2A8EA

Three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
210
structure length
210
Chain Sequence
TQMRFTEEDFNTFTIEGLDARMEVLKETVRPKLTALGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWESHVFVWFAIIYESPIKEEYGKLLEVNQETITKNIPDSFVWSADHTKPGVHKQSEMDKEQLKTLFERLQTVKKAELLCGIQLQKEEVLNMNNQEFLQRIDDAFKQLAFLYRLTQKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein yktB
publication title Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 60
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06335 DUF1054 Protein of unknown function (DUF1054)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.20 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 2a8eA00
2A8EA 3MQZA
chains in the Genus database with same CATH superfamily
2ZZGA 3E9IA 4YRNA 2RHQA 3PZCA 4YCWA 1QF6A 4XU3A 3W3SA 4CS4A 3IKMB 1E1TA 3V7CA 1RIQA 2CJBA 3I7FA 4K87A 4CH5A 4YDQA 2CJAA 2DQ3A 3RIRA 2DTHA 4YRKA 3NEMA 2AKWB 3LSSA 4P73C 1FYFA 2QHVA 4P3OA 2QHUA 4HWOA 2E41A 3ICAA 1VQZA 1EIYA 1EFWA 3HXUA 4YRSA 2ZT7A 3IKLA 1WPYA 2CJ9A 3RKXA 2DTIA 4HWRA 4RQFA 3QO8A 4XTYA 2DTOA 1EQRA 4YPFA 2DVEA 1H4VB 2EWNA 3IG2A 2EJ9A 3A5ZA 2ARUA 3VQXA 4H2SA 4X5OA 2PMEA 4LVLA 1NYRA 3HRIA 4OLFA 4DPGA 1JJCA 3HXZA 4UP7A 1E24A 4K88A 2CIMA 4XEOA 4YRCA 2DQ0A 1NNHA 2ZR3A 2E5AA 4XTXA 2ALYA 3LC0A 3L4GA 2I4OA 4YRJA 3L1AA 3TEHA 3M4QA 3P8TA 3EFSA 3A74A 3E9HA 4P73A 4TQFA 5K1XA 1KMMA 2ZT5A 2ZNJA 2ZT6A 2Q7GA 3A32A 4OP0A 2E64A 2I4NA 4XU0A 2EJFA 3FJPA 4TVAA 1YFSA 1B70A 3HRKA 2RHSB 3ERRA 2Q7EA 4YP0A 3OD1A 1ASZA 3REUA 3TEGA 2J3MA 2ZGWA 1YFTA 3VQWA 3TUPA 1WQ7A 2J3LA 3R07A 1X55A 1BBWA 1B76A 1WU7A 4H2XB 4NCXA 1ASYA 4UP8A 4RMFA 11ASA 3CMQA 4YRQA 1GGMA 1NJ1A 4H2WA 3HXWA 1PYSA 2Q7HA 4E51A 1L0WA 3L2ZA 4PHCA 4XU2A 3V7RA 3LSQA 4KR3A 4H2YA 3A7UA 4ZIBA 1Z7MA 3NENA 3VQYA 4XTVA 2IY5A 5ELOA 4TQDA 2P0LA 4P75C 4HA8A 2DXUA 2G4CA 5K1PA 2Q5IA 3PCOB 2EAYA 3A31A 2ZINA 2QHTA 1IL2A 4DQ2A 3MF1A 4YRTA 1H4TA 5HGQA 1EVLA 2DZCA 3HTZA 1Z7NA 4H2TA 1BIAA 4EO4A 2PMFA 2ZT8A 1HTTA 2AKWA 4CS2A 2E65A 3WQZA 2HNIA 4YCUA 4XTZA 1SRYA 4YRMA 4WJ4A 1X2HA 1X54A 4P3PA 3HFZB 1YFRA 2ZCEA 4UPAA 2NS6A 2ZZFA 3RKWA 2ZR2A 4TWAA 3RGLA 4TTVA 4YRGA 5F5WA 4TVYA 1N9WA 2ODRC 4P74C 2AMCB 2ZZEA 4LNSA 3HFZA 3DSQA 1WNLA 4YRPA 4P75A 2C7IA 1EVKA 1G5HA 4YCVA 1LYLA 5C53B 1G51A 2A8EA 3REXA 2ZNIA 2AMCA 3IALA 2P5IA 3BFMA 4HT4A 4TVWA 1B7YB 1X2GA 2ZXFA 3RUXA 2DU5A 4KQEA 2XTIA 12ASA 4CH6A 1NJ6A 1SESA 4XU1A 4P72C 2DU7A 3VQVA 3RL6A 4WF2A 4XTWA 2C8MA 4Q6GA 2RHSA 1H4SA 3HY1A 3P8VA 3RACA 3VBBA 1W66A 3UFGA 2DDZA 1E1OA 4CS3A 4G84A 4ZTUB 1HC7A 2E10A 3QTCA 4P74A 1NYQA 4LVMA 4YYEA 3UH0A 1HXDA 4H2XA 3MF2A 4PG3A 5KNNA 4EX5A 1USYC 4O2DA 1ADJA 5C51B 1ADYA 1WQWA 2DZ9A 1E22A 4L87A 1EIYB 1KMNA 1YB3A 3NETA 3HXVA 4LVIA 1SERA 3M4PA 2Q5HA 3MQZA 4CH4A 4P71C 3HXYA 1WYDA 3PCOA 1BBUA 1J5WA 4P72A 2DXTA 4UP9A 4K86A 2ZIMA 4XTUA 1B8AA 4BW9A 2EJGA 3NELA 4H02A 3KFUA 4BWAA 4YRRA 1X01A 4YREA 3UGTA 1NJ8A 2E3CA 3V7SA 2CGHA 1C0AA 3RKYA 5E3IA 4J15A 2ARTA 3P8YA 3QO5A 1JJCB 4RDXA 1ATIA 1X56A 4HWTA 1YGBA 2ALYB 3A5YA 4ZTZB 3L4GB 1BIBA 3A7AA 4KR2A 5C52B 3TEHB 4H2UA 1NJ2A 3QNEA 3MEYA 2DKGA 4YRIA 3HFVA 4LVJA 2DJZA 1USYA 3RF1A 4XEMA 4YRFA 4CH3A 4AH6A 3BJUA 2QHSA 5ELNA 3G1ZA 3A7RA 4TVAB 1B70B 4LVKA 3V8JA 4HVCA 2ZIOA 4WI1A 2ODRD 1QE0A 1G5IA 3UGQA 3V8LA 2I4MA 1H4QA 4HWSA 4P71A 1SETA 4YROA 1NJ5A 1WLEA 2FYKA 4HWPA 2E1HA 4P3NA 3QO7A 4WJ3M 1KOGA 4G85A 4RQEA 2ARSA 2RHQB 1B7YA 3HXXA 3HY0A 2ZTGA 1PYSB 2EL9A 1EOVA 4YRLA 2XGTA 3EFRA 2DEQA 3V8KA 2IY5B 4Q15A 4H2VA 2I4LA
chains in the Genus database with same CATH topology
2ZZGA 3E9IA 4YRNA 2RHQA 3PZCA 4YCWA 1QF6A 4XU3A 3W3SA 4CS4A 3IKMB 1E1TA 3V7CA 1RIQA 2CJBA 3I7FA 4K87A 4CH5A 4YDQA 2CJAA 2DQ3A 3RIRA 2DTHA 4YRKA 3NEMA 2AKWB 3LSSA 4P73C 1FYFA 2QHVA 4P3OA 2QHUA 4HWOA 2E41A 3ICAA 1VQZA 1EIYA 1EFWA 3HXUA 4YRSA 2ZT7A 3IKLA 1WPYA 2CJ9A 3RKXA 2DTIA 4HWRA 4RQFA 3QO8A 4XTYA 2DTOA 1EQRA 4YPFA 2DVEA 1H4VB 2EWNA 3IG2A 2EJ9A 3A5ZA 2ARUA 3VQXA 4H2SA 4X5OA 2PMEA 4LVLA 1NYRA 3HRIA 4OLFA 4DPGA 1JJCA 3HXZA 4UP7A 1E24A 4K88A 2CIMA 4XEOA 4YRCA 2DQ0A 1NNHA 2ZR3A 2E5AA 4XTXA 2ALYA 3LC0A 3L4GA 2I4OA 4YRJA 3L1AA 3TEHA 3M4QA 3P8TA 3EFSA 3A74A 3E9HA 4P73A 4TQFA 5K1XA 1KMMA 2ZT5A 2ZNJA 2ZT6A 2Q7GA 3A32A 4OP0A 2E64A 2I4NA 4XU0A 2EJFA 3FJPA 4TVAA 1YFSA 1B70A 3HRKA 2RHSB 3ERRA 2Q7EA 4YP0A 3OD1A 1ASZA 3REUA 3TEGA 2J3MA 2ZGWA 1YFTA 3VQWA 3TUPA 1WQ7A 2J3LA 3R07A 1X55A 1BBWA 1B76A 1WU7A 4H2XB 4NCXA 1ASYA 4UP8A 4RMFA 11ASA 3CMQA 4YRQA 1GGMA 1NJ1A 4H2WA 3HXWA 1PYSA 2Q7HA 4E51A 1L0WA 3L2ZA 4PHCA 4XU2A 3V7RA 3LSQA 4KR3A 4H2YA 3A7UA 4ZIBA 1Z7MA 3NENA 3VQYA 4XTVA 2IY5A 5ELOA 4TQDA 2P0LA 4P75C 4HA8A 2DXUA 2G4CA 5K1PA 2Q5IA 3PCOB 2EAYA 3A31A 2ZINA 2QHTA 1IL2A 4DQ2A 3MF1A 4YRTA 1H4TA 5HGQA 1EVLA 2DZCA 3HTZA 1Z7NA 4H2TA 1BIAA 4EO4A 2PMFA 2ZT8A 1HTTA 2AKWA 4CS2A 2E65A 3WQZA 2HNIA 4YCUA 4XTZA 1SRYA 4YRMA 4WJ4A 1X2HA 1X54A 4P3PA 3HFZB 1YFRA 2ZCEA 4UPAA 2NS6A 2ZZFA 3RKWA 2ZR2A 4TWAA 3RGLA 4TTVA 4YRGA 5F5WA 4TVYA 1N9WA 2ODRC 4P74C 2AMCB 2ZZEA 4LNSA 3HFZA 3DSQA 1WNLA 4YRPA 4P75A 2C7IA 1EVKA 1G5HA 4YCVA 1LYLA 5C53B 1G51A 2A8EA 3REXA 2ZNIA 2AMCA 3IALA 2P5IA 3BFMA 4HT4A 4TVWA 1B7YB 1X2GA 2ZXFA 3RUXA 2DU5A 4KQEA 2XTIA 12ASA 4CH6A 1NJ6A 1SESA 4XU1A 4P72C 2DU7A 3VQVA 3RL6A 4WF2A 4XTWA 2C8MA 4Q6GA 2RHSA 1H4SA 3HY1A 3P8VA 3RACA 3VBBA 1W66A 3UFGA 2DDZA 1E1OA 4CS3A 4G84A 4ZTUB 1HC7A 2E10A 3QTCA 4P74A 1NYQA 4LVMA 4YYEA 3UH0A 1HXDA 4H2XA 3MF2A 4PG3A 5KNNA 4EX5A 1USYC 4O2DA 1ADJA 5C51B 1ADYA 1WQWA 2DZ9A 1E22A 4L87A 1EIYB 1KMNA 1YB3A 3NETA 3HXVA 4LVIA 1SERA 3M4PA 2Q5HA 3MQZA 4CH4A 4P71C 3HXYA 1WYDA 3PCOA 1BBUA 1J5WA 4P72A 2DXTA 4UP9A 4K86A 2ZIMA 4XTUA 1B8AA 4BW9A 2EJGA 3NELA 4H02A 3KFUA 4BWAA 4YRRA 1X01A 4YREA 3UGTA 1NJ8A 2E3CA 3V7SA 2CGHA 1C0AA 3RKYA 5E3IA 4J15A 2ARTA 3P8YA 3QO5A 1JJCB 4RDXA 1ATIA 1X56A 4HWTA 1YGBA 2ALYB 3A5YA 4ZTZB 3L4GB 1BIBA 3A7AA 4KR2A 5C52B 3TEHB 4H2UA 1NJ2A 3QNEA 3MEYA 2DKGA 4YRIA 3HFVA 4LVJA 2DJZA 1USYA 3RF1A 4XEMA 4YRFA 4CH3A 4AH6A 3BJUA 2QHSA 5ELNA 3G1ZA 3A7RA 4TVAB 1B70B 4LVKA 3V8JA 4HVCA 2ZIOA 4WI1A 2ODRD 1QE0A 1G5IA 3UGQA 3V8LA 2I4MA 1H4QA 4HWSA 4P71A 1SETA 4YROA 1NJ5A 1WLEA 2FYKA 4HWPA 2E1HA 4P3NA 3QO7A 4WJ3M 1KOGA 4G85A 4RQEA 2ARSA 2RHQB 1B7YA 3HXXA 3HY0A 2ZTGA 1PYSB 2EL9A 1EOVA 4YRLA 2XGTA 3EFRA 2DEQA 3V8KA 2IY5B 4Q15A 4H2VA 2I4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8E A;  3MQZ A; 
#chains in the Genus database with same CATH topology
 2ZZG A;  3E9I A;  4YRN A;  2RHQ A;  3PZC A;  4YCW A;  1QF6 A;  4XU3 A;  3W3S A;  4CS4 A;  3IKM B;  1E1T A;  3V7C A;  1RIQ A;  2CJB A;  3I7F A;  4K87 A;  4CH5 A;  4YDQ A;  2CJA A;  2DQ3 A;  3RIR A;  2DTH A;  4YRK A;  3NEM A;  2AKW B;  3LSS A;  4P73 C;  1FYF A;  2QHV A;  4P3O A;  2QHU A;  4HWO A;  2E41 A;  3ICA A;  1VQZ A;  1EIY A;  1EFW A;  3HXU A;  4YRS A;  2ZT7 A;  3IKL A;  1WPY A;  2CJ9 A;  3RKX A;  2DTI A;  4HWR A;  4RQF A;  3QO8 A;  4XTY A;  2DTO A;  1EQR A;  4YPF A;  2DVE A;  1H4V B;  2EWN A;  3IG2 A;  2EJ9 A;  3A5Z A;  2ARU A;  3VQX A;  4H2S A;  4X5O A;  2PME A;  4LVL A;  1NYR A;  3HRI A;  4OLF A;  4DPG A;  1JJC A;  3HXZ A;  4UP7 A;  1E24 A;  4K88 A;  2CIM A;  4XEO A;  4YRC A;  2DQ0 A;  1NNH A;  2ZR3 A;  2E5A A;  4XTX A;  2ALY A;  3LC0 A;  3L4G A;  2I4O A;  4YRJ A;  3L1A A;  3TEH A;  3M4Q A;  3P8T A;  3EFS A;  3A74 A;  3E9H A;  4P73 A;  4TQF A;  5K1X A;  1KMM A;  2ZT5 A;  2ZNJ A;  2ZT6 A;  2Q7G A;  3A32 A;  4OP0 A;  2E64 A;  2I4N A;  4XU0 A;  2EJF A;  3FJP A;  4TVA A;  1YFS A;  1B70 A;  3HRK A;  2RHS B;  3ERR A;  2Q7E A;  4YP0 A;  3OD1 A;  1ASZ A;  3REU A;  3TEG A;  2J3M A;  2ZGW A;  1YFT A;  3VQW A;  3TUP A;  1WQ7 A;  2J3L A;  3R07 A;  1X55 A;  1BBW A;  1B76 A;  1WU7 A;  4H2X B;  4NCX A;  1ASY A;  4UP8 A;  4RMF A;  11AS A;  3CMQ A;  4YRQ A;  1GGM A;  1NJ1 A;  4H2W A;  3HXW A;  1PYS A;  2Q7H A;  4E51 A;  1L0W A;  3L2Z A;  4PHC A;  4XU2 A;  3V7R A;  3LSQ A;  4KR3 A;  4H2Y A;  3A7U A;  4ZIB A;  1Z7M A;  3NEN A;  3VQY A;  4XTV A;  2IY5 A;  5ELO A;  4TQD A;  2P0L A;  4P75 C;  4HA8 A;  2DXU A;  2G4C A;  5K1P A;  2Q5I A;  3PCO B;  2EAY A;  3A31 A;  2ZIN A;  2QHT A;  1IL2 A;  4DQ2 A;  3MF1 A;  4YRT A;  1H4T A;  5HGQ A;  1EVL A;  2DZC A;  3HTZ A;  1Z7N A;  4H2T A;  1BIA A;  4EO4 A;  2PMF A;  2ZT8 A;  1HTT A;  2AKW A;  4CS2 A;  2E65 A;  3WQZ A;  2HNI A;  4YCU A;  4XTZ A;  1SRY A;  4YRM A;  4WJ4 A;  1X2H A;  1X54 A;  4P3P A;  3HFZ B;  1YFR A;  2ZCE A;  4UPA A;  2NS6 A;  2ZZF A;  3RKW A;  2ZR2 A;  4TWA A;  3RGL A;  4TTV A;  4YRG A;  5F5W A;  4TVY A;  1N9W A;  2ODR C;  4P74 C;  2AMC B;  2ZZE A;  4LNS A;  3HFZ A;  3DSQ A;  1WNL A;  4YRP A;  4P75 A;  2C7I A;  1EVK A;  1G5H A;  4YCV A;  1LYL A;  5C53 B;  1G51 A;  2A8E A;  3REX A;  2ZNI A;  2AMC A;  3IAL A;  2P5I A;  3BFM A;  4HT4 A;  4TVW A;  1B7Y B;  1X2G A;  2ZXF A;  3RUX A;  2DU5 A;  4KQE A;  2XTI A;  12AS A;  4CH6 A;  1NJ6 A;  1SES A;  4XU1 A;  4P72 C;  2DU7 A;  3VQV A;  3RL6 A;  4WF2 A;  4XTW A;  2C8M A;  4Q6G A;  2RHS A;  1H4S A;  3HY1 A;  3P8V A;  3RAC A;  3VBB A;  1W66 A;  3UFG A;  2DDZ A;  1E1O A;  4CS3 A;  4G84 A;  4ZTU B;  1HC7 A;  2E10 A;  3QTC A;  4P74 A;  1NYQ A;  4LVM A;  4YYE A;  3UH0 A;  1HXD A;  4H2X A;  3MF2 A;  4PG3 A;  5KNN A;  4EX5 A;  1USY C;  4O2D A;  1ADJ A;  5C51 B;  1ADY A;  1WQW A;  2DZ9 A;  1E22 A;  4L87 A;  1EIY B;  1KMN A;  1YB3 A;  3NET A;  3HXV A;  4LVI A;  1SER A;  3M4P A;  2Q5H A;  3MQZ A;  4CH4 A;  4P71 C;  3HXY A;  1WYD A;  3PCO A;  1BBU A;  1J5W A;  4P72 A;  2DXT A;  4UP9 A;  4K86 A;  2ZIM A;  4XTU A;  1B8A A;  4BW9 A;  2EJG A;  3NEL A;  4H02 A;  3KFU A;  4BWA A;  4YRR A;  1X01 A;  4YRE A;  3UGT A;  1NJ8 A;  2E3C A;  3V7S A;  2CGH A;  1C0A A;  3RKY A;  5E3I A;  4J15 A;  2ART A;  3P8Y A;  3QO5 A;  1JJC B;  4RDX A;  1ATI A;  1X56 A;  4HWT A;  1YGB A;  2ALY B;  3A5Y A;  4ZTZ B;  3L4G B;  1BIB A;  3A7A A;  4KR2 A;  5C52 B;  3TEH B;  4H2U A;  1NJ2 A;  3QNE A;  3MEY A;  2DKG A;  4YRI A;  3HFV A;  4LVJ A;  2DJZ A;  1USY A;  3RF1 A;  4XEM A;  4YRF A;  4CH3 A;  4AH6 A;  3BJU A;  2QHS A;  5ELN A;  3G1Z A;  3A7R A;  4TVA B;  1B70 B;  4LVK A;  3V8J A;  4HVC A;  2ZIO A;  4WI1 A;  2ODR D;  1QE0 A;  1G5I A;  3UGQ A;  3V8L A;  2I4M A;  1H4Q A;  4HWS A;  4P71 A;  1SET A;  4YRO A;  1NJ5 A;  1WLE A;  2FYK A;  4HWP A;  2E1H A;  4P3N A;  3QO7 A;  4WJ3 M;  1KOG A;  4G85 A;  4RQE A;  2ARS A;  2RHQ B;  1B7Y A;  3HXX A;  3HY0 A;  2ZTG A;  1PYS B;  2EL9 A;  1EOV A;  4YRL A;  2XGT A;  3EFR A;  2DEQ A;  3V8K A;  2IY5 B;  4Q15 A;  4H2V A;  2I4L A; 
#chains in the Genus database with same CATH homology
 2ZZG A;  3E9I A;  4YRN A;  2RHQ A;  3PZC A;  4YCW A;  1QF6 A;  4XU3 A;  3W3S A;  4CS4 A;  3IKM B;  1E1T A;  3V7C A;  1RIQ A;  2CJB A;  3I7F A;  4K87 A;  4CH5 A;  4YDQ A;  2CJA A;  2DQ3 A;  3RIR A;  2DTH A;  4YRK A;  3NEM A;  2AKW B;  3LSS A;  4P73 C;  1FYF A;  2QHV A;  4P3O A;  2QHU A;  4HWO A;  2E41 A;  3ICA A;  1VQZ A;  1EIY A;  1EFW A;  3HXU A;  4YRS A;  2ZT7 A;  3IKL A;  1WPY A;  2CJ9 A;  3RKX A;  2DTI A;  4HWR A;  4RQF A;  3QO8 A;  4XTY A;  2DTO A;  1EQR A;  4YPF A;  2DVE A;  1H4V B;  2EWN A;  3IG2 A;  2EJ9 A;  3A5Z A;  2ARU A;  3VQX A;  4H2S A;  4X5O A;  2PME A;  4LVL A;  1NYR A;  3HRI A;  4OLF A;  4DPG A;  1JJC A;  3HXZ A;  4UP7 A;  1E24 A;  4K88 A;  2CIM A;  4XEO A;  4YRC A;  2DQ0 A;  1NNH A;  2ZR3 A;  2E5A A;  4XTX A;  2ALY A;  3LC0 A;  3L4G A;  2I4O A;  4YRJ A;  3L1A A;  3TEH A;  3M4Q A;  3P8T A;  3EFS A;  3A74 A;  3E9H A;  4P73 A;  4TQF A;  5K1X A;  1KMM A;  2ZT5 A;  2ZNJ A;  2ZT6 A;  2Q7G A;  3A32 A;  4OP0 A;  2E64 A;  2I4N A;  4XU0 A;  2EJF A;  3FJP A;  4TVA A;  1YFS A;  1B70 A;  3HRK A;  2RHS B;  3ERR A;  2Q7E A;  4YP0 A;  3OD1 A;  1ASZ A;  3REU A;  3TEG A;  2J3M A;  2ZGW A;  1YFT A;  3VQW A;  3TUP A;  1WQ7 A;  2J3L A;  3R07 A;  1X55 A;  1BBW A;  1B76 A;  1WU7 A;  4H2X B;  4NCX A;  1ASY A;  4UP8 A;  4RMF A;  11AS A;  3CMQ A;  4YRQ A;  1GGM A;  1NJ1 A;  4H2W A;  3HXW A;  1PYS A;  2Q7H A;  4E51 A;  1L0W A;  3L2Z A;  4PHC A;  4XU2 A;  3V7R A;  3LSQ A;  4KR3 A;  4H2Y A;  3A7U A;  4ZIB A;  1Z7M A;  3NEN A;  3VQY A;  4XTV A;  2IY5 A;  5ELO A;  4TQD A;  2P0L A;  4P75 C;  4HA8 A;  2DXU A;  2G4C A;  5K1P A;  2Q5I A;  3PCO B;  2EAY A;  3A31 A;  2ZIN A;  2QHT A;  1IL2 A;  4DQ2 A;  3MF1 A;  4YRT A;  1H4T A;  5HGQ A;  1EVL A;  2DZC A;  3HTZ A;  1Z7N A;  4H2T A;  1BIA A;  4EO4 A;  2PMF A;  2ZT8 A;  1HTT A;  2AKW A;  4CS2 A;  2E65 A;  3WQZ A;  2HNI A;  4YCU A;  4XTZ A;  1SRY A;  4YRM A;  4WJ4 A;  1X2H A;  1X54 A;  4P3P A;  3HFZ B;  1YFR A;  2ZCE A;  4UPA A;  2NS6 A;  2ZZF A;  3RKW A;  2ZR2 A;  4TWA A;  3RGL A;  4TTV A;  4YRG A;  5F5W A;  4TVY A;  1N9W A;  2ODR C;  4P74 C;  2AMC B;  2ZZE A;  4LNS A;  3HFZ A;  3DSQ A;  1WNL A;  4YRP A;  4P75 A;  2C7I A;  1EVK A;  1G5H A;  4YCV A;  1LYL A;  5C53 B;  1G51 A;  2A8E A;  3REX A;  2ZNI A;  2AMC A;  3IAL A;  2P5I A;  3BFM A;  4HT4 A;  4TVW A;  1B7Y B;  1X2G A;  2ZXF A;  3RUX A;  2DU5 A;  4KQE A;  2XTI A;  12AS A;  4CH6 A;  1NJ6 A;  1SES A;  4XU1 A;  4P72 C;  2DU7 A;  3VQV A;  3RL6 A;  4WF2 A;  4XTW A;  2C8M A;  4Q6G A;  2RHS A;  1H4S A;  3HY1 A;  3P8V A;  3RAC A;  3VBB A;  1W66 A;  3UFG A;  2DDZ A;  1E1O A;  4CS3 A;  4G84 A;  4ZTU B;  1HC7 A;  2E10 A;  3QTC A;  4P74 A;  1NYQ A;  4LVM A;  4YYE A;  3UH0 A;  1HXD A;  4H2X A;  3MF2 A;  4PG3 A;  5KNN A;  4EX5 A;  1USY C;  4O2D A;  1ADJ A;  5C51 B;  1ADY A;  1WQW A;  2DZ9 A;  1E22 A;  4L87 A;  1EIY B;  1KMN A;  1YB3 A;  3NET A;  3HXV A;  4LVI A;  1SER A;  3M4P A;  2Q5H A;  3MQZ A;  4CH4 A;  4P71 C;  3HXY A;  1WYD A;  3PCO A;  1BBU A;  1J5W A;  4P72 A;  2DXT A;  4UP9 A;  4K86 A;  2ZIM A;  4XTU A;  1B8A A;  4BW9 A;  2EJG A;  3NEL A;  4H02 A;  3KFU A;  4BWA A;  4YRR A;  1X01 A;  4YRE A;  3UGT A;  1NJ8 A;  2E3C A;  3V7S A;  2CGH A;  1C0A A;  3RKY A;  5E3I A;  4J15 A;  2ART A;  3P8Y A;  3QO5 A;  1JJC B;  4RDX A;  1ATI A;  1X56 A;  4HWT A;  1YGB A;  2ALY B;  3A5Y A;  4ZTZ B;  3L4G B;  1BIB A;  3A7A A;  4KR2 A;  5C52 B;  3TEH B;  4H2U A;  1NJ2 A;  3QNE A;  3MEY A;  2DKG A;  4YRI A;  3HFV A;  4LVJ A;  2DJZ A;  1USY A;  3RF1 A;  4XEM A;  4YRF A;  4CH3 A;  4AH6 A;  3BJU A;  2QHS A;  5ELN A;  3G1Z A;  3A7R A;  4TVA B;  1B70 B;  4LVK A;  3V8J A;  4HVC A;  2ZIO A;  4WI1 A;  2ODR D;  1QE0 A;  1G5I A;  3UGQ A;  3V8L A;  2I4M A;  1H4Q A;  4HWS A;  4P71 A;  1SET A;  4YRO A;  1NJ5 A;  1WLE A;  2FYK A;  4HWP A;  2E1H A;  4P3N A;  3QO7 A;  4WJ3 M;  1KOG A;  4G85 A;  4RQE A;  2ARS A;  2RHQ B;  1B7Y A;  3HXX A;  3HY0 A;  2ZTG A;  1PYS B;  2EL9 A;  1EOV A;  4YRL A;  2XGT A;  3EFR A;  2DEQ A;  3V8K A;  2IY5 B;  4Q15 A;  4H2V A;  2I4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...