2A8EA

Three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
210
structure length
210
Chain Sequence
TQMRFTEEDFNTFTIEGLDARMEVLKETVRPKLTALGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWESHVFVWFAIIYESPIKEEYGKLLEVNQETITKNIPDSFVWSADHTKPGVHKQSEMDKEQLKTLFERLQTVKKAELLCGIQLQKEEVLNMNNQEFLQRIDDAFKQLAFLYRLTQKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein yktB
total genus 60
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06335 DUF1054 Protein of unknown function (DUF1054)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.20 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 2a8eA00
3MQZA 2A8EA
chains in the Genus database with same CATH superfamily
4HA8A 1J5WA 5K1XA 1BBUA 1X2GA 2NS6A 4CS2A 3HFVA 3UFGA 4EX5A 5ELOA 3QO5A 2CJ9A 4TQFA 1FYFA 1YFRA 2RHSA 2EJGA 2ZINA 4XU2A 2ZT8A 4YRNA 4H2UA 3P8TA 3I7FA 4H2XA 5HGQA 3VQWA 3HFZA 4P73A 1PYSA 2P0LA 1WNLA 2ZR3A 2DTHA 2J3MA 5E3IA 2DU7A 3IG2A 1SETA 4YDQA 1X54A 4YRIA 2E3CA 1WQ7A 1L0WA 2ZT6A 5C52B 3L1AA 3RKWA 4OP0A 3G1ZA 3RKYA 4DQ2A 2ALYB 3V7CA 4ZTZB 1YFSA 1NYRA 3A7UA 3PCOB 1EQRA 4YYEA 3R07A 2DQ3A 1ADYA 2ARSA 3HXVA 4XEMA 2C8MA 3BJUA 4PG3A 3VQVA 2ZGWA 1RIQA 4O2DA 4HVCA 4P71C 1HXDA 2EWNA 3BFMA 4P3NA 4UP7A 1NJ6A 1IL2A 4OLFA 3VQXA 1NJ5A 2ODRC 4P75A 3HXZA 1WQWA 4LVIA 3A7AA 4H2TA 1USYC 4YRTA 1NYQA 4H2SA 3A5ZA 4WF2A 2PMFA 4P74C 4P3PA 4RMFA 4DPGA 3QO8A 2Q5IA 4LVLA 4LVJA 1G5HA 2ZXFA 2ZT5A 2RHSB 1NJ1A 3V7RA 1B8AA 4CH6A 4TWAA 2DEQA 1EVLA 1YGBA 4CS4A 3HXWA 4P3OA 2Q5HA 4H2XB 4XTUA 3HFZB 1B76A 4TTVA 2EL9A 2DQ0A 4YRRA 3TEHA 3A31A 4UP8A 1YB3A 4HT4A 4YRCA 4XU1A 2ZIMA 2E41A 1X55A 2I4OA 4WJ4A 1EVKA 1Z7NA 2QHVA 4P74A 2DZ9A 3MEYA 4CH4A 4TVAA 2AKWA 1USYA 1Z7MA 3RKXA 3QNEA 2EJ9A 2C7IA 1EIYB 2IY5B 1BIBA 4XEOA 4Q15A 4P75C 2ZIOA 1JJCB 1H4SA 3E9HA 4YRJA 4P71A 2QHTA 1BIAA 1X01A 2I4NA 1WYDA 3OD1A 4XTXA 1SERA 2QHUA 2EJFA 2E1HA 3EFSA 4YRLA 11ASA 4XTYA 2A8EA 4XTVA 3RIRA 3HRKA 4G85A 3W3SA 2EAYA 4BWAA 2E10A 3E9IA 1QF6A 1W66A 3REXA 3TEHB 3ERRA 3REUA 3UGQA 4PHCA 2XTIA 1WU7A 1NJ8A 4YCVA 1C0AA 4CS3A 4XU3A 2G4CA 4HWTA 3UGTA 4P72A 4LVMA 4YROA 3HTZA 4TVAB 2IY5A 2AMCB 1ADJA 2ZT7A 4XTZA 2ODRD 3RF1A 4ZTUB 4WI1A 1NNHA 4YCWA 2DJZA 4HWOA 4LNSA 3RUXA 5ELNA 1JJCA 4ZIBA 3DSQA 1G5IA 2DXTA 4YRFA 3V8LA 2E64A 2ARTA 3RL6A 1WPYA 3WQZA 2QHSA 5C53B 3NELA 1NJ2A 4P72C 3IKMB 2ALYA 3A74A 3HXYA 3FJPA 2ZZFA 1PYSB 1X56A 2E65A 4YREA 3LSSA 1GGMA 4TQDA 4AH6A 2DKGA 3RACA 3TUPA 2CIMA 2ZZGA 4YCUA 3L2ZA 2ZZEA 1B7YA 3V8KA 4H02A 4CH5A 3CMQA 12ASA 3NEMA 4P73C 1H4QA 4H2VA 1EOVA 2ZR2A 3MQZA 1G51A 3HXXA 5F5WA 3HXUA 2ZTGA 1ASYA 1KOGA 4RDXA 3P8YA 2HNIA 4YRMA 3MF1A 4KQEA 3V8JA 2AMCA 2PMEA 3A5YA 2RHQA 3HRIA 2Q7GA 3RGLA 1B70B 4TVYA 1N9WA 4CH3A 1YFTA 4YRGA 4RQEA 3VQYA 1ATIA 3NENA 2ZNJA 1E1OA 4EO4A 2DTIA 3QO7A 4K87A 5K1PA 1KMMA 1H4TA 2ZCEA 1E1TA 4BW9A 4YRPA 4G84A 1KMNA 4TVWA 3UH0A 4WJ3M 4H2WA 2Q7EA 2XGTA 1HTTA 1E22A 1QE0A 3A7RA 4LVKA 4HWPA 4HWRA 2I4LA 1VQZA 4UP9A 2DXUA 2Q7HA 4YP0A 4RQFA 2CGHA 5C51B 3M4QA 2DDZA 2FYKA 4L87A 2J3LA 3KFUA 3L4GB 3HY1A 4NCXA 3MF2A 2ARUA 3IALA 3VBBA 1LYLA 4H2YA 2CJAA 3IKLA 1EIYA 4UPAA 3QTCA 2DVEA 4YPFA 3P8VA 2P5IA 5KNNA 1B70A 1B7YB 4KR2A 1WLEA 4K88A 2CJBA 3EFRA 4HWSA 2DU5A 2DZCA 4YRKA 4Q6GA 4E51A 2I4MA 4XU0A 4J15A 3NETA 1ASZA 1SESA 2AKWB 1BBWA 3LSQA 3PCOA 1EFWA 3LC0A 1E24A 2RHQB 1H4VB 3ICAA 3PZCA 1X2HA 3TEGA 4YRQA 3A32A 4K86A 4XTWA 3V7SA 4YRSA 4X5OA 3L4GA 1HC7A 1SRYA 2DTOA 2E5AA 4KR3A 3HY0A 2ZNIA 3M4PA
chains in the Genus database with same CATH topology
4HA8A 1J5WA 5K1XA 1BBUA 1X2GA 2NS6A 4CS2A 3HFVA 3UFGA 4EX5A 5ELOA 3QO5A 2CJ9A 4TQFA 1FYFA 1YFRA 2RHSA 2EJGA 2ZINA 4XU2A 2ZT8A 4YRNA 4H2UA 3P8TA 3I7FA 4H2XA 5HGQA 3VQWA 3HFZA 4P73A 1PYSA 2P0LA 1WNLA 2ZR3A 2DTHA 2J3MA 5E3IA 2DU7A 3IG2A 1SETA 4YDQA 1X54A 4YRIA 2E3CA 1WQ7A 1L0WA 2ZT6A 5C52B 3L1AA 3RKWA 4OP0A 3G1ZA 3RKYA 4DQ2A 2ALYB 3V7CA 4ZTZB 1YFSA 1NYRA 3A7UA 3PCOB 1EQRA 4YYEA 3R07A 2DQ3A 1ADYA 2ARSA 3HXVA 4XEMA 2C8MA 3BJUA 4PG3A 3VQVA 2ZGWA 1RIQA 4O2DA 4HVCA 4P71C 1HXDA 2EWNA 3BFMA 4P3NA 4UP7A 1NJ6A 1IL2A 4OLFA 3VQXA 1NJ5A 2ODRC 4P75A 3HXZA 1WQWA 4LVIA 3A7AA 4H2TA 1USYC 4YRTA 1NYQA 4H2SA 3A5ZA 4WF2A 2PMFA 4P74C 4P3PA 4RMFA 4DPGA 3QO8A 2Q5IA 4LVLA 4LVJA 1G5HA 2ZXFA 2ZT5A 2RHSB 1NJ1A 3V7RA 1B8AA 4CH6A 4TWAA 2DEQA 1EVLA 1YGBA 4CS4A 3HXWA 4P3OA 2Q5HA 4H2XB 4XTUA 3HFZB 1B76A 4TTVA 2EL9A 2DQ0A 4YRRA 3TEHA 3A31A 4UP8A 1YB3A 4HT4A 4YRCA 4XU1A 2ZIMA 2E41A 1X55A 2I4OA 4WJ4A 1EVKA 1Z7NA 2QHVA 4P74A 2DZ9A 3MEYA 4CH4A 4TVAA 2AKWA 1USYA 1Z7MA 3RKXA 3QNEA 2EJ9A 2C7IA 1EIYB 2IY5B 1BIBA 4XEOA 4Q15A 4P75C 2ZIOA 1JJCB 1H4SA 3E9HA 4YRJA 4P71A 2QHTA 1BIAA 1X01A 2I4NA 1WYDA 3OD1A 4XTXA 1SERA 2QHUA 2EJFA 2E1HA 3EFSA 4YRLA 11ASA 4XTYA 2A8EA 4XTVA 3RIRA 3HRKA 4G85A 3W3SA 2EAYA 4BWAA 2E10A 3E9IA 1QF6A 1W66A 3REXA 3TEHB 3ERRA 3REUA 3UGQA 4PHCA 2XTIA 1WU7A 1NJ8A 4YCVA 1C0AA 4CS3A 4XU3A 2G4CA 4HWTA 3UGTA 4P72A 4LVMA 4YROA 3HTZA 4TVAB 2IY5A 2AMCB 1ADJA 2ZT7A 4XTZA 2ODRD 3RF1A 4ZTUB 4WI1A 1NNHA 4YCWA 2DJZA 4HWOA 4LNSA 3RUXA 5ELNA 1JJCA 4ZIBA 3DSQA 1G5IA 2DXTA 4YRFA 3V8LA 2E64A 2ARTA 3RL6A 1WPYA 3WQZA 2QHSA 5C53B 3NELA 1NJ2A 4P72C 3IKMB 2ALYA 3A74A 3HXYA 3FJPA 2ZZFA 1PYSB 1X56A 2E65A 4YREA 3LSSA 1GGMA 4TQDA 4AH6A 2DKGA 3RACA 3TUPA 2CIMA 2ZZGA 4YCUA 3L2ZA 2ZZEA 1B7YA 3V8KA 4H02A 4CH5A 3CMQA 12ASA 3NEMA 4P73C 1H4QA 4H2VA 1EOVA 2ZR2A 3MQZA 1G51A 3HXXA 5F5WA 3HXUA 2ZTGA 1ASYA 1KOGA 4RDXA 3P8YA 2HNIA 4YRMA 3MF1A 4KQEA 3V8JA 2AMCA 2PMEA 3A5YA 2RHQA 3HRIA 2Q7GA 3RGLA 1B70B 4TVYA 1N9WA 4CH3A 1YFTA 4YRGA 4RQEA 3VQYA 1ATIA 3NENA 2ZNJA 1E1OA 4EO4A 2DTIA 3QO7A 4K87A 5K1PA 1KMMA 1H4TA 2ZCEA 1E1TA 4BW9A 4YRPA 4G84A 1KMNA 4TVWA 3UH0A 4WJ3M 4H2WA 2Q7EA 2XGTA 1HTTA 1E22A 1QE0A 3A7RA 4LVKA 4HWPA 4HWRA 2I4LA 1VQZA 4UP9A 2DXUA 2Q7HA 4YP0A 4RQFA 2CGHA 5C51B 3M4QA 2DDZA 2FYKA 4L87A 2J3LA 3KFUA 3L4GB 3HY1A 4NCXA 3MF2A 2ARUA 3IALA 3VBBA 1LYLA 4H2YA 2CJAA 3IKLA 1EIYA 4UPAA 3QTCA 2DVEA 4YPFA 3P8VA 2P5IA 5KNNA 1B70A 1B7YB 4KR2A 1WLEA 4K88A 2CJBA 3EFRA 4HWSA 2DU5A 2DZCA 4YRKA 4Q6GA 4E51A 2I4MA 4XU0A 4J15A 3NETA 1ASZA 1SESA 2AKWB 1BBWA 3LSQA 3PCOA 1EFWA 3LC0A 1E24A 2RHQB 1H4VB 3ICAA 3PZCA 1X2HA 3TEGA 4YRQA 3A32A 4K86A 4XTWA 3V7SA 4YRSA 4X5OA 3L4GA 1HC7A 1SRYA 2DTOA 2E5AA 4KR3A 3HY0A 2ZNIA 3M4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQZ A;  2A8E A; 
#chains in the Genus database with same CATH topology
 4HA8 A;  1J5W A;  5K1X A;  1BBU A;  1X2G A;  2NS6 A;  4CS2 A;  3HFV A;  3UFG A;  4EX5 A;  5ELO A;  3QO5 A;  2CJ9 A;  4TQF A;  1FYF A;  1YFR A;  2RHS A;  2EJG A;  2ZIN A;  4XU2 A;  2ZT8 A;  4YRN A;  4H2U A;  3P8T A;  3I7F A;  4H2X A;  5HGQ A;  3VQW A;  3HFZ A;  4P73 A;  1PYS A;  2P0L A;  1WNL A;  2ZR3 A;  2DTH A;  2J3M A;  5E3I A;  2DU7 A;  3IG2 A;  1SET A;  4YDQ A;  1X54 A;  4YRI A;  2E3C A;  1WQ7 A;  1L0W A;  2ZT6 A;  5C52 B;  3L1A A;  3RKW A;  4OP0 A;  3G1Z A;  3RKY A;  4DQ2 A;  2ALY B;  3V7C A;  4ZTZ B;  1YFS A;  1NYR A;  3A7U A;  3PCO B;  1EQR A;  4YYE A;  3R07 A;  2DQ3 A;  1ADY A;  2ARS A;  3HXV A;  4XEM A;  2C8M A;  3BJU A;  4PG3 A;  3VQV A;  2ZGW A;  1RIQ A;  4O2D A;  4HVC A;  4P71 C;  1HXD A;  2EWN A;  3BFM A;  4P3N A;  4UP7 A;  1NJ6 A;  1IL2 A;  4OLF A;  3VQX A;  1NJ5 A;  2ODR C;  4P75 A;  3HXZ A;  1WQW A;  4LVI A;  3A7A A;  4H2T A;  1USY C;  4YRT A;  1NYQ A;  4H2S A;  3A5Z A;  4WF2 A;  2PMF A;  4P74 C;  4P3P A;  4RMF A;  4DPG A;  3QO8 A;  2Q5I A;  4LVL A;  4LVJ A;  1G5H A;  2ZXF A;  2ZT5 A;  2RHS B;  1NJ1 A;  3V7R A;  1B8A A;  4CH6 A;  4TWA A;  2DEQ A;  1EVL A;  1YGB A;  4CS4 A;  3HXW A;  4P3O A;  2Q5H A;  4H2X B;  4XTU A;  3HFZ B;  1B76 A;  4TTV A;  2EL9 A;  2DQ0 A;  4YRR A;  3TEH A;  3A31 A;  4UP8 A;  1YB3 A;  4HT4 A;  4YRC A;  4XU1 A;  2ZIM A;  2E41 A;  1X55 A;  2I4O A;  4WJ4 A;  1EVK A;  1Z7N A;  2QHV A;  4P74 A;  2DZ9 A;  3MEY A;  4CH4 A;  4TVA A;  2AKW A;  1USY A;  1Z7M A;  3RKX A;  3QNE A;  2EJ9 A;  2C7I A;  1EIY B;  2IY5 B;  1BIB A;  4XEO A;  4Q15 A;  4P75 C;  2ZIO A;  1JJC B;  1H4S A;  3E9H A;  4YRJ A;  4P71 A;  2QHT A;  1BIA A;  1X01 A;  2I4N A;  1WYD A;  3OD1 A;  4XTX A;  1SER A;  2QHU A;  2EJF A;  2E1H A;  3EFS A;  4YRL A;  11AS A;  4XTY A;  2A8E A;  4XTV A;  3RIR A;  3HRK A;  4G85 A;  3W3S A;  2EAY A;  4BWA A;  2E10 A;  3E9I A;  1QF6 A;  1W66 A;  3REX A;  3TEH B;  3ERR A;  3REU A;  3UGQ A;  4PHC A;  2XTI A;  1WU7 A;  1NJ8 A;  4YCV A;  1C0A A;  4CS3 A;  4XU3 A;  2G4C A;  4HWT A;  3UGT A;  4P72 A;  4LVM A;  4YRO A;  3HTZ A;  4TVA B;  2IY5 A;  2AMC B;  1ADJ A;  2ZT7 A;  4XTZ A;  2ODR D;  3RF1 A;  4ZTU B;  4WI1 A;  1NNH A;  4YCW A;  2DJZ A;  4HWO A;  4LNS A;  3RUX A;  5ELN A;  1JJC A;  4ZIB A;  3DSQ A;  1G5I A;  2DXT A;  4YRF A;  3V8L A;  2E64 A;  2ART A;  3RL6 A;  1WPY A;  3WQZ A;  2QHS A;  5C53 B;  3NEL A;  1NJ2 A;  4P72 C;  3IKM B;  2ALY A;  3A74 A;  3HXY A;  3FJP A;  2ZZF A;  1PYS B;  1X56 A;  2E65 A;  4YRE A;  3LSS A;  1GGM A;  4TQD A;  4AH6 A;  2DKG A;  3RAC A;  3TUP A;  2CIM A;  2ZZG A;  4YCU A;  3L2Z A;  2ZZE A;  1B7Y A;  3V8K A;  4H02 A;  4CH5 A;  3CMQ A;  12AS A;  3NEM A;  4P73 C;  1H4Q A;  4H2V A;  1EOV A;  2ZR2 A;  3MQZ A;  1G51 A;  3HXX A;  5F5W A;  3HXU A;  2ZTG A;  1ASY A;  1KOG A;  4RDX A;  3P8Y A;  2HNI A;  4YRM A;  3MF1 A;  4KQE A;  3V8J A;  2AMC A;  2PME A;  3A5Y A;  2RHQ A;  3HRI A;  2Q7G A;  3RGL A;  1B70 B;  4TVY A;  1N9W A;  4CH3 A;  1YFT A;  4YRG A;  4RQE A;  3VQY A;  1ATI A;  3NEN A;  2ZNJ A;  1E1O A;  4EO4 A;  2DTI A;  3QO7 A;  4K87 A;  5K1P A;  1KMM A;  1H4T A;  2ZCE A;  1E1T A;  4BW9 A;  4YRP A;  4G84 A;  1KMN A;  4TVW A;  3UH0 A;  4WJ3 M;  4H2W A;  2Q7E A;  2XGT A;  1HTT A;  1E22 A;  1QE0 A;  3A7R A;  4LVK A;  4HWP A;  4HWR A;  2I4L A;  1VQZ A;  4UP9 A;  2DXU A;  2Q7H A;  4YP0 A;  4RQF A;  2CGH A;  5C51 B;  3M4Q A;  2DDZ A;  2FYK A;  4L87 A;  2J3L A;  3KFU A;  3L4G B;  3HY1 A;  4NCX A;  3MF2 A;  2ARU A;  3IAL A;  3VBB A;  1LYL A;  4H2Y A;  2CJA A;  3IKL A;  1EIY A;  4UPA A;  3QTC A;  2DVE A;  4YPF A;  3P8V A;  2P5I A;  5KNN A;  1B70 A;  1B7Y B;  4KR2 A;  1WLE A;  4K88 A;  2CJB A;  3EFR A;  4HWS A;  2DU5 A;  2DZC A;  4YRK A;  4Q6G A;  4E51 A;  2I4M A;  4XU0 A;  4J15 A;  3NET A;  1ASZ A;  1SES A;  2AKW B;  1BBW A;  3LSQ A;  3PCO A;  1EFW A;  3LC0 A;  1E24 A;  2RHQ B;  1H4V B;  3ICA A;  3PZC A;  1X2H A;  3TEG A;  4YRQ A;  3A32 A;  4K86 A;  4XTW A;  3V7S A;  4YRS A;  4X5O A;  3L4G A;  1HC7 A;  1SRY A;  2DTO A;  2E5A A;  4KR3 A;  3HY0 A;  2ZNI A;  3M4P A; 
#chains in the Genus database with same CATH homology
 4HA8 A;  1J5W A;  5K1X A;  1BBU A;  1X2G A;  2NS6 A;  4CS2 A;  3HFV A;  3UFG A;  4EX5 A;  5ELO A;  3QO5 A;  2CJ9 A;  4TQF A;  1FYF A;  1YFR A;  2RHS A;  2EJG A;  2ZIN A;  4XU2 A;  2ZT8 A;  4YRN A;  4H2U A;  3P8T A;  3I7F A;  4H2X A;  5HGQ A;  3VQW A;  3HFZ A;  4P73 A;  1PYS A;  2P0L A;  1WNL A;  2ZR3 A;  2DTH A;  2J3M A;  5E3I A;  2DU7 A;  3IG2 A;  1SET A;  4YDQ A;  1X54 A;  4YRI A;  2E3C A;  1WQ7 A;  1L0W A;  2ZT6 A;  5C52 B;  3L1A A;  3RKW A;  4OP0 A;  3G1Z A;  3RKY A;  4DQ2 A;  2ALY B;  3V7C A;  4ZTZ B;  1YFS A;  1NYR A;  3A7U A;  3PCO B;  1EQR A;  4YYE A;  3R07 A;  2DQ3 A;  1ADY A;  2ARS A;  3HXV A;  4XEM A;  2C8M A;  3BJU A;  4PG3 A;  3VQV A;  2ZGW A;  1RIQ A;  4O2D A;  4HVC A;  4P71 C;  1HXD A;  2EWN A;  3BFM A;  4P3N A;  4UP7 A;  1NJ6 A;  1IL2 A;  4OLF A;  3VQX A;  1NJ5 A;  2ODR C;  4P75 A;  3HXZ A;  1WQW A;  4LVI A;  3A7A A;  4H2T A;  1USY C;  4YRT A;  1NYQ A;  4H2S A;  3A5Z A;  4WF2 A;  2PMF A;  4P74 C;  4P3P A;  4RMF A;  4DPG A;  3QO8 A;  2Q5I A;  4LVL A;  4LVJ A;  1G5H A;  2ZXF A;  2ZT5 A;  2RHS B;  1NJ1 A;  3V7R A;  1B8A A;  4CH6 A;  4TWA A;  2DEQ A;  1EVL A;  1YGB A;  4CS4 A;  3HXW A;  4P3O A;  2Q5H A;  4H2X B;  4XTU A;  3HFZ B;  1B76 A;  4TTV A;  2EL9 A;  2DQ0 A;  4YRR A;  3TEH A;  3A31 A;  4UP8 A;  1YB3 A;  4HT4 A;  4YRC A;  4XU1 A;  2ZIM A;  2E41 A;  1X55 A;  2I4O A;  4WJ4 A;  1EVK A;  1Z7N A;  2QHV A;  4P74 A;  2DZ9 A;  3MEY A;  4CH4 A;  4TVA A;  2AKW A;  1USY A;  1Z7M A;  3RKX A;  3QNE A;  2EJ9 A;  2C7I A;  1EIY B;  2IY5 B;  1BIB A;  4XEO A;  4Q15 A;  4P75 C;  2ZIO A;  1JJC B;  1H4S A;  3E9H A;  4YRJ A;  4P71 A;  2QHT A;  1BIA A;  1X01 A;  2I4N A;  1WYD A;  3OD1 A;  4XTX A;  1SER A;  2QHU A;  2EJF A;  2E1H A;  3EFS A;  4YRL A;  11AS A;  4XTY A;  2A8E A;  4XTV A;  3RIR A;  3HRK A;  4G85 A;  3W3S A;  2EAY A;  4BWA A;  2E10 A;  3E9I A;  1QF6 A;  1W66 A;  3REX A;  3TEH B;  3ERR A;  3REU A;  3UGQ A;  4PHC A;  2XTI A;  1WU7 A;  1NJ8 A;  4YCV A;  1C0A A;  4CS3 A;  4XU3 A;  2G4C A;  4HWT A;  3UGT A;  4P72 A;  4LVM A;  4YRO A;  3HTZ A;  4TVA B;  2IY5 A;  2AMC B;  1ADJ A;  2ZT7 A;  4XTZ A;  2ODR D;  3RF1 A;  4ZTU B;  4WI1 A;  1NNH A;  4YCW A;  2DJZ A;  4HWO A;  4LNS A;  3RUX A;  5ELN A;  1JJC A;  4ZIB A;  3DSQ A;  1G5I A;  2DXT A;  4YRF A;  3V8L A;  2E64 A;  2ART A;  3RL6 A;  1WPY A;  3WQZ A;  2QHS A;  5C53 B;  3NEL A;  1NJ2 A;  4P72 C;  3IKM B;  2ALY A;  3A74 A;  3HXY A;  3FJP A;  2ZZF A;  1PYS B;  1X56 A;  2E65 A;  4YRE A;  3LSS A;  1GGM A;  4TQD A;  4AH6 A;  2DKG A;  3RAC A;  3TUP A;  2CIM A;  2ZZG A;  4YCU A;  3L2Z A;  2ZZE A;  1B7Y A;  3V8K A;  4H02 A;  4CH5 A;  3CMQ A;  12AS A;  3NEM A;  4P73 C;  1H4Q A;  4H2V A;  1EOV A;  2ZR2 A;  3MQZ A;  1G51 A;  3HXX A;  5F5W A;  3HXU A;  2ZTG A;  1ASY A;  1KOG A;  4RDX A;  3P8Y A;  2HNI A;  4YRM A;  3MF1 A;  4KQE A;  3V8J A;  2AMC A;  2PME A;  3A5Y A;  2RHQ A;  3HRI A;  2Q7G A;  3RGL A;  1B70 B;  4TVY A;  1N9W A;  4CH3 A;  1YFT A;  4YRG A;  4RQE A;  3VQY A;  1ATI A;  3NEN A;  2ZNJ A;  1E1O A;  4EO4 A;  2DTI A;  3QO7 A;  4K87 A;  5K1P A;  1KMM A;  1H4T A;  2ZCE A;  1E1T A;  4BW9 A;  4YRP A;  4G84 A;  1KMN A;  4TVW A;  3UH0 A;  4WJ3 M;  4H2W A;  2Q7E A;  2XGT A;  1HTT A;  1E22 A;  1QE0 A;  3A7R A;  4LVK A;  4HWP A;  4HWR A;  2I4L A;  1VQZ A;  4UP9 A;  2DXU A;  2Q7H A;  4YP0 A;  4RQF A;  2CGH A;  5C51 B;  3M4Q A;  2DDZ A;  2FYK A;  4L87 A;  2J3L A;  3KFU A;  3L4G B;  3HY1 A;  4NCX A;  3MF2 A;  2ARU A;  3IAL A;  3VBB A;  1LYL A;  4H2Y A;  2CJA A;  3IKL A;  1EIY A;  4UPA A;  3QTC A;  2DVE A;  4YPF A;  3P8V A;  2P5I A;  5KNN A;  1B70 A;  1B7Y B;  4KR2 A;  1WLE A;  4K88 A;  2CJB A;  3EFR A;  4HWS A;  2DU5 A;  2DZC A;  4YRK A;  4Q6G A;  4E51 A;  2I4M A;  4XU0 A;  4J15 A;  3NET A;  1ASZ A;  1SES A;  2AKW B;  1BBW A;  3LSQ A;  3PCO A;  1EFW A;  3LC0 A;  1E24 A;  2RHQ B;  1H4V B;  3ICA A;  3PZC A;  1X2H A;  3TEG A;  4YRQ A;  3A32 A;  4K86 A;  4XTW A;  3V7S A;  4YRS A;  4X5O A;  3L4G A;  1HC7 A;  1SRY A;  2DTO A;  2E5A A;  4KR3 A;  3HY0 A;  2ZNI A;  3M4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...