2A8EA

Three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204.
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
210
structure length
210
Chain Sequence
TQMRFTEEDFNTFTIEGLDARMEVLKETVRPKLTALGEHFAPTLSALTGDEMFPHVAKHARRSVNPPADSWVAFANSKRGYKKLPHFQIGLWESHVFVWFAIIYESPIKEEYGKLLEVNQETITKNIPDSFVWSADHTKPGVHKQSEMDKEQLKTLFERLQTVKKAELLCGIQLQKEEVLNMNNQEFLQRIDDAFKQLAFLYRLTQKVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein yktB
total genus 60
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06335 DUF1054 Protein of unknown function (DUF1054)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.20 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 2a8eA00
2A8EA 3MQZA
chains in the Genus database with same CATH superfamily
3VQWA 1EQRA 1FYFA 2J3LA 2J3MA 1RIQA 4XTVA 4XEMA 1L0WA 4HWOA 2DZ9A 2DU7A 1E1TA 3A7RA 1YFSA 4YRGA 3REUA 2Q5IA 4PHCA 2HNIA 4P3OA 3VQXA 2EWNA 1NJ8A 1QF6A 2RHSA 2Q7GA 1X2GA 1NJ6A 1WU7A 3A5YA 1E22A 4HWRA 3DSQA 2DKGA 4P74A 3RIRA 1EOVA 4YCVA 2ARSA 4H2WA 2ZNIA 1X01A 4HWTA 3HXUA 4YRPA 1G51A 3A7AA 1E1OA 4UP9A 4H2YA 1X54A 2ZR3A 3HY1A 4H2XB 4TVYA 4HWSA 4P73A 4XU0A 2QHVA 4UPAA 3VQVA 3PCOB 4H2UA 4HA8A 4TVAA 1WYDA 4P75C 1HC7A 3KFUA 3R07A 2ZZGA 3NETA 4RMFA 4XTZA 3W3SA 4G85A 3P8YA 4X5OA 1Z7NA 3V7SA 3RACA 1IL2A 3L2ZA 3E9HA 4TTVA 5E3IA 2DXUA 2DXTA 3IKMB 3HY0A 3UH0A 5C51B 3L1AA 1YFRA 3OD1A 4YDQA 4P74C 2RHSB 4H2TA 2ZNJA 2AKWB 2PMEA 4CS3A 3V7RA 2DJZA 2RHQB 2DTIA 3LSQA 2ALYA 3REXA 2IY5A 4XTUA 1B8AA 1H4VB 4XU1A 3I7FA 4XU2A 4K88A 1SRYA 2ZINA 1WQ7A 2E5AA 4RQFA 4P73C 4P3NA 3EFSA 3IG2A 1WLEA 1G5IA 5F5WA 1LYLA 1B76A 1N9WA 2DZCA 4RDXA 3BJUA 1KMMA 2Q7HA 4TWAA 4BW9A 4RQEA 4YRCA 1ATIA 1ADYA 2CIMA 3HRKA 1B70A 3BFMA 4H02A 2ZR2A 4ZTUB 4XTWA 2EJGA 3HTZA 1EVLA 4ZIBA 1NYRA 3UFGA 2CGHA 1PYSB 2AMCB 1BBUA 3A74A 3FJPA 3M4QA 3EFRA 1WPYA 12ASA 4P71C 1J5WA 4YRIA 1ADJA 2C7IA 3RUXA 1JJCB 2CJBA 5ELNA 1NJ1A 2EJFA 3LC0A 4HT4A 3QTCA 3HFVA 4K86A 1HXDA 1QE0A 4LVIA 1USYC 2ZT7A 3MF2A 3CMQA 2CJ9A 3RGLA 4YROA 3PZCA 1HTTA 4XTXA 3IKLA 1WQWA 3QO5A 4YPFA 1B7YA 1BBWA 1EIYB 2QHTA 4LVMA 2ODRD 2E64A 3MQZA 2A8EA 2I4LA 3UGTA 3PCOA 4BWAA 4CH6A 3WQZA 2E41A 4WJ3M 11ASA 3VBBA 4P71A 2ZTGA 3L4GA 4YRTA 3NEMA 4H2XA 4YRRA 3ERRA 4WI1A 3MF1A 1YFTA 4TVWA 3HXXA 4P3PA 4YRMA 3RKYA 4P72C 3VQYA 3HRIA 1EVKA 2ZT8A 1SESA 2ARTA 1H4SA 2C8MA 4H2SA 4YCWA 1E24A 3TEGA 1YGBA 1H4QA 4EO4A 1JJCA 4P75A 3V8LA 2DVEA 4P72A 4WF2A 4J15A 2I4NA 2G4CA 3G1ZA 2E1HA 5C52B 4Q15A 4YP0A 1B70B 2I4OA 4CH5A 1H4TA 3M4PA 4CS2A 2ZT5A 3IALA 4DPGA 1ASYA 5K1XA 3HXYA 4YRSA 4LVKA 4UP7A 4XU3A 2PMFA 4EX5A 2ARUA 5KNNA 4G84A 2E65A 2I4MA 4HVCA 1Z7MA 2DU5A 3P8TA 4DQ2A 3A32A 2DTHA 4HWPA 2P5IA 1SETA 3HXWA 4KR2A 2DDZA 2IY5B 1C0AA 3NELA 3QO8A 1NYQA 4PG3A 2EJ9A 2RHQA 2DQ3A 2ALYB 3RL6A 2NS6A 3A7UA 4OLFA 2ZCEA 3L4GB 2ODRC 2AKWA 1X2HA 4KQEA 4K87A 3HFZA 3LSSA 1W66A 3TEHA 1USYA 3V7CA 1KMNA 1NJ5A 4XEOA 1VQZA 2QHSA 3HXZA 4OP0A 1B7YB 2DTOA 2P0LA 2ZIMA 4CH4A 1GGMA 4XTYA 4YCUA 3RKXA 1NNHA 4E51A 1NJ2A 2EL9A 4Q6GA 1X56A 2ZZEA 1G5HA 1BIBA 2E3CA 3UGQA 4L87A 4YRKA 4CH3A 2QHUA 2ZIOA 1KOGA 1YB3A 4YRNA 3V8KA 1X55A 2Q7EA 5K1PA 4TQDA 2AMCA 2E10A 4UP8A 2EAYA 2DEQA 3TEHB 1PYSA 3HFZB 4TVAB 2ZGWA 2ZT6A 4NCXA 2XGTA 2ZZFA 4YRQA 4LVLA 3QO7A 1ASZA 3E9IA 2CJAA 1EFWA 1BIAA 4YRJA 3A5ZA 5HGQA 5C53B 3RF1A 1EIYA 4O2DA 2Q5HA 2XTIA 3A31A 4LVJA 3TUPA 3NENA 4YRFA 4YREA 4AH6A 1WNLA 5ELOA 4TQFA 4KR3A 3QNEA 4YRLA 4CS4A 3HXVA 3V8JA 4ZTZB 3MEYA 4WJ4A 2FYKA 3RKWA 3P8VA 2DQ0A 3ICAA 4LNSA 4H2VA 4YYEA 2ZXFA 1SERA
chains in the Genus database with same CATH topology
3VQWA 1EQRA 1FYFA 2J3LA 2J3MA 1RIQA 4XTVA 4XEMA 1L0WA 4HWOA 2DZ9A 2DU7A 1E1TA 3A7RA 1YFSA 4YRGA 3REUA 2Q5IA 4PHCA 2HNIA 4P3OA 3VQXA 2EWNA 1NJ8A 1QF6A 2RHSA 2Q7GA 1X2GA 1NJ6A 1WU7A 3A5YA 1E22A 4HWRA 3DSQA 2DKGA 4P74A 3RIRA 1EOVA 4YCVA 2ARSA 4H2WA 2ZNIA 1X01A 4HWTA 3HXUA 4YRPA 1G51A 3A7AA 1E1OA 4UP9A 4H2YA 1X54A 2ZR3A 3HY1A 4H2XB 4TVYA 4HWSA 4P73A 4XU0A 2QHVA 4UPAA 3VQVA 3PCOB 4H2UA 4HA8A 4TVAA 1WYDA 4P75C 1HC7A 3KFUA 3R07A 2ZZGA 3NETA 4RMFA 4XTZA 3W3SA 4G85A 3P8YA 4X5OA 1Z7NA 3V7SA 3RACA 1IL2A 3L2ZA 3E9HA 4TTVA 5E3IA 2DXUA 2DXTA 3IKMB 3HY0A 3UH0A 5C51B 3L1AA 1YFRA 3OD1A 4YDQA 4P74C 2RHSB 4H2TA 2ZNJA 2AKWB 2PMEA 4CS3A 3V7RA 2DJZA 2RHQB 2DTIA 3LSQA 2ALYA 3REXA 2IY5A 4XTUA 1B8AA 1H4VB 4XU1A 3I7FA 4XU2A 4K88A 1SRYA 2ZINA 1WQ7A 2E5AA 4RQFA 4P73C 4P3NA 3EFSA 3IG2A 1WLEA 1G5IA 5F5WA 1LYLA 1B76A 1N9WA 2DZCA 4RDXA 3BJUA 1KMMA 2Q7HA 4TWAA 4BW9A 4RQEA 4YRCA 1ATIA 1ADYA 2CIMA 3HRKA 1B70A 3BFMA 4H02A 2ZR2A 4ZTUB 4XTWA 2EJGA 3HTZA 1EVLA 4ZIBA 1NYRA 3UFGA 2CGHA 1PYSB 2AMCB 1BBUA 3A74A 3FJPA 3M4QA 3EFRA 1WPYA 12ASA 4P71C 1J5WA 4YRIA 1ADJA 2C7IA 3RUXA 1JJCB 2CJBA 5ELNA 1NJ1A 2EJFA 3LC0A 4HT4A 3QTCA 3HFVA 4K86A 1HXDA 1QE0A 4LVIA 1USYC 2ZT7A 3MF2A 3CMQA 2CJ9A 3RGLA 4YROA 3PZCA 1HTTA 4XTXA 3IKLA 1WQWA 3QO5A 4YPFA 1B7YA 1BBWA 1EIYB 2QHTA 4LVMA 2ODRD 2E64A 3MQZA 2A8EA 2I4LA 3UGTA 3PCOA 4BWAA 4CH6A 3WQZA 2E41A 4WJ3M 11ASA 3VBBA 4P71A 2ZTGA 3L4GA 4YRTA 3NEMA 4H2XA 4YRRA 3ERRA 4WI1A 3MF1A 1YFTA 4TVWA 3HXXA 4P3PA 4YRMA 3RKYA 4P72C 3VQYA 3HRIA 1EVKA 2ZT8A 1SESA 2ARTA 1H4SA 2C8MA 4H2SA 4YCWA 1E24A 3TEGA 1YGBA 1H4QA 4EO4A 1JJCA 4P75A 3V8LA 2DVEA 4P72A 4WF2A 4J15A 2I4NA 2G4CA 3G1ZA 2E1HA 5C52B 4Q15A 4YP0A 1B70B 2I4OA 4CH5A 1H4TA 3M4PA 4CS2A 2ZT5A 3IALA 4DPGA 1ASYA 5K1XA 3HXYA 4YRSA 4LVKA 4UP7A 4XU3A 2PMFA 4EX5A 2ARUA 5KNNA 4G84A 2E65A 2I4MA 4HVCA 1Z7MA 2DU5A 3P8TA 4DQ2A 3A32A 2DTHA 4HWPA 2P5IA 1SETA 3HXWA 4KR2A 2DDZA 2IY5B 1C0AA 3NELA 3QO8A 1NYQA 4PG3A 2EJ9A 2RHQA 2DQ3A 2ALYB 3RL6A 2NS6A 3A7UA 4OLFA 2ZCEA 3L4GB 2ODRC 2AKWA 1X2HA 4KQEA 4K87A 3HFZA 3LSSA 1W66A 3TEHA 1USYA 3V7CA 1KMNA 1NJ5A 4XEOA 1VQZA 2QHSA 3HXZA 4OP0A 1B7YB 2DTOA 2P0LA 2ZIMA 4CH4A 1GGMA 4XTYA 4YCUA 3RKXA 1NNHA 4E51A 1NJ2A 2EL9A 4Q6GA 1X56A 2ZZEA 1G5HA 1BIBA 2E3CA 3UGQA 4L87A 4YRKA 4CH3A 2QHUA 2ZIOA 1KOGA 1YB3A 4YRNA 3V8KA 1X55A 2Q7EA 5K1PA 4TQDA 2AMCA 2E10A 4UP8A 2EAYA 2DEQA 3TEHB 1PYSA 3HFZB 4TVAB 2ZGWA 2ZT6A 4NCXA 2XGTA 2ZZFA 4YRQA 4LVLA 3QO7A 1ASZA 3E9IA 2CJAA 1EFWA 1BIAA 4YRJA 3A5ZA 5HGQA 5C53B 3RF1A 1EIYA 4O2DA 2Q5HA 2XTIA 3A31A 4LVJA 3TUPA 3NENA 4YRFA 4YREA 4AH6A 1WNLA 5ELOA 4TQFA 4KR3A 3QNEA 4YRLA 4CS4A 3HXVA 3V8JA 4ZTZB 3MEYA 4WJ4A 2FYKA 3RKWA 3P8VA 2DQ0A 3ICAA 4LNSA 4H2VA 4YYEA 2ZXFA 1SERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8E A;  3MQZ A; 
#chains in the Genus database with same CATH topology
 3VQW A;  1EQR A;  1FYF A;  2J3L A;  2J3M A;  1RIQ A;  4XTV A;  4XEM A;  1L0W A;  4HWO A;  2DZ9 A;  2DU7 A;  1E1T A;  3A7R A;  1YFS A;  4YRG A;  3REU A;  2Q5I A;  4PHC A;  2HNI A;  4P3O A;  3VQX A;  2EWN A;  1NJ8 A;  1QF6 A;  2RHS A;  2Q7G A;  1X2G A;  1NJ6 A;  1WU7 A;  3A5Y A;  1E22 A;  4HWR A;  3DSQ A;  2DKG A;  4P74 A;  3RIR A;  1EOV A;  4YCV A;  2ARS A;  4H2W A;  2ZNI A;  1X01 A;  4HWT A;  3HXU A;  4YRP A;  1G51 A;  3A7A A;  1E1O A;  4UP9 A;  4H2Y A;  1X54 A;  2ZR3 A;  3HY1 A;  4H2X B;  4TVY A;  4HWS A;  4P73 A;  4XU0 A;  2QHV A;  4UPA A;  3VQV A;  3PCO B;  4H2U A;  4HA8 A;  4TVA A;  1WYD A;  4P75 C;  1HC7 A;  3KFU A;  3R07 A;  2ZZG A;  3NET A;  4RMF A;  4XTZ A;  3W3S A;  4G85 A;  3P8Y A;  4X5O A;  1Z7N A;  3V7S A;  3RAC A;  1IL2 A;  3L2Z A;  3E9H A;  4TTV A;  5E3I A;  2DXU A;  2DXT A;  3IKM B;  3HY0 A;  3UH0 A;  5C51 B;  3L1A A;  1YFR A;  3OD1 A;  4YDQ A;  4P74 C;  2RHS B;  4H2T A;  2ZNJ A;  2AKW B;  2PME A;  4CS3 A;  3V7R A;  2DJZ A;  2RHQ B;  2DTI A;  3LSQ A;  2ALY A;  3REX A;  2IY5 A;  4XTU A;  1B8A A;  1H4V B;  4XU1 A;  3I7F A;  4XU2 A;  4K88 A;  1SRY A;  2ZIN A;  1WQ7 A;  2E5A A;  4RQF A;  4P73 C;  4P3N A;  3EFS A;  3IG2 A;  1WLE A;  1G5I A;  5F5W A;  1LYL A;  1B76 A;  1N9W A;  2DZC A;  4RDX A;  3BJU A;  1KMM A;  2Q7H A;  4TWA A;  4BW9 A;  4RQE A;  4YRC A;  1ATI A;  1ADY A;  2CIM A;  3HRK A;  1B70 A;  3BFM A;  4H02 A;  2ZR2 A;  4ZTU B;  4XTW A;  2EJG A;  3HTZ A;  1EVL A;  4ZIB A;  1NYR A;  3UFG A;  2CGH A;  1PYS B;  2AMC B;  1BBU A;  3A74 A;  3FJP A;  3M4Q A;  3EFR A;  1WPY A;  12AS A;  4P71 C;  1J5W A;  4YRI A;  1ADJ A;  2C7I A;  3RUX A;  1JJC B;  2CJB A;  5ELN A;  1NJ1 A;  2EJF A;  3LC0 A;  4HT4 A;  3QTC A;  3HFV A;  4K86 A;  1HXD A;  1QE0 A;  4LVI A;  1USY C;  2ZT7 A;  3MF2 A;  3CMQ A;  2CJ9 A;  3RGL A;  4YRO A;  3PZC A;  1HTT A;  4XTX A;  3IKL A;  1WQW A;  3QO5 A;  4YPF A;  1B7Y A;  1BBW A;  1EIY B;  2QHT A;  4LVM A;  2ODR D;  2E64 A;  3MQZ A;  2A8E A;  2I4L A;  3UGT A;  3PCO A;  4BWA A;  4CH6 A;  3WQZ A;  2E41 A;  4WJ3 M;  11AS A;  3VBB A;  4P71 A;  2ZTG A;  3L4G A;  4YRT A;  3NEM A;  4H2X A;  4YRR A;  3ERR A;  4WI1 A;  3MF1 A;  1YFT A;  4TVW A;  3HXX A;  4P3P A;  4YRM A;  3RKY A;  4P72 C;  3VQY A;  3HRI A;  1EVK A;  2ZT8 A;  1SES A;  2ART A;  1H4S A;  2C8M A;  4H2S A;  4YCW A;  1E24 A;  3TEG A;  1YGB A;  1H4Q A;  4EO4 A;  1JJC A;  4P75 A;  3V8L A;  2DVE A;  4P72 A;  4WF2 A;  4J15 A;  2I4N A;  2G4C A;  3G1Z A;  2E1H A;  5C52 B;  4Q15 A;  4YP0 A;  1B70 B;  2I4O A;  4CH5 A;  1H4T A;  3M4P A;  4CS2 A;  2ZT5 A;  3IAL A;  4DPG A;  1ASY A;  5K1X A;  3HXY A;  4YRS A;  4LVK A;  4UP7 A;  4XU3 A;  2PMF A;  4EX5 A;  2ARU A;  5KNN A;  4G84 A;  2E65 A;  2I4M A;  4HVC A;  1Z7M A;  2DU5 A;  3P8T A;  4DQ2 A;  3A32 A;  2DTH A;  4HWP A;  2P5I A;  1SET A;  3HXW A;  4KR2 A;  2DDZ A;  2IY5 B;  1C0A A;  3NEL A;  3QO8 A;  1NYQ A;  4PG3 A;  2EJ9 A;  2RHQ A;  2DQ3 A;  2ALY B;  3RL6 A;  2NS6 A;  3A7U A;  4OLF A;  2ZCE A;  3L4G B;  2ODR C;  2AKW A;  1X2H A;  4KQE A;  4K87 A;  3HFZ A;  3LSS A;  1W66 A;  3TEH A;  1USY A;  3V7C A;  1KMN A;  1NJ5 A;  4XEO A;  1VQZ A;  2QHS A;  3HXZ A;  4OP0 A;  1B7Y B;  2DTO A;  2P0L A;  2ZIM A;  4CH4 A;  1GGM A;  4XTY A;  4YCU A;  3RKX A;  1NNH A;  4E51 A;  1NJ2 A;  2EL9 A;  4Q6G A;  1X56 A;  2ZZE A;  1G5H A;  1BIB A;  2E3C A;  3UGQ A;  4L87 A;  4YRK A;  4CH3 A;  2QHU A;  2ZIO A;  1KOG A;  1YB3 A;  4YRN A;  3V8K A;  1X55 A;  2Q7E A;  5K1P A;  4TQD A;  2AMC A;  2E10 A;  4UP8 A;  2EAY A;  2DEQ A;  3TEH B;  1PYS A;  3HFZ B;  4TVA B;  2ZGW A;  2ZT6 A;  4NCX A;  2XGT A;  2ZZF A;  4YRQ A;  4LVL A;  3QO7 A;  1ASZ A;  3E9I A;  2CJA A;  1EFW A;  1BIA A;  4YRJ A;  3A5Z A;  5HGQ A;  5C53 B;  3RF1 A;  1EIY A;  4O2D A;  2Q5H A;  2XTI A;  3A31 A;  4LVJ A;  3TUP A;  3NEN A;  4YRF A;  4YRE A;  4AH6 A;  1WNL A;  5ELO A;  4TQF A;  4KR3 A;  3QNE A;  4YRL A;  4CS4 A;  3HXV A;  3V8J A;  4ZTZ B;  3MEY A;  4WJ4 A;  2FYK A;  3RKW A;  3P8V A;  2DQ0 A;  3ICA A;  4LNS A;  4H2V A;  4YYE A;  2ZXF A;  1SER A; 
#chains in the Genus database with same CATH homology
 3VQW A;  1EQR A;  1FYF A;  2J3L A;  2J3M A;  1RIQ A;  4XTV A;  4XEM A;  1L0W A;  4HWO A;  2DZ9 A;  2DU7 A;  1E1T A;  3A7R A;  1YFS A;  4YRG A;  3REU A;  2Q5I A;  4PHC A;  2HNI A;  4P3O A;  3VQX A;  2EWN A;  1NJ8 A;  1QF6 A;  2RHS A;  2Q7G A;  1X2G A;  1NJ6 A;  1WU7 A;  3A5Y A;  1E22 A;  4HWR A;  3DSQ A;  2DKG A;  4P74 A;  3RIR A;  1EOV A;  4YCV A;  2ARS A;  4H2W A;  2ZNI A;  1X01 A;  4HWT A;  3HXU A;  4YRP A;  1G51 A;  3A7A A;  1E1O A;  4UP9 A;  4H2Y A;  1X54 A;  2ZR3 A;  3HY1 A;  4H2X B;  4TVY A;  4HWS A;  4P73 A;  4XU0 A;  2QHV A;  4UPA A;  3VQV A;  3PCO B;  4H2U A;  4HA8 A;  4TVA A;  1WYD A;  4P75 C;  1HC7 A;  3KFU A;  3R07 A;  2ZZG A;  3NET A;  4RMF A;  4XTZ A;  3W3S A;  4G85 A;  3P8Y A;  4X5O A;  1Z7N A;  3V7S A;  3RAC A;  1IL2 A;  3L2Z A;  3E9H A;  4TTV A;  5E3I A;  2DXU A;  2DXT A;  3IKM B;  3HY0 A;  3UH0 A;  5C51 B;  3L1A A;  1YFR A;  3OD1 A;  4YDQ A;  4P74 C;  2RHS B;  4H2T A;  2ZNJ A;  2AKW B;  2PME A;  4CS3 A;  3V7R A;  2DJZ A;  2RHQ B;  2DTI A;  3LSQ A;  2ALY A;  3REX A;  2IY5 A;  4XTU A;  1B8A A;  1H4V B;  4XU1 A;  3I7F A;  4XU2 A;  4K88 A;  1SRY A;  2ZIN A;  1WQ7 A;  2E5A A;  4RQF A;  4P73 C;  4P3N A;  3EFS A;  3IG2 A;  1WLE A;  1G5I A;  5F5W A;  1LYL A;  1B76 A;  1N9W A;  2DZC A;  4RDX A;  3BJU A;  1KMM A;  2Q7H A;  4TWA A;  4BW9 A;  4RQE A;  4YRC A;  1ATI A;  1ADY A;  2CIM A;  3HRK A;  1B70 A;  3BFM A;  4H02 A;  2ZR2 A;  4ZTU B;  4XTW A;  2EJG A;  3HTZ A;  1EVL A;  4ZIB A;  1NYR A;  3UFG A;  2CGH A;  1PYS B;  2AMC B;  1BBU A;  3A74 A;  3FJP A;  3M4Q A;  3EFR A;  1WPY A;  12AS A;  4P71 C;  1J5W A;  4YRI A;  1ADJ A;  2C7I A;  3RUX A;  1JJC B;  2CJB A;  5ELN A;  1NJ1 A;  2EJF A;  3LC0 A;  4HT4 A;  3QTC A;  3HFV A;  4K86 A;  1HXD A;  1QE0 A;  4LVI A;  1USY C;  2ZT7 A;  3MF2 A;  3CMQ A;  2CJ9 A;  3RGL A;  4YRO A;  3PZC A;  1HTT A;  4XTX A;  3IKL A;  1WQW A;  3QO5 A;  4YPF A;  1B7Y A;  1BBW A;  1EIY B;  2QHT A;  4LVM A;  2ODR D;  2E64 A;  3MQZ A;  2A8E A;  2I4L A;  3UGT A;  3PCO A;  4BWA A;  4CH6 A;  3WQZ A;  2E41 A;  4WJ3 M;  11AS A;  3VBB A;  4P71 A;  2ZTG A;  3L4G A;  4YRT A;  3NEM A;  4H2X A;  4YRR A;  3ERR A;  4WI1 A;  3MF1 A;  1YFT A;  4TVW A;  3HXX A;  4P3P A;  4YRM A;  3RKY A;  4P72 C;  3VQY A;  3HRI A;  1EVK A;  2ZT8 A;  1SES A;  2ART A;  1H4S A;  2C8M A;  4H2S A;  4YCW A;  1E24 A;  3TEG A;  1YGB A;  1H4Q A;  4EO4 A;  1JJC A;  4P75 A;  3V8L A;  2DVE A;  4P72 A;  4WF2 A;  4J15 A;  2I4N A;  2G4C A;  3G1Z A;  2E1H A;  5C52 B;  4Q15 A;  4YP0 A;  1B70 B;  2I4O A;  4CH5 A;  1H4T A;  3M4P A;  4CS2 A;  2ZT5 A;  3IAL A;  4DPG A;  1ASY A;  5K1X A;  3HXY A;  4YRS A;  4LVK A;  4UP7 A;  4XU3 A;  2PMF A;  4EX5 A;  2ARU A;  5KNN A;  4G84 A;  2E65 A;  2I4M A;  4HVC A;  1Z7M A;  2DU5 A;  3P8T A;  4DQ2 A;  3A32 A;  2DTH A;  4HWP A;  2P5I A;  1SET A;  3HXW A;  4KR2 A;  2DDZ A;  2IY5 B;  1C0A A;  3NEL A;  3QO8 A;  1NYQ A;  4PG3 A;  2EJ9 A;  2RHQ A;  2DQ3 A;  2ALY B;  3RL6 A;  2NS6 A;  3A7U A;  4OLF A;  2ZCE A;  3L4G B;  2ODR C;  2AKW A;  1X2H A;  4KQE A;  4K87 A;  3HFZ A;  3LSS A;  1W66 A;  3TEH A;  1USY A;  3V7C A;  1KMN A;  1NJ5 A;  4XEO A;  1VQZ A;  2QHS A;  3HXZ A;  4OP0 A;  1B7Y B;  2DTO A;  2P0L A;  2ZIM A;  4CH4 A;  1GGM A;  4XTY A;  4YCU A;  3RKX A;  1NNH A;  4E51 A;  1NJ2 A;  2EL9 A;  4Q6G A;  1X56 A;  2ZZE A;  1G5H A;  1BIB A;  2E3C A;  3UGQ A;  4L87 A;  4YRK A;  4CH3 A;  2QHU A;  2ZIO A;  1KOG A;  1YB3 A;  4YRN A;  3V8K A;  1X55 A;  2Q7E A;  5K1P A;  4TQD A;  2AMC A;  2E10 A;  4UP8 A;  2EAY A;  2DEQ A;  3TEH B;  1PYS A;  3HFZ B;  4TVA B;  2ZGW A;  2ZT6 A;  4NCX A;  2XGT A;  2ZZF A;  4YRQ A;  4LVL A;  3QO7 A;  1ASZ A;  3E9I A;  2CJA A;  1EFW A;  1BIA A;  4YRJ A;  3A5Z A;  5HGQ A;  5C53 B;  3RF1 A;  1EIY A;  4O2D A;  2Q5H A;  2XTI A;  3A31 A;  4LVJ A;  3TUP A;  3NEN A;  4YRF A;  4YRE A;  4AH6 A;  1WNL A;  5ELO A;  4TQF A;  4KR3 A;  3QNE A;  4YRL A;  4CS4 A;  3HXV A;  3V8J A;  4ZTZ B;  3MEY A;  4WJ4 A;  2FYK A;  3RKW A;  3P8V A;  2DQ0 A;  3ICA A;  4LNS A;  4H2V A;  4YYE A;  2ZXF A;  1SER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...