA 1OWNA 3IH5A 2CV0A 1I6MA 3RK1A 3MUEA 2QUJA 1JIJA 1ILEA 3TZEA 2DXIA 4I6GA 3AFHA 5HUHA 2J4DA 4RPIA 4KR9A 4MUNA 3HGMA 1NP7A 1NYLA 1YUNA 3ND6A 3FY4A 4YP5A 3TNJA 2IJGX 1TFUA 2VTBB 1TQ8A 1M8PA 3AL0C 2E18A 1JIIA 1WXGA 2GKSA 3ZUGA 2AG6A 1MJHA 4ZT2A 2CFOA 4K03A 2DETA 3P0IA 3FHJA 1N78A 1QNFA 1JHDA 1O0BA 5DB4A 1IH8A 1F7UA 5LLTA 5JBNA 3KFLA 1J70A 1EE1A 3RK0A 1QU3A 3LOQA 4ARIA 3CVYA 1F4LA 2A88A 1V47A 4DDMA 1MAWA 1HYBA 3L93A 3N2YA 4FZJA 3PNBA 1RQGA 1EUYA 2JANA 4NX2A 3VRHA 1O94C 1U7DA 1IVSA 3UOWA 4WNYA 2CV1A 3NBKA 5TEWA 1PG0A 2CUZA 4G5FA 4J75A 1LW7A 1M8KA 1MB9A 2HGZA 1NZJA 2QUKA 5TEVA 3CVWA 2CYBA 5BNZA 1IQ0A 3H99A 1WZ2A 1R6UA 1X6VA 5DASA 4CT0A 3CR8A 2DR2A 4AS1A 4MUFA 4WSOA 4MWEA 1OWPA 5J59A 1TYCA 1J1UA 1IFXA 3G6KA 2QJFA 1Q19A 3IMGA 2QJOA 4S1OA 3H97A 4XFDA 4E1AA 2PG3A 2YWCA 4MUHA 1I6KA 1MBZA 2V0CA 2B7LA 3FH0A 2WSIA 4PBRA 2VXOA 3KT3A 3CLUC 1NUTA 1EFVB 4I6EA 1WXIA 4R0NA 2OQ2A 1N77A 3PNYA 2J07A 1N2GA 4NAUA 4OUDA 2D5BA 3MLAA 3UK2A 4UZEA 3H9BA 1GPMA 3RHSA 3COVA 1D2RA 2DPLA 4ZT3A 3RJZA 4MVYA 4EG3A 3IOBA 1NUPA 3GUZA 5DK4A 1KORA 3SEQA 3IODA 1PG2A 4F4HA 2D54A 2QUIA 1OBHA 3DV2A 4ZCPA 2WQ7A 1J20A 1JEDA 1NUQA 1XNJA 4EG8A 1O95D 2X1LA 2HZ7A 1Y42X 2H29A 4Q16A 1OD6A 4G5YA 1YULA 2OV4A 3IUBA 3FDXA 1N2JA 4MVCA 1KQNA 4R2MA 1N2IA 3CLTD 1ZH0A 1YIAA 1PFVA 4QRDA 3VGJA 2PFSA 1KP2A 1QJCA 2JAXA 3FI0A 3KT0A 4NATA 1YI8A 3QTBA 4EG5A 4MUEA 3TQOA 3SEZA 1J09A 1JECA 3K32A 5FNZA 2ZUFA 4MWDA 1MOPA 2GOYA 1O6BA 4MWCA 1N2EA 1JIKA 3G5AA 2A1TR 4EFKA 1YIDA 2YWBA 1U3DA 1H3FA 1GTSA 1OWLA 3MMXA 1Q11A 4NDAA 4DDHA 1FYDA 1FFYA 4ZT6A 4ZT7A 4JZYA 1I2DA 1JZSA 2O8VA 4MW6A 3IVCA 1OWOA 3NV7A 2PXHA 5FO1A 2DLCX 1WOYA 2WQ6A 1JILA 4OUDB 4R2LA 3HV0A 1JZQA 3CLSC 4X0EA 5K0SA 4L2IB 2A1TS 4DDKA 3Q4GA 2X1MA 1VLHA 4TS1A 2Z3VA 1EFPB 1GN8A 3HMQA 4MW1A 2XRYA 4PBTA 4MULA 3TQIA 4KR7A 1MB2A 1EJ2A 4U8HA 1KH3A 2BTEA 4MW5A 4KR6A 1S4MA 2PZBA 3IMCA 5K0TA 1DNPA 3D6VA 3MLBA 1VL2A 3IOEA 4CDMA 1JEEA 1H1TA 3N05A 3P52A 4RUKA 3ZJTA 2A1UB 3X1MA 3AG5A 2E0IA 3SZGA 4EF6A 1WY5A 1O96B 1G8HA 4H3SA 2HMAA 2YXNA 1B6TA 2G36A 2QJTA 1O97C 3SDBA 4BWVA 2PIDA 1N2BA 3TZLA 4DJAA 4MQ6A 4U7JA 3TS1A 1VBNA 2I1LA 3HZRA 4MW0A 2EL7A 2GM3A 4YBRA 3D6UA 1NSYA 3CLTC 3DO8A 3C8ZA 3VU8A 4MW4A 4ZCTA 1WXEA 1U0BB 3SZ3A 1K4KA 1IRXA 1NI5A 1EUQA 1Q77A 1WJGA 1VBKA 1V8FA 1GTRA 1ZUNA 1J1ZA 2VTBA 1IQUA 3A04A 1KKUA 3A4IA 4MUKA 1O5TA 4CQNA 1P7PA 3CLRD 2D13A 3DPIA 1G8FA 1ZJWA 1F7VA 1H3EA 4JFAA 5LFAA 1K92A 1QRSA 3PXUA 4ZCSA 3X1KA 3SP1A 1LI5A 1KP3A 1VBMA 1WQ3A 3GMIA 2E89A 4K0RA 1EXDA 3ND7A 2CV2A 3A2KA 1PFWA 1QQTA 3MXTA 1M8GA 4XSVA 4JXZA 3JXEA 3N8HA 1ULHA 4EG6A 1TYDE 3P0JA 3K9WA 3CVVA 1N2HA 1H3NA 1COZA 3CA8A 4KKVA 1XNHA 2E21A 4ZCQA 4F3RA 2AKEA 1T6YA 1KAQA 1MRZA 4NZPA 5DEOA 4MUIA 1A8HA 4XFJA 3IVXA 3ELBA 3E27A 3GLVA 5F23A 1GLNA 4MLPA 1U3CA 4GRIA 3HL4A 3Q12A 4ND7A 2J08A 1NUUA 2QTMA 4CDNA 1IHOA 2ZP1A 3AIIA 4Q93A 1WKBA 3ZXSA 2DEUA 2BYTA 3CLUD 3Q10A 2QUHA 3U1VA 1SURA 3KT6A 3RFFA 3AG6A 3ZGZA 1O0CA 1QU2A 2PZ8A 3FG9A 3RBAA 5KCMA 2YY5A 2XRZA 2WB2A 4PBSA 4GU5A 4MW9A 4DLPA 4HJRA 4EG7A 4J76A 3OP1A 3ZIUA 1NUSA 1G59A 5FO0A 1R6XA 4MW7A 2NZ2A 3SYTA 1M83A 1N75A 2DUMA 2DERA 1KQOA 3IDFA 1EFVA 3COWA 5H16A 3IUEA 1PFYA 3FNRA 5EKDA 4HK4A 2J09A 1UFVA 1ZH6A 1T9GR 1OWMA 4ZT4A 3COZA 1K4MA 3CVUA 1TYAE 4OJMX 1QRUA 1T6XA 3AKZA 1JMVA 3FIUA 4G6ZA 1GZUA 1MAUA 1NURA 1YUMA 1N1DA 4ZCRA 4JXXA 3OTWA 4YP6A 2JA2A 1G8GA 1X8XA 1T6ZA 3L92A 4UZFA 4YMIA 1T9GS 4MWBA 1XNGA 2TS1A 2V0GA 1CT9A 1M8FA 4HJXA 2EJCA 4ARCA 3LE8A 1KH1A 4MUJA 2CYCA 3BL5A 3CLRC 3I05A 1WQ4A 4EG4A 3LCJA 4HPWA 3X1JA 2CSXA 2CYAA 3ILVA 2O5RA 3S3TA 1BS2A 1O95C 1F9AA 4EG1A 2X3FA 3FWKA 4KPUA 1I6LA 1TEZA 3A05A 2NSYA 4NAHA 2IP1A 4MVWA 4AQ7A 2C5SA 1PFUA 3CLSD 3QE4A 2RD2A 1J21A 3H05A 4MUGA 4QREA 3COYA 3ZJUA 2RE8A 3IOCA 1M8JA 5AHWA 3DLAA 4A91A 1MC1A 1JGTA 1LI7A 5TS2A 1WXFA 4MW2A 3NBAA 3ISJA 3F3MA 3IVGA 1KH2A 1M1ZA 3HFJA 2QTNA 3FOCA 1O94D 2X0KA 1QTQA 1GAXA 3ZXIA 5J5AA 4DNXA 2A7XA 1XJQA 1TYBE 1U7XA 1OBCA 3UC5A 4MVXA 1IQRA 5J58A 5IJXA 4P2BA 3UMVA 4QBTA 3ZJVA 3KT8A 3IMEA 4L2IA 5IHXA 4ND6A 4JYZA 1EFPA 4ZT5A 3G59A 3CVXA 1N2OA 3QTTA 1K97A 2R5WA 5HG0A 1KQPA 2A86A 5LM3A 1KAMA 2ZUEA 4DE5A 3N9IA 2A4MA 3P0HA 4MAFA 1O97D 2Z09A 4YP7A 5HUJA 1KR2A 3ND5A 1R6TA 1WXHA 3PNVA 2PZAA 2AZXA 4EGAA 2CT8A 2H2AA 2A1UA 3UY4A 5KWVA 3FETA 4U63A 2QTRA 3M5WA 4PY2A 1N3LA 5KHAA 1O96A 2IELA
chains in the Genus database with same CATH superfamily
2XNDD 2QB5A 3A1WA 3MWEB 4O1MA 4WZAA 3R7NA 2OPBA 2FSIA 2J5BA 1W88B 3QYAA 5H7XA 1JDZA 1L9XA 2O05A 2VAWA 3M33A 4FWBA 4TN1A 2BGWA 4WRRA 3C48A 1H23A 1Z68A 1R50A 4LXIA 1JDTA 1AGNA 1FBTA 1RIFA 4HLNA 4QM6A 4Y2VA 4OJQA 3C16C 4ZVKA 4E88A 1ZCZA 1T10A 4KRFA 1I9GA 1A8UA 2A9PA 3L4SO 2ZS9A 4AJ4A 1Q0HA 3AFHA 5ELXA 3Q9LA 3HCCA 1NW5A 2JIBA 5ECDA 2C1EA 5HM6A 1CR0A 3PITA 1X7WB 1CDDA 3TNJA 5FWAA 3EXG2 4B5LA 1TFUA 1R4NA 1ZUNB 4G41A 3A6FA 1CKEA 1UZAA 1L4NA 3HBFA 3WMEA 1BDHA 2C2ZA 4CMGA 1A27A 1NA5A 3Q3GE 3B78A 3FPEA 3EOBI 4XJXA 5CYPA 3PENA 2R1TA 3FHJA 1SIOA 5HCNA 3PHLA 4BYGA 1L3BA 5B2ZA 1A8PA 1IH8A 4GUAA 4HH4A 2D74A 1XZNA 2E5WA 4UUPA 3RB8A 5FNVF 2YQZA 5I9SA 1UBSB 3TQFA 2EERA 1F4LA 4H16A 1KMNA 1WVIA 4JWKA 3OQ1A 2EKQA 1UJ5A 2DB3A 5G2OA 3VKWA 4YECA 3WGNA 4OP2A 1H4SA 2WTUA 1RXSA 1KDYA 3BC1A 4CEJB 5ESWA 1NMEA 2ZYUX 4KH0A 2R5NA 2GPWA 1KARA 1T5SA 4BKRA 4DG9A 1A71A 1NOKA 2BKAA 2OCXA 2XGJA 5EWJB 2ZIZA 3DTNA 4R8VA 3DNFA 3UXMA 1REQA 5JJCA 5J3JA 2XZOA 1WU7A 1GNSA 1N6PA 2UZ4A 4Z3KA 4GKKB 5E2IA 4Z3DA 1P1RA 4G5FA 1MVOA 3T7CA 4PLCA 3N53A 2PANA 2FHPA 1XLTA 3G1TA 3K0HA 4QUIA 3UW3A 2VC2B 4UMFA 1THTA 4O2AA 1E2NA 3VM6A 5DASA 4KLNA 4CT0A 2Q62A 3DZJA 4Q7EA 5J59A 1J5XA 3AVUA 2JLAA 3MQ2A 4FFVA 4GMGA 4OU5A 2Y71A 4EYEA 1RJ9A 3TQRA 3IAFA 3AF0A 5DU2A 2FA9A 1ZVQA 1XF1A 4G2NA 4KDCA 3IE0A 4OLFA 2W6JA 1RPNA 1DX4A 3GDOA 3O8LA 2HU5A 2XBLA 3PI6A 2IY9A 3OE7D 1A9YA 4DPMA 1DCMA 1FLNA 1H9AA 3G49A 3Q3IA 4Z1MA 4DJ5X 3LWDA 3FXAA 4HWOA 3ZGXA 3PQ7A 1A97A 4PC1A 5EG5A 2N1MA 1WRBA 3W5IA 3SE7A 2O8EA 3DOCA 3TF5A 2OXCA 4B3TB 5LQAA 1AGPA 1G5TA 4EYOA 4QEKA 1JXAA 4WKNA 1XMJA 1WXIA 1XKLA 4Z4EA 1YKGA 3LUDA 1JSCA 2FXIA 1V4VA 4KUHA 2RKOA 2D5BA 4E51A 3H5TA 3I2KA 2G3YA 4ZAXA 2CBZA 3A1CA 4ESOA 2X8BA 1ZLYA 2GBCA 2XBMA 2HMVA 1D2RA 2J8ZA 4YAWA 4QIHA 2TYSB 4JLPA 5BPHA 3NAQA 5JDCA 2FMFA 3IOBA 2KPOA 4LPSA 4P1ZA 1ZEJA 2ZUVA 1KORA 4NU5A 3PF9A 4X8OA 5FV4A 1NRXA 1OI4A 3DMTA 4JSYA 3STYA 2RHRA 2LRHA 2VUTA 1OBHA 3JQEA 1CUGA 2FPUA 3H11A 1J24A 2Q3HA 2QM0A 4GW3A 3O7WA 3PC3A 5EJGA 4JI3B 1X92A 2HEGA 4W99A 2H16A 3C6XA 1C9YA 2R751 1X2EA 4P80A 1GNTA 3O1JC 1WU8A 3LPDA 5JCOA 1QHXA 2FXVA 9MHTA 3N74A 2P27A 1TMYA 3OM0A 1EQAA 1BE0A 2ZRFA 1O3YA 4IRMA 4KQCA 4MLCA 5KTNA 2JFBA 2MR6A 3D7MA 4Y6QA 3E70C 4K6FA 3RYTC 4A6DA 3OOJA 2HDOA 4KLAA 1OC2A 3Q6NA 4B31A 4ZVTA 3AY6A 2A14A 1ZM3A 3KQQA 3TTSA 1UK7A 3N2KA 4PFJA 2VK1A 3C3DA 5F33A 4I1VA 5HOQA 4AKGA 5TLSA 5BY2A 5HA5A 1ZIDA 2XAAA 5I48A 1M33A 2H3HA 1MFPA 3GH3A 1SUDA 3KT0A 3C5VA 2H7VA 1GDDA 4QPNA 4AURA 2H1HA 1BGVA 3H6GA 3HPRA 3GVIA 3MRSA 2ZTSA 3EDYA 5KNCH 3HVUA 1ZVVA 1EK6A 4F56A 1QH1B 1I2BA 5GM1A 3D4OA 3DO6A 3BIWA 4DIDA 3O8RA 5FJJA 2X5JO 3L6EA 2ADFA 1N5DA 4D43A 3N7AA 4OV6B 3HXTA 4KXVA 4PCLA 3U1TA 4E11A 2FI1A 5IVPA 4LEIA 1U1CA 4DRYA 3D8NA 3RKRA 2J3LA 1NVFA 4UFNA 2EW1A 1NW3A 2JIMA 5LA6F 5E0OA 4D81A 4AFNA 1NPYA 1ONOA 4K9QA 3V4PB 1DU4A 2WIDA 2YDYA 1GG8A 1I2DA 4JZYA 5EYPB 3E7PA 2OGWA 5EUBA 4EKYA 5IJ0B 5ESXA 3IKMB 2PYIA 1PJAA 2CZQA 2IYRA 3H8WA 3Q5GA 4GMHA 4B83A 5DIFA 1MHTA 2H11A 4L3OA 5IC4A 1E5QA 1QFZA 1ABEA 4X0EA 5K0SA 4TTPA 1SELA 1Z17A 2H2HA 2RB4A 4TS1A 2WAOA 4M87A 4TMYA 4DV7B 1XA4A 1ST3A 2GZ3A 5E9QA 4Y2TA 3TI9A 4RZIA 3ISTA 2FZVA 2X2OA 4LXUA 3NQ41 4PM4A 4W5HA 1JL3A 3R9IA 3W7VA 3CFIA 1HL3A 1TGYA 2J6BA 1OXTA 1B41A 2FQXA 2SKCA 3K9BA 3U5TA 5HE8A 2OSVA 3VPAA 4OHXA 1UKYA 3KJXA 3FDJA 4GOJA 4NNJA 4PX5A 3IIIA 1KOLA 4DIEA 5K0TA 3L1IA 4V0OA 1QFJA 1GO2A 2O2CA 2YWDA 2ODWA 4L1KA 3RS8A 5KYWA 5BWOA 1QLWA 1VJGA 3PFNA 4CDMA 4ZDIA 1K0FA 5KYYA 3QVTA 3TLKA 4X66B 3L8FA 4JU8A 3EWNA 5AYVA 1DZ3A 2M6KA 2BV3A 4EF6A 2FW0A 1DCTA 1CK4A 2Z4RA 3NTUA 3YASA 2BM1A 1HGXA 1DTEA 1LWOA 3BTVA 3WFIA 3GFBA 4D2IA 1ORDA 4UKDA 4F46A 1H2EA 1OLUB 1DOAA 4ZVNA 1YRBA 3C43A 5DJ5A 5HRUA 3R4VA 4LYDA 3W0LB 4K81B 1E99A 2XEDA 4YRIA 5C1DA 2XY4A 2X1HA 5D5PA 1QYCA 1Z0KA 2RHLA 4CMAA 1HDRA 1CULC 3N0WA 3VVCA 1G41A 3OWXA 2P6RA 5EP4A 4RKYA 4LRWA 2OP1A 1RIIA 4GWGA 4DQLA 1CCWA 1HDYA 2XIQA 1YACA 2QQ0A 3RO7A 4UOEA 1ZM2A 2CDNA 1R27A 3GP3A 3MS2A 3H2HA 5LQSA 1HLGA 3RVQA 1M0WA 3BEDA 2OFOA 1FSSA 5H70A 1SBYA 2L69A 4F1WA 1WSAA 4TV8F 4E1BA 3N6XA 4BQPA 2CMGA 2EOAA 2ZYSA 3M89A 4G3XA 3WZLA 4D74A 1ODSA 3AF2A 1Q77A 4FKBA 1S8FA 2ZAGA 1DAIA 2DR0A 1L5HA 1EFRD 2CFIA 2PSDA 3L7LA 3C6BA 1RZUA 4A5SA 3A4IA 2VXYA 3QUBA 3C8DA 2X9QA 2D7JA 2QT0A 3FPCA 4EA9A 4X8HA 5FF9A 1L7MA 4ERNA 4E2XA 2R8PA 3NX4A 1E7QA 1NNI1 2BEKA 2Z8XA 3QVMA 4D9MA 2C04A 4PGFA 4F9FA 3W2GA 3H3FA 3U0VA 4O8ZA 5AKZA 5E4JA 5FOUA 5ICGA 1PJRA 2G7ZA 5LP1A 2NO9A 2ST1A 4DA6A 5C7LO 1JG6A 2PM8A 3I04A 1T8YA 4FE7A 9ABPA 2AI2A 1ADGA 3CE6A 2LCIA 2FGKA 1P2VA 1RXIA 2VKTA 1U31A 4ESEA 2CLSA 4GYJA 1LNSA 3C45A 4CF3A 3KQHA 2E21A 1EWRA 1Z0ZA 5COBA 3K4QA 3UGTA 3HUFA 2ZW9A 4HTAA 4KI7A 4PTLA 5DEOA 3JYOA 3D4LA 2G70A 1QR6A 2FSVA 2VYQA 2Z9CA 1S5PA 3IVXA 1MTZA 2A5JA 2JNWA 3OP4A 4Y2SA 3P32A 3I32A 1Y7LA 4L4UA 4TMTA 5KAMA 2LKCA 1ATIA 3HL4A 1AZLA 2ASVA 3HWWA 5IMBA 4F3NA 2Y1OA 2E1RA 2VH1A 3PUHA 1TXGA 1K08A 5IFLA 4OBEA 3OIUA 2QRLA 2QUHA 4MHSA 3JD0A 4QVGA 3BRWA 2XOXA 1HE2A 2JAWA 2PSSA 4IOMA 4B2IA 3QUSA 3SFVA 1NVUQ 3QEMB 1E1KA 3WV5A 3AEUB 4CMIA 4FE4A 4FFLA 3RBAA 3Q3JB 4I0WB 1UT5A 3JPWA 4EWLA 3TDMA 4DBLC 5CXUA 4Q4JB 3FOEC 2XRZA 1G9SA 1MXHA 3DFFA 3H3JA 4UQLA 1CFJA 1EINA 2QF7A 1QV6A 3OTGA 1D03A 2DHDA 4W1RA 5AUQA 5G1OA 1YC2A 2W71A 1K7FB 1C3EA 3LTEA 5CB8A 2R84A 1AVTA 3K0FA 4TXLA 3FJ1A 2IF0A 1IEVA 5TB5A 1DKNA 3KL4A 5GIOE 3AFOA 4PLVA 5H81A 5BWLA 1Z8HA 2FTKE 4HQOA 3W8NA 4Q7LA 4ZQFA 4FGJA 4AO8A 3PNMA 1IBCA 2O0JA 3WLJA 2GXAA 4II7A 1CUBA 4QUEA 4MQFB 4MTCA 3CVOA 4WFIA 5EIHA 4HLCA 1L5WA 1QGOA 2BEUB 2WHXA 1WXQA 3FPBA 4HN2A 3M5DA 2EF0A 4CNQA 3IUEA 4HQRA 1OX5A 5CTJA 2XQVA 3WAGA 5KDDA 3I2HA 3V8PA 2HF7A 1I94B 5TSDA 1EP1B 1ODJA 1P9WA 1L5VA 4YJ3A 5AJTA 2VK8A 1OWMA 1NW9B 4HAWA 1KYYA 2ZPAA 4J6EA 3R2JA 1NTRA 4MO2A 3UPUA 4OJMX 1LK0A 4X6XA 3UJDA 1Z12A 5BSHA 2CLLB 5A7HA 2EFGA 4I4TA 1V1MA 2PUEA 5HS6A 3S1AA 1ZU4A 3OTWA 2QYTA 4PHTA 3LHKA 3JQ8B 2WE8A 2XAUA 3K6RA 4FBGA 3F49S 2Q3CA 4CKXA 1NSTA 3GLUA 4D0NA 1A5TA 3EMVA 4BPBA 1NT2A 1E5XA 2E37A 2H2WA 1R0YA 4TTRA 3RD5A 4AP5A 3CLRC 2JH3A 3T99A 1EWYA 2PT9A 4F4UA 2QSYA 2E48A 2I4OA 3W5VA 3M8KA 5L4SA 1JJAA 4FFMA 2ZBPA 1KSGA 3S3TA 3TR0A 5HKOA 2IHYA 4RWZA 2XA1A 1ZHOA 5JBIA 4KL8S 2XQIA 2YIVX 3BB1A 4J1NA 3ZI0A 1LCIA 4RJKA 3DGEC 3ZE1B 2VPIA 1TEZA 5KSOA 3PK0A 4B3MB 4KHPB 1J25A 3BWMA 4UVDA 2OYSA 2JFGA 3JVEA 5TGDA 1CS0A 1PNOA 5DNCA 2HQSA 4LRQA 4G4SO 4URYR 5K8VA 2MYTA 2RGAA 3AHGA 2RE8A 3WBKA 3DC2A 4ZMSA 2PAFA 2F3SA 1UBKS 2XD4A 5JYDA 4KWTA 4JSRA 2PZLA 3RVDA 1JSXA 4IYRA 4BUJA 3CS3A 3KXIA 1TQHA 4N1AA 4WBSA 3TNDA 3RUEA 1YU6A 1TVCA 2ALJA 4MUXA 2F1OA 2OCLA 2VTEA 2C20A 1UM9A 2QTNA 3H13A 3UYLA 2C95A 3HJNA 1X1QA 4U8GA 1QHHA 1E7SA 4EFDA 4KQHA 5DHUA 1K89A 1ZM7A 2QV7A 4WXHA 1JALA 3GT0A 5EUQB 5KX5B 2ZYHA 4II3A 2ECPA 2BD0A 2YJTD 2ODPA 3GEIA 4YI3A 3WWOA 4BMOB 5ADVA 5J58A 2HR1A 4PC6A 4C7OB 5JVDA 4YRJA 1VJTA 5LBUA 3HO1A 8LDHA 1DAMA 3K0KA 3GLKA 1SQGA 5GM2A 2H0QA 5BV8A 1R0RE 3AHCA 1ZOPA 1XTPA 4Y9UA 3AVVA 5DIZA 1BFKA 2R1UA 1P60A 1MUUA 3N2NA 4WIAA 4BV3A 3LW7A 2C54A 2F67A 3TX6A 4EFNA 2J3KA 2CLMB 3GPLA 3NWBA 2HQRA 4I1RA 1JDBB 3MJSA 1MEOA 1X1CA 2ZAIA 3O2SB 5I9IA 5A62A 3B1WA 3T4PA 4C7KA 1XTRA 2AHOA 4QWMA 4RVHA 1VPEA 1Q3TA 3KTOA 4C4XA 4X94A 3SZLA 4QUBA 4EA7A 4JQCA 5CM9C 4CI9A 3KUUA 1QH8B 1LVGA 2J9XB 5KWVA 1QBGA 2BM8A 4P4NA 2ZDHA 3D2LA 5LDGA 1P0PA 3BEOA 4DLSA 5H4GA 4WBNA 2YCBA 2B4TO 3GEHA 3DNMA 4L3VA 4PY2A 3ETEA 3WP0A 1RU3A 2PMFA 1B26A 5TGTA 5DULA 4M0LA 5AIBA 1N2SA 4KJXA 4KRXA 1DX9A 4GPTA 1HKUA 3RV3A 1UK8A 1XZ8A 1JEJA 1BN6A 1RWXA 2G9ZA 3GW8A 2CE7A 1Y7HA 2WTNA 3IMKA 4IJ5A 4URHA 1AGXA 3W9YA 5EHXA 4LZJA 2O5EA 3D7NA 2WF6A 5E2BA 2QX6A 2AG5A 4EPTA 2QG9A 1JQ3A 2GERA 2OMKA 3IJRA 4RF3A 2YS7A 5HUHA 4RPIA 1VSVA 2XMBA 1PN3A 1F2UB 1U1DA 2PMCA 1ISHA 1JKMA 2C4UA 2XUQA 2ZGVA 3R3WA 2X19A 4M9ZA 1YASA 4RO0A 4D9EA 2V1UA 3O91A 4TYPA 4GYYA 5IT9A 3ESYA 4YJFA 3LP8A 1GKKA 1WAMA 4C7MA 4NHEA 3FFAA 4L0DA 1F2TA 3GBPA 1DEXA 1UADA 3V1UA 4H59A 2V7TA 3KQOA 5JS1A 4PU0A 5CM2Z 2Z6UA 1GPYA 1RI3A 2BPOA 3IXLA 2XWQA 4H15A 4G97A 3LMKA 4AZ0A 4EJ2A 3IEPA 1JXMA 3IJPA 4D46A 3F8TA 3E9NA 4MKZA 3OETA 1KEPA 2GRAA 3EA5A 5YASA 1U2DA 4FCCA 2AK2A 4S1VA 1CQPA 2C61A 2HGSA 4CKBA 1WKVA 2XJ4A 3CW8X 4HDRA 4OJYA 1TVEA 2CLCX 2RK4A 1KBZA 2G5CA 1H93A 5IABA 1VA4A 2Q3BA 3P9IA 1MA0A 4ILEA 3D31A 3EZXA 1ADYA 5AI5A 3CUUA 1SCJA 3M4JA 5B36A 2IHKA 3PE4A 1VFPA 1RQGA 1SVSA 3O3MB 4ZEWA 3KWJA 3NYRA 4QARA 5AW8A 1CXZA 1O94C 5JPIA 1MJGA 1EDOA 1SWWA 3BGSA 1JYFA 4MKIA 2Z5FA 1ZINA 1P9OA 1EFUA 4D45A 1WZEA 3KO8A 4QC2A 4WT7A 5JJKA 3T38A 2H7XA 4CEHA 3N2GA 1TM1E 3LLUA 5KI6A 4YXFA 3V1TC 4G36A 1H94A 1QPZA 1KA9H 1VKJA 2LW7A 2WU3A 3EARA 1HURA 4GHWA 3LJKA 4XGKA 5CVJA 2X2EA 3S2IA 5LIRA 4C21A 1YE5A 5AKIA 1MZVA 2V9CA 3ZIAA 1YB1A 1LDMA 3R76A 3E2IA 3GHHA 1YAHA 3RBZA 3ZZ0A 7REQA 3AR6A 2X4IA 3RIMA 1M2KA 2H2IA 1NJSA 2VOEA 3L1HA 4XFDA 3VFDA 3SJBA 1DVRA 3EBOA 4BRSA 3KPVA 10MHA 2NUAB 4DRXB 3AXSA 4F9EA 1C9NA 3W8RA 4L72A 4PBRA 3TAXA 3ZWQA 3HJBA 4WCFB 3UWSA 1YR6A 4JL8A 1E9AA 2H1IA 4MCIA 3UHPA 3VBCA 3CSUA 4ZMRA 4WFJA 3ICPA 2IH2A 3ST7A 1KQ3A 2UVDA 1ZCBA 3URKA 4F9GA 4LDNA 1TJNA 3BCHA 3GUHA 4DZZA 1TUBA 3AJ8A 3ESAA 1V39A 1DC7A 2XXAB 3LQ4A 3LZDA 2QRJA 3I9KA 4UAVA 2WFAA 3BCUA 4YRDA 5K3FB 5DF1A 1E5DA 5THQA 2GCNA 4L4YA 2RJ3A 4RIHA 3T7IA 3HJRA 3N2ZB 3LXRA 5DGXA 1XU9A 2CCGA 3EODA 5IM5A 3SEQA 5B58C 5H9VA 4I99A 3TI7A 4JBXA 3DPSA 4PC2A 2IWRA 1J20A 1JEDA 3ZQ6A 3ZKWB 5DE3A 4PPNA 1LWNA 2DFNA 2E87A 1HNXB 1FFEA 1JKIA 2C9BA 3LDGA 1L3CA 4LWOA 1ZUD1 4CMIB 3ESZA 3OT4A 5CURA 4X1IA 1CDOA 2YC4C 3F3SA 1C9JA 4UTPA 5JRJA 4BC0A 2QAGA 3CEMA 3DBVO 4EM6A 1XG5A 4NQRA 3O1HB 4I9FA 1FUKA 2EFDB 3MMNA 1AGYA 4MCHA 1XL0A 2HK6A 3X1ZA 3N5CA 1N2IA 1M10A 2IYPA 4FR5A 4UZSA 1T3TA 2G67A 5CDFA 4UTXA 2NNLD 3UF0A 1HDZA 1GAQA 5L4NA 4IHQA 1PHPA 5DFAA 3W8FA 5B1SA 1IDOA 2PUJA 3QNWA 1CZKA 5CCDA 4E08A 3U4IA 5JQGA 2WZBA 3HDQA 1JU4A 2F3TA 2V9PA 1ZMXA 3WB1A 4IDPA 4QBKA 4DWVA 1EG2A 1ZRSA 2A1IA 2X13A 3DZFA 3SWWA 2CB9A 2HQBA 5GVSA 4FWTA 1GFZA 2G4CA 1E5TA 4GKBA 5K45A 2O2ZA 2BEVA 4E30A 4TPKA 2QP3A 3KQMA 3PI7A 4QBIA 4IIGA 2CXNA 3OIVA 4V38A 4ATNA 1IWPB 4D5EA 3K8ZA 1L4BA 2BP7B 3WYCA 2NU9B 3PQ2A 2GK3A 3NANA 3TSWA 3B82A 1ID1A 1P29A 3CZMA 3O4FA 3TW0A 5HR5A 3QUTA 1BKDR 1YDEA 3GEPA 3S0JA 4GMKA 4C0WA 2HJRA 2Q5EA 1UT6A 1JPUA 4BO7A 1RSZA 3NATA 6AT1A 5JMWA 4HQ6A 4HVAA 1PO7A 5E1BA 4XYMA 4WE3A 4B80A 1NJ8A 2O8NA 1TO2E 3S1SA 3F71A 4HYTA 2WWTA 1UMCA 2GBFA 4ZYTA 4C08A 2PO7A 1ZVMA 4V0KA 4JLBA 4RTMA 1MB0A 3BRWD 1P6XA 1ND6A 3AOEC 2C29D 2H9IA 2B94A 5CITA 2VDVE 4EUEA 3RH0A 1K5HA 5C1IA 3SU8A 5CYFA 1ZD4A 3V7YA 3PUXA 4B82A 1FVFA 4BZWA 3ICVA 2PRKA 1MW8X 2PXCA 5D8DA 5AVQA 4FXOA 4P86A 4MW5A 2XQGA 8ATCA 4KR6A 2HUPA 3L8EA 2GLTA 8AT1A 2FMTA 1SU8A 1RLOA 4GSYA 1TK2A 1CVLA 1S2NA 5EQTA 4JQYA 3SD7A 2P68A 3SQLA 3E48A 5HZKA 1T1RA 1XD2B 2OHHA 2BGIA 1PJQA 2VJMB 1YOVA 2B9EA 1MGPA 4ZODA 3AILA 2VRCD 3K4HA 3OZ7A 5DBHX 1H1TA 1JPVA 4IS3A 4LTNA 4U5XA 3ZU2A 3T4XA 2OG1A 4QUJA 1CY2A 4I1UA 4MPPA 4PZLA 4TQAA 3K5PA 4G1VA 4KN6A 1M2WA 4XCQA 3LDHA 1RQXA 1XZQA 4LOAA 5BUZA 3R3XA 2VHUA 5FOTA 3SC4A 1AN9A 4DR4B 3S8EA 1TTTA 4UHKA 1PJ3A 2YFHA 4X90A 4LQCA 4MKXA 2JAUA 1YS7A 1PV2A 3JQGA 1KEKA 3SS7X 3DHWC 1O97C 1Y9AA 3IDSA 4MYUA 1SA0B 1SG6A 2I2AA 3O21A 1AKYA 3OUTA 3CLVA 2I4NA 5FR1A 1N0IA 4IZOA 3FRIA 5AICA 2F8LA 3HA3A 4ZQCB 3O47A 2C3OA 2W37A 5A02A 1QVAA 3B1YA 3PX7A 2I4LA 1UBFA 2JFOA 3V8EA 3HA2A 3IERA 1X42A 2RAVA 1BRTA 1TCAA 3RQIA 2OHFA 4Q24A 3DSRA 5EL0A 3T0GA 4D6YA 1KL7A 1NSYA 1XRMA 5HQTA 4YASA 5K0NA 1FUIA 2B34A 2ZU6A 1FFGA 1QC5A 4ENSA 2NV0A 4XE5A 1TM5E 4PPGA 3DB1A 5KAPA 3DJYA 1AIPA 1CUWA 3TW8A 1QIFA 2L2QA 3KVOA 4KWIA 3W04A 1ULBA 5IUNC 2X14A 1GTRA 2JL1A 3VKHA 5AT1A 2H5LA 1EJ6A 3LHSA 2JGIA 4H18A 1V16B 1ECGA 1C0LA 4X85A 3PB3A 3HXMA 1R88A 1OXBB 2D13A 3FWYA 3H2IA 1KXZA 2JI4A 2LDBA 1W2HA 2EZ9A 3Q3CA 4B6QA 3VNBA 4XX1A 4EVQA 4INPA 5BPFA 1DBSA 2C7BA 4P53A 5JT1A 3GY0A 1LKZA 3A7EA 1ST2A 3GJ5A 3QVJA 2BC9A 1N6RA 4H7IA 3X1KA 1K98A 4DVJA 1KP3A 4Y2UA 4I1OA 1EXDA 1LFAA 3E1KA 2PO5A 5KDLA 521PA 2CV2A 2W8BB 1ECLA 1QQTA 4QYTA 3H4IA 1AV7A 3OUZA 3PQEA 4TUYF 2OCBA 1X87A 4U2KA 2CJXA 1C0IA 4XSVA 3D02A 3RFUA 3WE7A 5C7YA 5K0FA 4FN5A 2WU8A 1YDHA 3ZKAA 1IAQA 5EINA 3S4YA 3U6KA 3SF8B 3LFUA 4BJ5A 4BCCA 3E5HA 2I78A 4HD8A 3AFGA 4RL4A 4WCDA 1LS1A 3M5PA 1WSWA 5FPTA 5IDQA 3VO1A 5IF3A 2AMLA 2IT1A 4Y6SA 2CJWB 3DA8A 2RAFA 4FD3A 5LSAA 4P3NA 3TLYA 2ZI6A 4ZOLF 5D85A 5AKJA 4NJEA 2JAOA 3W5JA 4DJJA 2B4QA 2YHIA 2XCLA 3W5SA 1UWVA 3V1LA 1P44A 1SXJB 5KREA 2O2SA 1PWEA 2R4QA 3NTQA 4XYEA 2EEZA 2WMOB 1AZTA 4R8KA 3T0IA 2WHPA 3U1VA 3N8DA 1K7CA 4P0QB 2GA8A 3BYZA 4WADA 2N47A 1YNOA 3FG9A 3I5UA 3JYPA 3PGMA 1Q2XA 3AJ9A 4K9KA 3RE1A 3MJRA 4IMIB 5SICE 2J3IA 3NRCA 1UXKA 3K9NA 1J2UA 1I5RA 2H9YA 1E58A 5CU7A 4C0HA 1CBUA 3RS4A 2WB2A 3BORA 2RB5A 2O06A 4K9OA 4QXOA 3WHLA 2XE4A 3C3AA 3BMXA 3THOA 2QVZX 3SOZA 1NU8A 2WD7B 2WYVA 1K66A 2Q8QA 2XGSA 2Z2KA 8GPBA 4KYUA 4XRGA 5AW5A 3U49A 3V4LA 4ZI7F 5AW0A 3Q8XB 2PUTA 2RHBA 3G3EA 3SHTA 3U3ZA 4B4VA 3WY9A 4AVYA 2XRMA 2D0OB 2CMKA 2GNOA 2CFRA 4LYAA 2CL7X 4Z2AA 1KZ9A 1UQUA 2L19A 3K09C 4UTVA 1BVUA 1N75A 5EEGA 4BOYA 4DB4A 4GBJA 3QX8A 1IC6A 3HB9A 3AINA 2UYQA 4P5PA 3U60B 3P2MA 5FXMA 3RT9A 5I8WA 2VP4A 1YAJA 1YF3A 3H8SA 4N49A 2BF7A 3RS5A 4CV0A 5C8ZA 1VJ5A 5ESDA 4JYCA 1T3HA 1VG9B 2G09A 2DBZA 1V3VA 3BL8A 4I50A 1UFVA 1X7GA 2PKEA 2MSLA 3C8UA 4INJA 3EIWA 2W2KB 4D9FA 5ENVA 2AZDA 1XLWA 2YHUA 2G1KA 2F48A 2GZMA 2QRHA 3HDTA 3I01A 4MS3A 3TCXB 4CGYA 1VSUA 4V03A 1G7SA 4B34A 2B5OA 3JX9A 4QGBA 1IVNA 2GF2A 1QGZA 1BQEA 5DW0A 4JVOA 1C0KA 5I4IA 2P2LA 2XLBA 3GLFA 4JXXA 1NURA 1RXVA 2PPVA 4R84A 3TIXB 1VP9A 1DV2A 2C5HA 3HEAA 4BAGA 1MPTA 4KQWA 3KQWA 3ED1A 4C7BA 1AZSC 2VBIA 3L04A 3OSZA 1M2JA 3WB9A 3OU7A 3AEZA 1RHJA 3ITNA 3CMCO 4ZKDA 1JUDA 2ILTA 5EE9A 4QDJA 4BKUA 2FYTA 2R60A 1XJCA 4LYHA 3SOPA 3JAMA 2Z2XA 5REQB 3LQRA 5C2JB 3S2EA 4K6OA 2C59A 2H54A 4LBVA 4D8WA 2F43B 1HTWA 3I5AA 3TRKA 3IO5A 4IFIA 2VPYA 5LDHA 2FEOA 2BHNA 1ULSA 2RHHA 3NHJA 5U4QA 2FK8A 2XYPA 2XCQA 1G16A 5FUXA 1PVDA 5HFNA 2YQ4A 4AQ7A 1P1JA 4ETIA 3PX3A 4YMHA 2XZPA 2V6FA 5A5DA 5IXJA 1ZGZA 2H07A 3RQSA 3GQBA 1X1BA 4G0NA 4XSGA 3NVMB 3HB5X 4CCYA 4BQIA 3BMQA 5DCLA 4DUPA 4LXYA 3TMAA 3VOBA 1OILA 1OZGA 1WMDA 2BI4A 1FLDA 1WF6A 3K31A 2C83A 2G0TA 3K5HA 2HREA 3IHLA 3AR7A 4QG7A 4QYMA 1JJFA 1Q91A 2M6SA 1WKCA 3L8HA 4IF4A 5ETJA 2VDNB 3D0OA 5F2OA 5THKA 1C30B 4G8BA 3MZ0A 3NBAA 3UK6A 1IOLA 5KYKA 1HEYA 4MA4A 3KKKA 4C2TA 4W8OA 2Y9MB 3T6KA 4BMPB 2C57A 1F8FA 2PX4A 1KC3A 3HA7A 4TXNA 4CV3A 3CUVA 1J7JA 3WGYA 4ENTA 3AWIA 5BNFA 5GIPE 3R7BA 1WBJB 1Z22A 2Q3FA 3R8XA 3T35A 1B2RA 4KN9S 1GQRA 1B6RA 2YWEA 3PQCA 3E3AA 1NXVA 4O2RA 2ZAMA 5IJXA 2X22A 1IEWA 3FZGA 4MLZA 1K6EA 4C0AC 4C43A 2JIRA 3BXPA 1JA0A 3RC2A 3FRJA 4G81A 4DLNA 4DS3A 4YCLA 2BBTA 4N5MA 4ZT5A 1RM3A 1UOEA 1S89A 1MH1A 1MTOA 1XTUA 3CF0A 3H5OA 3L6DA 3M6WA 1P75A 4UD2A 1OJLA 3CLHA 5EGNA 5FULA 1QGAA 1RYEA 3VNQA 1UOQA 2NSHA 1P2SA 2G88A 2JBAB 5B12A 1YHNA 1M0SA 1TUEA 5IDWA 3IAM6 5ICEA 1XZPA 2P9JA 2ZVQX 2B25A 4LBYA 4NE9A 3RYIB 4BFCA 4D9KA 4E5DA 1Y9DA 1IBKB 3R5SA 4AROA 3IPXA 4MKHA 4EJ6A 3H4MA 4DSTA 1U63A 1EHCA 1X14A 5AK6A 1T2FA 3A32A 4JQZA 1DMSA 4RETA 3DMPA 3VKFA 1A9XB 1SB8A 1Z0AA 4JLMA 3THYB 4XX0A 2H2AA 5FP0A 2R6DA 1W94A 1E3WB 1MAAA 1NG1A 2XA9A 3M5WA 2WJAA 4MVJA 4AUNA 3REQA 5TF4A 5ABPA 3JWJA 2CJPA 2XI4A 5FOVA 3ZGVA 3U31A 4Q6BA 4A2CA 4ZREA 3KB8A 5A6SB 1H4QA 3THRA 3QENA 1OREA 2CV0A 2HADA 4G0VA 4JLDA 3I0MA 3UWOA 1KDTA 2CFSA 2J3DA 3SQMA 4P0PB 1U2RA 1TPZA 3R5HA 3IUQA 2BWJA 3DLHA 1NVEA 2V6IA 1G5QA 5JD6A 2J3EA 1WCIA 3PXGA 3TZEA 2CBXA 4I6GA 2RGNA 4AJJA 1KJIA 2WT4A 2XJ9A 5L3SB 3IPLA 4KR9A 1RI5A 1GPLA 3ZR4B 5E6SB 1Z2CA 3FY4A 1PD0A 2WJYA 2YN4A 1ZN7A 5DHQA 1Z6GA 1ZM9A 3ANNA 4K9RA 4XZ3A 4B3SB 5G4LA 1DJQA 2YUTA 3F4BA 4HFRA 3QG5A 3CRW1 2ADMA 5JE8A 2HMYB 2P3OA 3AWDA 3LQ2A 1II9A 1YDMA 1JIIA 2C9YA 2CLOB 2QQEA 3LF2A 5CB4A 4WCVA 3RUIA 4D97A 3ZD8A 3A6DA 1CZNA 1IXSB 2HTFA 1E62A 4QDTA 2JI8A 4E21A 1JE1A 4Y2JA 5IKPA 1M1NB 1E66A 2H6EA 3BGVA 3Q6MA 1MOQA 3KKLA 3NOQA 4FEAA 3K1AA 4PFKA 3L7JA 3IELA 4RTKA 2C97A 2A59A 1PLKA 4UJ3A 3PZBA 4FC7A 4TWZA 5HQJA 1R64A 1F1BA 5AXAA 2VSFA 2A88A 3L8DA 3RARA 5KTOA 1V47A 4EPVA 4MMZB 1VC2A 4ZC8A 1ZJ6A 1ZX1A 3W7BA 1RHMA 2R7LA 2LBPA 1HLDA 4U2FA 3WADA 4DXHA 2MWMA 3HVHA 1HWYA 2IHJA 1OFHA 2QTLA 3BSSA 2R00C 2JANA 2ZSKA 4YRNA 2QLNA 3URMA 2O8CB 2IITA 3G82C 4JT4A 4S0XA 1W5EA 4XB1A 1T5TA 5IT5A 3ZDAA 5DHAA 4OKNA 3ONFA 3ZIAD 4QG3A 3GRCA 2DPMA 3Q3EA 1KFJB 2PS3A 2G1UA 2Q5JA 3DL4A 4CLOA 1NQTA 4D4LA 1PT7A 5KNDD 3DHYA 3AVTA 2AG0A 4ZGGA 2PBRA 5HDBB 3I6YA 2I03A 5HRAA 2JEYA 4HQ0A 3MPOA 1IQ0A 2XADA 4IUYA 4NESA 1YZGA 4ONEA 5EI5A 5CFZA 2AJCA 2IECA 2D1QA 5AKEA 3P2JA 3EB9A 2IXEA 2RDMA 3IURA 4MWEA 4NMWA 5CEEA 1E9SA 1BMQA 1B8PA 3KFXA 3CF4A 4DIUA 1VIAA 5MFPA 1QP7A 5FWNA 2J3QA 4F21A 3RADC 2W2NA 3KSMA 1X1RA 4O2AF 1SZPA 1T9DA 4K6MA 4R6WA 4W8GA 4OYHA 2YJ3A 4R5MA 3DXZA 4EPYA 3LDUA 5GP1A 4J3FA 4V0MA 1XLUA 4C0XA 5M34A 2J0VA 3IP3A 4JQSA 3GI1A 2WSIA 5JW6A 2V7VA 4ZZIA 1ADCA 4DGQA 4H2DA 2C7QA 2PXXA 2WZQA 4L15A 4N8SA 2VO1A 3VU9A 5DYTA 1L4HA 3EXHA 3X44A 8ABPA 4G0YA 4M22A 5TIIA 3MMSA 1G20E 1DARA 1S4QA 2H0AA 2PH3A 3FNEA 1YR2A 2BCEA 1JLHA 2WVHA 3SBXA 1ENPA 2QS9A 4UXHA 4WGFA 1LRKA 4F4IA 4M1QA 1P7VA 4M0UA 1KDZA 4JJAA 4RL6A 4LZZA 3LT5A 1U11A 4MHOA 2ACKA 3JRNA 1PHRA 4HGQA 3ZCTA 1K8RA 3GU3A 1USVA 4BKQA 4DF3A 2D54A 3GCDA 3P20A 2FWIA 3LSTA 2Q41A 4ZKEA 2WQ7A 3F73A 1HYEA 2HK8A 4YYEA 5F1PA 2F4NA 3E53A 3E82A 1YFKA 1V5IA 4B7AA 4MAMA 1JVBA 2ZFUA 1EU1A 3IAHA 2A52A 2ESRA 1CY7A 3NU1A 4CQLA 3LQFA 3ZK7A 1TKBA 5IYZA 1RACA 1DJOA 1FYVA 1MG5A 4H27A 2VHCA 4D44A 2YNMC 3IP6A 1RLUA 3O9ZA 3W2HA 5ERXA 4OUKX 5BSWA 1W5FA 2TMKA 2UZ1A 4MVCA 5L40A 2MJLA 3L8CA 1K63A 4KIFA 1TQ6A 4MJ7A 4PNHA 1MF7A 3T3IA 1PFVA 3VGJA 2GN8A 3A7DA 2FEWB 4BRWA 2D62A 4QTTB 2AKEA 4CG3A 3DYBA 2IHZA 1N5MA 4NV0A 4S1PA 4HRAA 4FHEA 1UK9A 1YQWA 1TZKA 2V74B 2QT9A 3CZAA 5JS8A 4E4RA 4QO8A 2NP7A 4OHVA 5HNKA 2BMEA 3EEFA 4Q4LA 3AGPA 5FNZA 3UQYS 4BN4A 4N12A 3NEPX 3SIXA 3DD5A 4YLYA 1PBNA 4UVGA 3RRBA 4D8YA 1KOGA 2W0MA 2XWSA 4XR9A 4AJHA 4F5DA 5J4VA 3C3CA 2BUAA 4ALIA 3TDNA 2OGFA 1VKHA 3KDSE 4L74A 4JI1B 2XF2A 1LPBB 3I5MA 3CGGA 4IXTA 1TCVA 4JHXA 4OL0A 4ZD6A 5EJ7A 5DM60 3MJFA 3MUOA 4EKGA 2WPDA 1YFZA 4JHLA 3DZGA 1XAHA 2VJDA 1JJIA 3FNQA 1VB3A 2C7VA 4C0LA 4ZRNA 1PEYA 1T3ZA 4UVIA 5BR7A 4RLFA 4RSRA 1QCDA 3I72A 4KV7A 1JV2B 2GHRA 1ORIA 1IXKA 3I8XA 4F3YA 2WDZA 4HWRA 1I3CA 3KB2A 4L2IB 4ZFNA 5CHEA 3RUAA 4Q9KA 1AURA 2ZJ6A 1GN8A 3FYUB 3UMJA 2DR3A 1UDBA 3AVOA 1E20A 5KOIA 4PQRA 4BNUA 3IAUA 2PRYA 1XYYA 1EJ2A 3N1UA 3TSAA 1GZ4A 1UINA 3I1IA 4EKIA 3EEIA 3SIWA 3WWCA 4Z9XA 1KEEB 4IJQA 5HFJA 4HXYA 4JBNA 1SKQA 2F9LA 4CLEA 3WB2A 3RRNA 1D1QA 4DTIA 1DL5A 4US1R 3VR4A 3QW2A 2Y27A 1YI0A 4GC9A 4UHBA 4DMRA 1Y6QA 1GKYA 3QEOA 1AHIA 2WFLB 3C41J 3G9XA 3H19A 4D0SA 4F4CA 5F73A 4FM9A 1UPFA 1T2EA 3K1ZA 1Y4DE 3CBQA 5KSPA 1GPH1 3HB1A 4RUKA 4LY0A 4QPZA 2HHCA 4OHFA 1YJAA 3KKMA 4HDCA 3DKVA 3FMOB 1ZR4A 5CX1A 2B3DA 2VZ8A 1AO3A 4M6WA 4TZ6A 4X00A 1NN0A 5EJAA 2VYVA 2HFKA 5EJMA 4YUXA 3AL2A 1JQDA 4LISA 4A0SA 3BA1A 1D2AA 4TKMA 2OV2A 2QVCA 4QX6A 2QZ9A 3WP1B 1Z4MA 2YXPX 3M83A 4RF2A 3R9XA 4AMGA 5T57A 4LOJA 4RHCA 3BS4A 2WT8A 4QD3A 1XTQA 1JQAA 2C9MA 4O4IB 5FV7A 3UH1A 5FX2A 1IB6A 2Q5HA 4D9IA 2J5RA 4QSHA 4XM1A 2PQ6A 4CM1A 3PJDA 1UP4A 2J67A 1GTVA 3C8MA 3KWMA 1Z08A 4BBZA 3AQIA 4YRPA 2BVNA 4FYHA 1XMPA 1B00A 4F6LA 2WTXA 3UWKA 2NQ2C 5JHGB 1ITZA 1VGQA 1ZHHA 3IGFA 2I67A 3OM8A 4RD0A 2AQ8A 2JIOA 2J7PA 4TGLA 5DI3B 2HRZA 2J0UA 2PKYX 1AMUA 4RTOA 1G21A 2OZKA 3TW4A 4QVKA 3EG9A 3PUJA 3QWHA 2VYCA 3I37X 3AUTA 1JFVA 1JG2A 2R68A 2ZPUA 1W5BA 3LL7A 1U1FA 1U0HC 3IA7A 3CONA 3P9NA 3QA3E 3S2YA 1XFAA 2AN3A 3CKKA 1VIVA 2RMKA 5LOVB 4QUDA 2X4LA 4MQ4A 3CZCA 4R9SA 3VI3B 1TEXA 3ZOZA 4P4SA 4WKOA 4COOA 3KS9A 2Y6VA 4RZXA 4N0EA 2X9NA 1QRRA 1IPHA 4R9UC 4DLTA 1U8TA 1Z6QA 1A9QA 1BMFD 2WV9A 3H8JA 4OAQA 3ZWOA 2A2ZA 3JXEA 5IVIA 4PNEA 2EYQA 2NO6A 3LVRE 1TYDE 1NBHA 2GAJA 3CVVA 3EXAA 4IIBA 1S2GA 1OVGA 3CA8A 1NOJA 3V8BA 1E5LA 3NEAA 4L22A 3NFRA 1U9CA 3H1GA 2IK8A 1RXUA 221PA 3VGPA 3UBTA 2HEIA 4ZICA 2B69A 2CNLA 3NTVA 3QX7A 4QLAA 4BLTA 2G9QA 5ELLA 2O3JA 3WLQA 4Q9IA 3T4UA 2ECFA 3ABSB 3RT7A 1PUXA 2Q2VA 4D9JA 4RABA 4S1WA 1N0VC 1NUUA 1H8EA 1V8OA 2AFHB 1MKYA 3QKWA 4L9WA 5DNDA 2DEUA 1DKQA 1OHHA 1E0KA 3IBCA 2ZWPA 4JGBA 2YVQA 1WWKA 4WFQA 4IAOA 2A9OA 4MCJA 1ZK4A 4M9XA 2JLUA 1COWA 1QU2A 1E60A 4IIFA 2XITA 3LX5A 3BIFA 3E9RA 2XUZA 4U6NA 1R0XA 2J87A 2O5VA 2W43A 3M6UA 4RANA 3V1YA 2WZCA 3L02A 2ODNA 3DB2A 3EXIA 2RGDA 4IINA 5CMLA 1T4CB 4RFSA 1TJ4A 4LWZA 2DWQA 3NBYC 4MP8A 4YN3A 3VQTA 1O9HA 3D1LA 3ES9A 4L50A 4LI3X 1PL7A 4TN5A 5JXWA 2XB2A 5IVDA 4LDQA 4MGZR 3VDNB 2DVMA 4EEZA 4FMCF 1QONA 3IMFA 4OHPA 4ZCLA 1BW9A 4F3TA 1FJGB 1TCUA 2VJCA 5ARCA 5BVGB 2P3QA 3PGA1 4FOLA 3RF6A 2GBGA 1HF3A 3SIPA 2BDUA 1DWOA 2AJTA 5IZCC 2DUWA 2C4VA 4YQEA 1SUWA 4EKDA 5JOQA 1P9NA 3Q72A 4FOSA 1PZHA 2IBTA 4JY7A 1D4AA 4KDFA 2H8GA 4AX4A 1PFYA 2F3RA 3TRJA 3K92A 1AF4A 4DUZB 1ZIXA 2AMYA 2WUWE 3EGWA 3QUAA 3KOOA 4X8LA 1TRKA 5I47A 2DT5A 3ZV7A 3WLNA 4D82A 1YRLA 1MW9X 1WPXA 5JMPA 2O6HA 1ECPA 1P39A 4ASUA 2W6QA 1RWMA 4H0FA 4U7FA 4ZVVA 1GXSA 4H31A 4M8IA 3CY6A 5K3AA 4YJ3F 3M2TA 1I01A 3K0AA 1GL9B 3BL6A 2BN4A 1EM8B 2OGUA 3OG9A 2XQFA 4YCNA 3DGFC 2V6MA 4FR0A 3GG9A 2P9CA 3K8QA 1J0EA 1AS0A 1AX9A 1XN1A 2DSTA 2IYNA 3BZWA 3NBUA 3OZFA 5CVEA 4I4TF 5DSZA 4ZV7A 4BO4A 2WWYA 2IP2A 1SJ9A 3NJ4A 3SSNA 2HMUA 4E12A 1Y1TA 2QE7A 1KZ4A 3M9LA 3ENVA 3B3JA 3X1JA 3QMVA 3ABQB 1DWQA 2YVLA 3NLLA 4R05A 1U5AA 3U17A 1KMIY 1BS2A 2B4KA 5IBRA 1RZRA 2ORED 1RYMA 2QQFA 1T0BA 2Z1MA 1CY1A 4YLGA 4QPDA 2C88A 1RM4A 3A05A 1BHQ1 3KEMA 3MS4A 2O14A 3PC6A 3QJGA 2VUIB 4RS3A 1Y8RA 2BIFA 2D7CA 2FPOA 1F8XA 1YMQA 2RD2A 2DBRA 3IXMA 4NK5A 2I1WA 3K70D 1SVUA 2QRQA 1J9EA 1JFFA 2HHAA 5F1YA 2ZG6A 1M7GA 4XYBA 3CZRA 5AHWA 4YDQA 3WSWA 3AKYA 3D4NA 1O77A 1DO8A 3LPAA 4D1YA 1LI7A 4Y9SA 4P83A 4H9GA 5C8VA 4HZIA 1PDVA 2E82A 1GCAA 2G9VA 2JGJA 3ZX5A 1PDOA 2H1OA 4EY8A 4F6RB 1M0TA 1EP9A 3BRSA 3NCHA 2MR5A 1U8UA 2HUNA 1GAXA 1X86B 3B7PA 3ZXIA 1E0AA 1O87A 2NV6A 2VAXA 3ABZA 2FRXA 1CPYA 3N2LA 3CKMA 2O1XA 4HDNA 3CQ9A 3IX7A 2BEJA 1AT1A 2XUKA 4KO4S 5AWFC 3DJFA 4C1BA 1ZK1A 1IOZA 1UDAA 5H3LA 3V97A 3WGVA 3PQDA 2FKAA 2WU1A 3BIOA 5KYGA 2JKVA 2NTVA 4Q4AA 1BHSA 4AAYA 5BMVF 5FL7A 5IHXA 2E4VA 2AJ8A 3GRRA 3I64A 3K1JA 1IUOA 3PUVA 4HRVA 3O8DA 3OJLA 3OPMA 5G0VA 3RHFA 1N2OA 3L4EA 5KKNB 4PAGA 1QK3A 5ILQA 4CCSA 2XYGA 2G72A 3DWFA 3PXXA 4EB0A 5FOQA 2GEDA 5CPFA 4Z9FA 5JVDF 1H9BA 4PSVA 2AKYA 1IY2A 4CMHA 3WDKA 3KAJA 2NZ8A 5FRDA 5AH0A 3AV0B 4F2GA 4AM8A 1CJBA 4YCCA 4R4JA 3I6MA 1TA0A 1OCEA 1YHZA 2NYVA 1U5BB 2YMLA 2ZI4A 4IV5A 4ZU1X 1ZI6A 2IWHA 4DSAA 5FOWA 4JBYA 4NG5A 1RRCA 1WXHA 4PNZA 4IQGA 4DNQA 3DG9A 2CCJA 2W6MA 4JBHA 4DNOA 3NMUF 4AP9A 4EGAA 4IBOA 2W58A 4MH0R 1FNSA 2K5UA 3OT1B 4A8JA 1E2HA 4OQPA 4EZBA 1XPRA 3DWIA 1A9OA 4YNBA 1TADA 1R4MB 1BN7A 1C1YA 3CH4B 1CF4A 3FFXA 5AXBA 3RIGA 1P74A 3R1IA 2HRBA 3EPLA 2Q2NA 2D8MA 4DR1B 3WIUA 1OMOA 1ESCA 1YCDA 3RK1A 4QPCA 4WBNF 2QVXX 3LY7A 3P9RA 4PZ9A 1F3LA 4I9GA 1O9BA 3IC5A 2PRIA 3QRWA 4GP7A 4QOHA 4JI7B 2HCJB 1HYHA 5L53A 3A1TA 3OC6A 2V58A 3HXKA 3JQAD 3DFUA 3M34A 2H4JA 3FAZA 5C1PA 1ZI9A 2GYUA 1EK5A 2H00A 1WB9A 2VTBB 4AKEA 4D9GA 4CIYA 3W8DA 4X45A 2O9JA 3DLBA 1OXUA 2G77B 4BLVA 1TLFA 2QY6A 1HY3A 2ZRPA 3G88A 4ACBA 3OF2A 2PGLA 4PG6A 2QZSA 4U9UA 5JAZA 1L4YA 1OAOC 2CXTA 4KO8A 1WULS 4IDOA 1R6DA 1LSSA 2A5LA 4C22A 2ZE6A 4N76A 2Y77A 2O8DA 2QRPA 3H04A 1C0EA 3O2NA 2IH4A 1J70A 4Z4GA 1QIMA 3H1EA 3HCRA 4EO7A 3OX4A 4BMNA 3X2FA 3HU5A 1OZHA 2VJYA 3VV3A 4G0OA 2AXQA 2XQKA 2IZ6A 4M98A 1GZ5A 1YXMA 1W4CA 3IIEA 2C2YA 2PKWA 1I3OA 3OIFA 3T52A 3AJDA 2ZR7A 5ESRA 3DW1X 1AKMA 3CG4A 3D3NA 1VCOA 3KL2A 2WPDD 2GKOA 3BH0A 1LW6E 4QEDA 4WX2B 1JIXA 4TKLA 5LQRA 3PFFA 1KNXA 2R65A 4WOJA 4JT8A 2BEWB 2RHGB 2GR9A 3D2CA 4GXQA 2AMFA 4U2DA 2NU8A 4IIHA 3L82B 3C39A 4DQ0A 1VXRA 5CLHA 4DW8A 4PG5A 1PX2A 2Q6VA 4HGOA 2FOIA 2HRCA 1OFUX 3AJAA 5K0BA 3VHXB 1LW7A 4WECA 1KYIA 4RVCA 1WTAA 2OMEA 1NJ6A 2H06A 2WKWA 3DZ8A 3H9JA 4D98A 4YMSA 3JPYA 4ZHQA 5HJEA 3IUSA 4MRMA 2NVOA 2ZTHA 4KJZA 3CO5A 1GR0A 1X9GA 1X3SA 2IRWA 2JJ2D 4M1KA 4R8LA 5FPHA 3CURA 2IS2A 1KETA 2R7AA 4HDKB 3KXPA 5ALNA 3TZ6A 2XMZA 3V8VA 1EKXA 1ONPA 1G66A 1FMCA 1U3TA 2RGGA 3HR7A 2X42A 2XNSA 7MDHA 1CUAA 2NO1A 4PQEA 4MUHA 3EN0A 3D4BA 4X93A 3I9OA 3JQQA 3FH0A 3W79A 1Y7TA 1E4VA 1ESDA 3PD7A 3QTLA 1WMEA 1IK6A 2H92A 4DREA 1FS5A 5TVKA 3KT3A 2D00A 4EKEA 2GX6A 1N7IA 4LNAA 2WM9B 2GETA 3L8YA 2YV3A 2YWRA 4WINA 2A92A 4CRWB 1BZYA 2HW8A 3QX9A 4NBNA 2JJ8A 5FT9A 1I2CA 4ZEMA 2VYVD 1INLA 2HXYA 2YBDA 4IQ8A 1J8FA 3LLSA 4OUDA 4RXMA 4X60A 3A3NA 4AU1A 2Y1LA 4F8JA 4RTSA 3G5TA 3JY6A 2VJQA 5GONB 4HQLA 2ZJ4A 1TU0A 2ZJFA 1U1GA 1JI3A 2DPLA 2KBEA 3HBLA 4HS9A 4MGEA 4EI8A 1H8HA 4A10A 3E8MA 1N5KA 1XEXA 3P9QA 3RLFA 3PKZA 1WHSA 1NUPA 4KE7A 5DNAA 3VHQA 5B37A 1PG2A 5C5EA 4UTOA 3OD5A 2Y9PB 4L9AA 3D6HA 4LYJA 2QUIA 5EKTA 3GVXA 4LDRA 4HH0A 1UJ4A 5DBOA 2NSLA 5C4IA 2AE1A 3LC7O 1OW3B 3GOQA 1YRQA 1SVKA 4H0NA 2XUIA 5FPPA 4FB4A 4HMOA 2A9RA 2WUFA 1BVYF 3GMTA 1ZIOA 4PXSA 4HDMB 3GNTA 1QK5A 2J7PD 2O23A 1C4WA 3R5FA 3OZSA 4CTNA 5EHNA 5LZ2A 5I7UA 3HBMA 1R5OA 1M0EA 4DARA 3NYWA 3QITA 4IHJA 2ZTLA 2ZJBA 2XBUA 1GAEO 2QNRA 1WUTA 2VNIA 4NYMQ 3O03A 3GLHA 5CT9A 2V6BA 3UAWA 2DHCA 1FC0A 3JU3A 1W44A 1XCBA 2WJIA 5E6UA 5T6BA 4Z7QB 1BXRB 3H7AA 5JNWA 4QOIA 1KP2A 4FZ3A 4BIIA 4LF7B 1V9CA 4CL8A 3A9VA 3PS9A 3WB0A 4E2FA 3DLIA 2XKKA 4PICA 1BE8A 4R2HA 2P2YA 4UUAA 3CI0K 1GGFA 1P73A 1XQVA 1XKXA 3MAAC 5C5CA 2WKRA 4LE2A 1UWCA 4RWEA 1J09A 1LBQA 3DHNA 2VZ9A 2ZSBA 1K7YA 3FNIA 4YCDA 4F0JA 3D8UA 5JQGF 2ZJ1A 2BFAA 2GESA 1MOPA 1ZC3A 2Q7OE 3G85A 4NABA 3NOXA 4GM0A 1BXGA 1PGJA 5EMJA 3PXEA 4JA0A 4BVJA 5EXSA 2ZRLA 2NP6A 4W63A 4FGWA 4F11A 2VPPA 4UBOA 2QN2A 1CJSA 2RI0A 1FW8A 3IAS1 1U1IA 2JGMA 3FOFC 4AMBA 1FX0A 2ECKA 3WLPA 2OD7A 3GRVA 3OM1A 4AO6A 2P9BA 3PIRA 3CN9A 3STWA 4A2WA 5I4KA 2WIFA 3HXPA 3GRAA 3VA7A 3HNOA 4LYYA 4QGGA 4O1HA 1H8ED 3RFXA 1FVOA 3K2IA 3V55A 2OM6A 3KTAA 1OHHD 3R6DA 4FSXA 3I52A 1SKMA 1DIOB 3MTIA 2SCUA 3O90A 2G5ZA 1JHOA 1GZVA 3Q4GA 2JFXA 2NVWA 2ZT8A 4QECA 4O5AA 2CMHA 3O3OB 1RPZA 4H7EA 3UG7A 3BXGA 2CEAA 2ZZNA 4X61A 2VNKA 3N2IA 3ZWCA 1KU0A 1UOOA 4NYIQ 1L7DA 4IVRA 1PT9A 2FKNA 1FOEB 3RTBA 3KETA 2P4HX 2F6RA 4EB6A 5KUTA 4BXOB 2DMRA 3ND9A 5JLJA 4KXMA 5LIPA 1GTZA 5C1OA 1S4MA 3BOSA 4ZAVA 2QE6A 1SCDA 3ULKA 4DQXA 1AQJA 3JAWA 4M38A 2H52A 4QBFA 1A98A 4KGDA 4MMYB 1U98A 1OLXB 3BG5A 4WEQA 5KKAA 3ZGNA 1VL2A 1SXJC 3QOYA 5DRYA 2WWWA 1ZSNA 1B8VA 4FOTA 4MMXB 2QENA 4BU1A 1K8ZB 4PZUA 4KLZA 1UBHS 3B70A 3NHSA 4QPPA 5E7QA 2G04A 3F90A 4UAJA 4F04A 3A28A 4ZVOA 2WYUA 3DLTA 5D2CA 1NMSA 3X1MA 3RAEC 4BN0A 1DG9A 2ZRCA 4QICA 3MJHA 3IT2A 1SC6A 4UJ5A 4N01A 4J91A 1LLUA 5DBGA 1H1LB 3OIDA 3R6WA 4WK2B 1BVHA 2X4DA 3KXKA 5TGZA 4XCXA 4KNYA 1N9GB 2DY0A 3RVKA 3QLUC 3TTVA 1XZLA 4O8CA 1CUSA 2JHPA 3HXLA 4HMQA 2ZWVA 4ASUD 2X58A 4UEQA 2O19A 1GGJA 1Q0PA 3PSHA 1IBRA 3HU2A 1OLSB 1X1EA 4P93A 4BNKA 2JATA 1PNVA 5BOSA 2OHJA 1N2BA 1G5RA 2AEMA 3LBFA 3R75A 4ZAWA 3VH2A 2AC7A 2AZMA 3ZY4A 3L1UA 3U40A 3TS1A 1AOXA 3CUKA 1ZQ1A 2G80A 3P94A 4GGPA 4N3CA 5AVUA 4QYIA 4LF8B 4PYKA 2EL7A 2IOYA 1YL6A 3ZIDA 1L1RA 1X7HA 3MG9A 2R6HA 3PPWA 2BR3A 4PIMA 2F9MA 4Z1OA 3AVYA 4GLBA 1K4KA 2ZRIA 4AY4A 2QE7D 3E22B 4AX8A 2CHFA 4C4RA 1ECJA 5DN9A 4F2HA 5B7QA 2GYWA 1LV8A 1H2HA 4US0R 2I6QA 3V4RA 2F4VB 4PLZA 4I08A 3A04A 5CNMA 1WY7A 3RC9A 1UJBA 3NTLA 1W93A 3CLRD 4REQB 3SHQA 5JNLA 7AT1A 1YTUA 1G63A 5C0OE 5KOJA 4GI5A 1WPGA 1R8SA 2ID4A 2VLIA 2AK3A 3SQNA 3IBYA 4NZMA 2L17A 1AA6A 2QVYX 5DTRA 2HU8A 3LI2A 4J1SA 4Q4HA 4BVBA 3SNHA 4YCSA 3HU3A 4RKWA 2RBEA 5TRTA 3JYNA 1M8GA 3TL3A 3D8SA 1LJLA 3PU6A 4BNMA 1FP2A 1UF9A 2MINB 1V7PC 3B9BA 1IEXA 2RHWA 4O4LA 5G0UA 4CM8B 1HFKA 1CUFA 2FFHA 3F6EX 3ZXXA 3Q2KA 1Z5PA 1NYQA 3GCXA 3G2NA 2QD4A 4G0XA 1SC1A 2HZBA 1U0SY 3DTYA 2EGHA 5JFGA 1U9IA 4XVHA 3AERA 4KVZA 2FZCA 3E27A 1W0JA 3UV3A 5KQLA 3GLTA 1LF5A 1IK4A 1AKNA 3JS5A 1JG3A 4IG4A 4NENB 5BSTA 2WWXA 3L0PA 4C1NA 2J46A 2AFIA 2ZP1A 1Z2OX 5FL7D 5TT1A 4R81A 5TJ9A 4B6EA 2OPHA 1WZCA 4UM9D 1FS4A 3BSYA 1GDHA 2N9UA 4URWR 3VKUA 4CGZA 4DG5A 3ZGZA 1L7QA 5ALYA 2OK8A 3EEQA 5KCMA 2XKBA 3QEKA 2XB4A 3DMRA 3GN2A 4I9UA 4S12A 4OHYA 3V7UA 2XV1A 1WDWB 2HBYA 2OSBA 2QD1A 2HO4A 3TFQA 4DIFA 5IDXA 2W2QA 4H3KB 1Y1SA 3AO0B 5TQ0B 3CG0A 1I1HA 1BOOA 3CX8A 5L3QB 3FZQA 3MQFA 5D5QA 1CHNA 2GS9A 3DWGA 1IJEA 1NUSA 3B6JA 4LZWA 1DTWA 1ZD9A 4J1TC 4M76B 4MW7A 4XH9B 3V4ZA 4WOCA 5HVNA 4KFRA 3CXRA 4GQAA 1E3MA 3HEBA 4DC0A 2QVGA 3FMGA 3IDFA 3U7EB 2G2SA 1RE0A 2DFVA 4CF6A 1QIIA 3E8SA 3VDMA 4QUKA 3FBTA 4UFOA 5IC5A 2XSZA 5GTDA 5EOVA 3ROKA 4I9NA 3JQFA 4NYIR 2DCMA 3KZMA 1ZH6A 1XWIA 1XTZA 1C3OA 2IXDA 2AC2A 5T6MA 4F86A 2C84A 3AB8A 3DUWA 3EUFA 1QOQB 3LCVB 3STUA 5KHOC 1Z7WA 1E2QA 1VIYA 1IZ8A 3LF4A 1CY4A 2GPNA 1QE3A 2XMPA 3PQ3A 4E33A 4EUFA 1WETA 2JFUA 2CXRA 1MR3F 2KI5A 2G06A 3L5KA 4I50F 4F5YA 4NDNE 3WGLA 1JA1A 5DLEA 3SYRA 3KSBC 3GUYA 3GLIB 1K75A 4QXPA 4CFSA 1II8A 3RF7A 3GHYA 3OMWA 3QP9A 3WWEA 3PJRA 1UWKA 5FUMA 1XELA 2C5AA 4MR9B 1D09A 4OK6A 2GJ8A 4RE6A 3NW9A 2N75A 2PYDA 1YGYA 2QTVA 1XNGA 3R40A 3JARA 4FDAA 3QFCA 1N2CE 5DISB 3O7MA 2ODAA 3SVZA 4HJXA 5ICFA 4B6FA 4LX8A 4CETA 2Q4TA 5LMCA 1YFJA 1A5BB 4RVNA 1EUDA 3W6ZA 4A0QA 4H77A 2C4KA 3PV0A 4MEBA 4PSAA 1IBMB 3WC4A 3HSSA 1VLJA 4M8LA 3LDFA 4BE4A 1N6OA 3EIUA 2OE2A 3BWDD 5K8CA 2X3FA 5LA6B 2HJGA 4LIPD 1HPLA 3QUCA 1TCCA 4B35A 2RHOA 2PSFA 1JSLA 4OYLA 3U3DA 1D2GA 1KI4A 2RAUA 1J21A 1F5SA 3COYA 3ANYB 2XLCA 4YJHA 5IK2D 4B6PA 2RCYA 2OQVA 4QGHA 2LZ0A 1Y6GA 4A91A 5JMTA 2XTNA 3CNOA 1VKOA 2Q2WA 3QVUA 3SNKA 1X7WA 3HV2A 3T9AA 3ZX4A 1AA9A 2GK6A 4WZBB 5TS2A 2CBGA 2MSWA 1MG0A 4HPXB 3ISJA 3HADA 1JAZA 2J30A 5AJXA 4L6CA 4AULA 1O94D 3WXBA 4D4MA 2ATIA 1QTQA 3K5WA 4QQKA 4DNXA 1ICEA 3WL5A 5IW8A 1X15A 3UIEA 4QO7A 1XTTA 1JLSA 1L4GA 2EW8A 1LC3A 3WRVA 5K03A 4YO7A 5FORA 1C1XA 5BQFA 3O8QB 4GBED 4KAJA 4E14A 1UP6A 2V4UA 3STTA 4IM7A 1W4AA 1LDNA 4FLMA 5F1OA 5ALHA 1ECFA 4AMVA 3WKBA 4E5KA 3ZE2B 2XUGA 1ZNYA 1PKEA 4MVJP 3L77A 3OSUA 4JLJA 4GYKA 1E4OA 2AXPA 1EVJA 3G2HA 5DWDA 3D6TB 1CB7A 4QRIA 5M2QA 3SVLA 4N5LA 3AVWA 4PS0A 3FCAA 1DKUA 2ZVJA 2IHUA 5BRAA 1ISGA 2A0KA 1MJNA 5CIYA 1G38A 3RANA 2BMAA 3VPDA 3B1KA 3CNLA 2P65A 5KJEA 6Q21A 3VU3A 2H7CA 2PWYA 5LQDA 1E2LA 2Q50A 1S9HA 2PL9A 1UMBA 2X5KO 4LJYA 4RJIA 3STVA 3E18A 3NHPA 2O8FA 2HIGA 3NB0A 1CNEA 4BAUA 1GCGA 4Z9AA 1E8NA 2PKXA 4D3FA 4D0GA 4RA6A 3K73O 2BKLA 1KJWA 2FN3A 2PLFA 4RNCA 4HNVA 3U80A 1ULAA 5GY7A 2G82A 3I1YA 1C8BA 1I2MA 1MFZA 3KU1A 3MW8A 2RCNA 4LSMA 5BN3A 2P7IA 2HD4A 4BX8A 4OP1A 4TV8B 3ZUPA 4YMWA 4G25A 1U7WA 1JWAB 2D5AA 5EHGA 3PRHA 3CTPA 2OXRA 3UXYA 2ATVA 4MVJF 3VNAA 4E2ZA 2ZK7A 4KQ2A 3SY8A 5K8TA 4GXNA 1VXOA 2P1RA 3U0BA 4KR3A 2HCBA 4EYQA 4CQMA 4DT1A 1FFWA 1YZ3A 2ANCA 4GX0A 4HVTA 1DADA 3VDXA 3COSA 4OYYA 1TUIA 3DDZX 2EKBA 5EXEA 2J4DA 2NU7A 4MR8B 1T2CA 2EEPA 2ONJA 5BYAA 4NS4A 4AQYB 2Q5OA 1T9CA 4MUBA 1KE1A 1I9CA 2IJGX 1Z28A 5FPYA 3EQ8A 3QFRA 5A7GA 2OXIA 5BW8A 1Q20A 2PH7A 2PD3A 3ASZA 5AVVA 1XE3A 2HDWA 2D4AA 3LY8A 5FBQB 1ZGGA 3K9CA 3FUXA 4KH1A 5CLLA 3UGQA 1XQYA 4LNUA 2GKSA 1E8DA 2A57A 4ZPJA 3UJHA 4YGXB 3FVQA 4G0WA 3LOUA 1Q92A 2DETA 1ZP6A 1GGVA 2FZ5A 1JIUA 3OICA 1BTOA 5DGCA 621PA 5LQKA 2XMDA 3V3TA 3U44B 1W0KA 4OI1A 2NAFA 5JBNA 1JSRA 1Z56C 2W6NA 5CPBA 4UHJA 5CM8B 5BO5A 1K2WA 4R1PA 1V5GA 3PL5A 2L0XA 2POQX 4Q1AA 1DJNA 4XGIA 4EP1A 1OGYA 1XVIA 2YV2A 1OFVA 1BD3A 5AVYA 1U9YA 2I4IA 3B13B 1ODLA 2WAAA 1CY8A 2QSZA 5G53C 3SC6A 3UG6A 5ES4B 5C37A 3KJHA 2FWRA 4PTZA 2R62A 4GX2A 3CB4A 3OPXA 5FYDA 4M3NA 3ETCA 4H17A 1EK1A 4JOBA 1B15A 5TE9A 2NWQA 3R0IA 2BE9A 2ZVDA 1CQIB 2A30A 3CX3A 3G02A 4K3UA 4QXMA 3WVNA 3H83A 3NHKA 4N8EA 5DH9A 5E2AA 4UUQA 1QAOA 5BN5B 3ZXUB 3LX6A 1D07A 3U1BA 4OXKA 5T7BA 1X94A 2VDUE 3L0YA 2GD0A 2ATXA 5JY6A 1W48A 4I3GA 1HFEL 4P81A 5ERGB 3TXYA 4NCIA 4UD6A 1EYZA 1LY1A 1TYCA 1SVIA 2XXBA 3HFSA 2WFZA 3GVPA 4HWTA 3G6KA 2G25A 4IQ4A 3HS3A 4ZAZA 3AMVA 1SUSA 1N33B 1IHXA 3LPMA 2FUKA 4FZRA 1B6SA 1U90A 3KYDA 4IJ6A 3ZY6A 3K8OE 3RIXA 1KKLA 3EAQA 2HF2A 3ZHBA 3R0JA 4XEHA 1V26A 2B7LA 1NASA 4BFWA 1ORTA 4FD2A 4TV9A 4MWZA 4DRZA 1D7AA 3SC2B 3VMFA 2IUEA 3M6MD 2OQIA 3FYUC 1Z73A 3CT4A 2C2HA 1YFLA 1MH9A 4MGKR 3PNYA 1MDBA 4P7KA 3ENWA 3DKRA 4NAUA 2COEA 2HI0A 3O83A 1I3NA 1OZFA 1F0PA 2M2IA 4RTQA 4CT4B 3FHTA 1NQVA 2J5QA 3NM6B 2G6TA 3KSDO 5CH3A 5KQRA 5B3KA 4R8RA 4DBLE 1HQYE 4CIWA 3KEQA 3HCFA 1Z4QA 4BP9A 3E9ZA 5AFSA 3OIGA 3F74A 3DMYA 4KBFA 1YO6A 4BVGA 5H1YA 3DBLA 3PNKA 5C8YA 3OOWA 2Q6OA 3M70A 3QF7A 2W2MA 4IRUB 2OWEA 4G65A 2RGYA 3AM3A 1T9KA 3PXAA 3V2UA 1OD6A 2RONA 4HQKA 4CM4B 4GNRA 3QF4B 1U02A 3TBKA 5JAMA 4C88A 1DWPA 3IOMA 3LS2A 2HKIA 2VF5X 2FH5B 2WVJA 3RYHA 4V0RA 3W3AH 3O84A 3IDAA 5L7TA 4DJEC 5CNIA 4NEGA 1E79A 1OGIA 1Z7EA 2N46A 2BRUC 3SJ7A 4QRDA 3VAZA 1TVMA 1EK2A 2GZ1A 1TK3A 3LVBA 1GNQA 3CZPA 2PFSA 1G1MA 1NGSA 2H9AA 2P7HA 3W9UA 3TWOA 3RI3A 1LZKA 3FI0A 1CW2B 2JLSA 1M2OB 1SVLA 4DLAA 1OPRA 5T8KA 4G1UC 1OX6A 2AMJA 1E63A 2EJVA 2X41A 3ODPA 1G8JA 13PKA 4DMGA 2H4FA 1GA1A 4CLRB 4HEQA 5FA5A 4CODB 4Q9NA 2HPVA 5KYTA 2P8JA 2EJBA 2ZWIA 2PL5A 1X9IA 3HYTA 1NSFA 4N40A 3A27A 3HDHA 5J2UF 4QGSA 2OORA 3PHHA 4FQ5A 3L6UA 3FLAA 1OWLA 3JWGA 4NDAA 5DTEA 1A9ZA 1W0JD 4HPJB 3H0EA 4N5NA 2VDLB 4M0FA 3ZH2A 5EC8A 1RXWA 3FF4A 2I2DA 1RXYA 5F21A 1N1MA 2X2PA 1UT8A 1XXHE 4OFWA 4WXRA 3BFXA 3LCMA 4XPIB 5HKLA 4JP8A 1CNFA 1OT3A 2C77A 1MIOA 3FW1A 4OHMA 1EA5A 2LP4Y 4BEWA 1PE0A 3L43A 1FQOA 1QMGA 1Z82A 2F00A 2NXNA 3M81A 3BFVA 4LZNA 1V71A 4JC4A 1TMGE 4DDKA 1YKSA 4EMUA 1NX9A 4CF4A 4PAWA 4YJ2B 4HTFB 2NXEA 1RYYA 4JEUA 4O4HA 3N0XA 4EHKA 4O29A 4MR7B 2R47A 5AOVA 2LUOA 3PC2A 2CY0A 2DJ5A 3WMGA 1KBOA 1MB2A 1SFRA 1M1YE 4HLUA 2V7XA 1FBNA 1FQKA 1NVBA 3EHEA 3JVUA 5P8WA 2BHSA 1CQJA 3EFOB 4NOLA 1NATA 1FS6A 1T2UA 3HJFA 3BXFA 1LPMA 2P2SA 4FDVA 5BSUA 4C0QC 4K8RB 3Q5EA 3X1XA 3IHTA 3KR1A 3IUYA 4BX0A 1IXRC 4NBRA 5EKUA 3THXA 1NVKA 2ZBRA 3HJHA 2P5SA 3HCNA 3IFSA 2IEBA 4V0SA 5HILA 1N4DA 1SUIA 4HHEA 4JXKA 4X3PA 3ABRB 3FR8A 1SOWA 3K6SA 3I9LA 4QBHA 4D3YA 4CMKA 3WGIA 1GNVA 3EC7A 2HTEA 3CUYA 3PQFA 4HEHA 4MVJH 2LR0A 4OK3A 4AZ3A 1UUFA 1GV0A 3II6X 5TPWA 4I55A 1O96B 2FWAA 4TRMA 4DR2B 4AG6A 4PTYA 3DF9A 4K40A 3HZOA 3NIWA 3B9QA 3AUKA 4OP3A 1JHZA 4GNKA 2FP4A 1V45E 3A6LA 2IUTA 4ARZB 1WUIS 2OUIA 5MN5A 3PEUA 1VCNA 2PA3A 1YBMA 1QPGA 2AOWA 2H1FA 4Q05A 5GJWC 3TMKA 3C7AA 3C8HA 4LV8B 3BWYA 3KLOA 4KGXA 2A94A 3SDZA 4OGLA 4DV3B 1Q6YA 3KUCA 4IGIA 2IC5A 4C89A 3OLZA 4L6AA 1M2FA 3WYNA 2ODEA 5J4YA 1TYEB 3DOHA 5LQNA 2IH5A 4WEOA 1YL5A 1L5KA 1FXUA 3HZRA 5DX1A 4CEIB 3H4VA 2JEOA 1FK8A 3G2PA 2EYUA 2X3YA 1SQSA 1Z45A 1DEOA 2BKUA 1R0BA 2BBOA 3GFTA 4HAXA 3V5NA 1U3FA 3JVVA 1RHKA 3NEJA 1WZNA 2E1PA 4H35A 3NTXA 4LY9A 3UYKA 3EGDB 1T1SA 3NVDA 4JGIA 3ZHYA 4JODA 9GPBA 3ITKA 2A5YB 1A0OA 2BE7A 5GAJA 4JL5A 1U28A 3MT8A 2R7KA 3SR0A 1T0PA 3HBAA 1Z5NA 3EVFA 4CKWA 2JASA 3IIMA 2CHVA 3QE9Y 3PXUA 2FSPA 4DLBA 5BORA 3MVEA 2H18A 4UDXX 5TNXA 1XPOA 4R3WA 1H42A 2VI5A 1U8YA 1VBMA 3JASA 1EI9A 4K0RA 5KSWB 3ND7A 4EJMA 2GO7A 1NNLA 2YYSA 5K0EA 3NETA 1J2TA 5K01A 1GRQA 2OZLA 2W42A 3QSGA 5F64A 1VA5A 1XK6A 4LTMA 4OFXA 1L4MA 2WABA 4MDYA 4P3YA 1QHYA 4LHYA 4WGGA 1GQQA 2HNKA 3MWDA 1XCOA 2JK1A 3ORRA 4KKVA 5IU6A 1XEWX 2C3YA 3MN1A 2II6A 2GN1A 1CR2A 2C5FA 1WMSA 1Y8QB 1TDJA 2I6UA 3IE2A 2PUBA 1S01A 1YT5A 5KOHA 3BMCB 1RS0A 4Y7DA 3PF8A 4R1LA 1LDEA 2J3MA 1XKTA 2OA0A 1HE4A 3EXEB 4P3PA 1JHYA 3QKSB 4MVJG 1QGUA 1PGNA 4GZ3A 3T5AA 1NW8A 1VMDA 4ISBA 4GZMA 1WXDA 1YDFA 4M8KA 3RRZA 4AXBA 5DEIA 1Y89A 3TAUA 2P9YA 3EHDA 2Q07A 3CNBA 4Q01A 2O50A 1EXMA 3PLRA 1NVGA 4HNRA 1B16A 2QOEA 1VHJA 3OCCA 3OPVA 4LRSB 3FJOA 5HXAA 1MNQA 1RWVA 4DYDA 3AM5A 3C3BA 1NBOA 4HNAB 4YUAA 3DTVA 3GJZA 3N76A 1HOXA 2V5VA 4TS3A 3ZW8A 4LK2A 4MW9A 3I28A 4B3IA 3DEKA 2CGEA 1O03A 3FFTA 5TQ2A 1RVDA 4BASA 5FBVB 1TYZA 2BM0A 1BKYA 2GVNA 4A8PA 4MJLA 3F9RA 3WI7A 4B7CA 6REQA 3PEYA 1ONSA 1SBNE 3A31A 4ARAA 1KP9A 1T26A 2J9FB 1LTHR 5CIQA 5IT0A 3GJ6A 3OHSX 3GJYA 4IJVA 4LS3A 2P69A 5C1BA 1Z8NA 2I4MA 4TLCA 3TPFA 2XA2A 4IXNA 1PDWA 1U0LA 1DQZA 2X0RA