2A9HA

Nmr structural studies of a potassium channel / charybdotoxin complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel
publication title Nuclear magnetic resonance structural studies of a potassium channel-charybdotoxin complex.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport, membrane protein
total genus 32
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2a9hA00
1R3IC 4WFHA 4RUFA 4TWKA 1XL6A 4XDLA 2ITCC 2EIMC 4PA3A 3SYAA 3ASOC 1M57C 2IH1C 4X8AA 3T1CA 5CBFA 3FB5C 3JYCA 2P7TC 4MVSA 5IY5C 4LCUC 4P9OA 5EBMC 4BW5A 3RVZA 3FB7C 2HVKC 3AG2C 3F5WC 3F7VC 3AG3C 2A79B 3OUFA 3SPIA 3STLC 1R3LC 1BL8A 3SPJA 1OCCC 4PA7A 2DWEC 2ZD9A 3IFXA 4EKWA 4R7CA 5CBGA 3SYPA 2WLLA 1V54C 4MVZA 2X6BA 2WLHA 3K03A 3PJSK 1QLEC 2A9HA 3OUSA 4MVOA 4X88A 3LDCA 1LNQA 1OCOC 2BOBC 3SYOA 3K04A 3WG7C 2BOCC 3UM7A 2Q68A 2HJFC 3ZJZA 4RO2A 3SPHA 2ZXWC 4ZBMA 3K0GA 2R9RB 3FB8C 4MVRA 2W0FC 3E86A 3EFFK 3RW0A 2DYSC 1V55C 2AHYA 2ITDC 3VOUA 4JTCB 3R65A 4J9YB 3LDEA 2WLLB 3OGCC 4PDVA 2QTOA 4JTAB 3ZRSA 3T4ZA 2EIJC 4PDMA 4LBEC 4GX5A 4OXSA 4WFGA 4MTOA 1ORQC 4PA9A 3KG2A 4GX0A 3AG1C 3K06A 3SPGA 2Y69C 5EK0A 2WLIA 3SYCA 3T2MA 4QNHB 5CBHA 2OCCC 3HPLC 2WLKA 4QE7A 3K0DA 5KUKA 4J9ZB 1P7BA 1JVMA 5EBWC 4DXWA 2WLJA 2EILC 3FB6C 2WLMA 3IGAC 5B1BC 3BEHA 1OCRC 2HG5C 4MTFA 4G27B 3SYQA 1XL4A 3UKMA 4MW8A 4GX1A 3ABKC 3TETA 2EIKC 4QE9A 4JTDB 2DYRC 4R8CA 3E8HA 3T4DA 5EC2C 2QKSA 4MS2A 2WLIB 3E8FA 5KUMA 5EBLC 1R3KC 3RBZA 2DWDC 2IH3C 4RUEA 1ZWIC 2JK5C 4PA6A 3OR7C 5BZBA 4MVQA 1G4YB 1K4CC 4HYOA 3E8GA 5EC1C 4I9WA 4MVUA 4P30A 2KB1A 1R3JC 3K08A 1KKDA 3SJQC 4WFEA 3F7YC 2AHZA 3OR6C 5B3SC 4MSWC 4WFFA 2HFEC 2EINC 3X2QC 3RVYA 4P2ZA 4R6ZA 3AG4C 3ABMC 3E8BA 4PDRA 2YEVA 5J9PC 2WLNA 1S5HC 2A0LA 1OCZC 5B1AC 4GX2A 2K1EA 3GB7C 4X89A 4P9PA 4KFMA 1J95A 4CBCA 4UUJC 4R50A 3E83A 2NLJC 4MW3A 5E1AC 4RAIA 3SPCA 2X6CA 2Q6AA 3ABLC 2X6AA 2HVJC 1K4DC 3E89A 4H37A 4H33A 2Q67A 4MVMA 3ASNC 4G28B 4HZ3A 4XDKA 3LDDA 2ATKC 2H8PC 2Q69A 1M56C 3STZC 3LNMB 4LP8A 4F4LA 4XDJA 4MTGA 4PDLA 3TCUA 4PA4A 3LUTB
chains in the Genus database with same CATH superfamily
1EBOA 3SJAC 4GUNA 2LO1A 5BR8O 3MDSA 1SKVA 3OFNG 5L3EA 4FLWA 2A79B 3CD6V 3ETQA 4LF5B 4O2AA 2N74A 2Q7HA 4A5UB 3KZIZ 4Q20A 2DWEC 3CC7V 2Q5ZA 4DV4B 2RNBA 4R7CA 2ZNIA 4CZZA 3ZMUA 2V1DA 4B3SB 2MW2B 3K9SA 4EB6B 2DYSC 3TK1A 2L6LA 2ADPA 4TQDA 4DR5B 4GX0A 3X2QB 1GMGA 4ZHQB 5B1AB 4DXWA 3IAYA 3IGAC 3A0HZ 3UKMA 1KU9A 2LQTA 3E22B 4FVMA 3E8FA 3JAMN 3LSQA 2P22C 3K59A 1F7YA 2YICA 4DR6B 1FD9A 5IYBO 1YJ9V 4DR1B 4JAAA 4TV9B 4KUMA 2F66C 5LP6B 2YXLA 4YJ3B 1K5QA 3A2FA 1QR9A 4I0XA 1YVWA 2JGDB 2ADQB 4JGSA 2GV9A 4OX9B 3PN1A 2DW4A 1IX9A 2VS0A 3GWOA 3UT5A 1Y76B 2Q9LA 4NB5A 3RYHA 3W7TA 2HHHB 2OWOA 4DV1B 3B77A 3JAWA 3CYOA 1K7DA 3JATB 1FXKC 1BQ0A 5C8YA 4DR2O 3SDLA 1SQBH 2EIMC 1N0NA 1BGYH 4PA3A 3W7UA 3ZMZA 3QO5A 3DC5A 1PKXA 5ITZA 4DV4O 1NJIW 2Y69B 3AG2C 3F7VC 1YF2A 3U0ZA 4IL6Z 2LGWA 3ZHTA 5CB4B 4K35A 4DUZB 1N33B 4B3SO 1XMQO 2LFSA 4MVOA 5LHGA 1HDJA 1BT8A 3K79A 4RO2A 4DV5B 3BRCA 3HKCA 4DR5O 2ZCEA 2CTWA 3E86A 3G80A 3JARB 2ITDC 4E2LA 3R65A 4K8XA 1TVKA 3CMAV 4JTAB 1XMOB 4UV8A 2ZDIA 3U11A 3TXSA 5H2FZ 3RYCA 4QE7A 2IJHA 5KUKA 5IWAO 1WA8A 4JI1B 4ABMA 4Z2WA 5B1BC 2OT5A 4CH6A 3OT7A 3ABUA 4TSFG 3BCCH 3ZHUA 3RYIA 1IURA 3T4DA 2FYUH 1LR1A 1OHHG 1DF4A 1VP7A 2JK5C 5CA0B 5JWPA 4NR1A 1G4YB 1B3QA 3ZIAG 5LXTB 2Y4UA 2XT9A 1VQNV 2CGNA 4P2ZA 4OX9O 2UXNA 5J9PC 2UU9B 4I55B 3CCRV 5LGNA 3D3QA 1YZBA 4FLVA 4DV1O 3JAKB 2FMLA 4ZKIA 3P3PA 3OEHG 2W0XA 3ASNC 1RFYA 3LDDA 4LF8O 1PNLA 4UXNA 3CE2A 3OAAG 1YI2V 2EZOA 1QLNA 1K92A 3SYAA 3ASOC 5F2VO 2XTAA 3CRMA 2ZE8A 2VQEO 4O4IA 3JYCA 1Y66A 4DUZO 4LFBB 1W0KG 2F4VO 3E2EA 2OTLV 1ZUQA 3OEEG 1HW7A 2EINB 4DV3O 4PA7A 3CXCU 2KG7A 3KCXA 2WLLA 1JFFB 1ZX3A 3A0BZ 2O57A 2E3CA 2Q68A 1R6KA 1XMOO 4B08A 5JCOA 2CTRA 2GTAA 3B8MA 5GONB 4YXWG 4JI1O 3ZRSA 1ORQC 4GLXA 1OV9A 2AZ2A 5IJ0A 2P5OA 5KA5A 4LF9B 1OJHA 1W59A 4HNAA 4UCTA 1QVGU 4OPAA 3J7AU 1IXMA 3CRQA 2EZPA 1N34B 3E8HA 3MHSC 1DK1A 2DWDC 3ZS8C 3QG5A 4PI0A 1KECA 1R3JC 4F6EA 1YITV 2UU9O 3OGIB 2EBOA 1N0JA 2AHZA 3ZMSA 3O65A 3HKEA 4X1YB 1SF9A 2X7RB 3K57A 5J2UA 5IY5B 2QM4A 2IJKA 2YI8A 1XBLA 4GZRB 4UVCA 1VQOV 4B3RB 3SPCA 4KP4A 1PD3A 2X6AA 2ZDIC 4I50A 1OZ0A 4IGGA 1AB3A 4DV6B 3HB3B 4LP8A 3GVMA 4XDJA 2QDOA 4JI4O 1MZFA 4UCVA 4LFBO 4TWKA 3LSUA 5JQGB 2IH1C 2ZR3A 4H0LB 3AEIA 4K0KB 4LCUC 1IBKB 5EYPA 5LMUB 3UO2A 4AHCA 2IM9A 5LGTA 1EN4A 5JJJB 1O9HA 4GT1A 4HBNA 1BL8A 3WU2Z 2F23A 4X9QA 4JI5B 1D5NA 4ZI7B 5JVDB 4MTXA 5FNVA 1PPJH 1Q5OA 1FYJA 2YIBA 1MZEA 2WAMA 2A06H 3E35A 5C93A 2CAZC 3FAVA 1YEWA 4DRXB 3ML0A 4LF9O 3N2KB 1VF5B 4I5SA 2ILMA 5LYJB 1FAFA 4FMTA 4FIPC 2OCCC 1N34O 2ZE5A 2WLJA 3BEHA 2BTOA 4JV5O 2R70A 2EIKC 1WLEA 4JYBA 4KHPO 4YHHB 3MAQA 1KMIZ 2QKSA 3UO3A 4IYIA 4FFBA 4MVQA 5EC1C 3ZMTA 1E1RG 2P6JA 5B3SC 3D36A 1UJWB 1R1BA 2XUMA 4J7JA 1BHAA 5JCOC 3GB7C 2ZE6A 4X62B 5EZYB 4DV6O 3C3TA 3ABLC 1P7GA 1SZXA 4DR4B 4DV7B 2GBOA 4JI8O 4H37A 4LH7A 1HR0O 1JMKC 2EX3A 2Q67A 4G28B 3AK2A 4XDKA 3L73H 1BSMA 3CP1A 1TUEB 3LUTB 4K0KO 2LP7A 1AILA 1IBKO 5LMUO 1M1KW 4UVBA 2YIAA 4PELA 5KHHA 4CC5A 2V4DA 1PV0A 3QF7A 2YC0A 3FB7C 3AG1B 4JI5O 2UXDO 1SQVH 3JCUZ 1SA0B 4NXMB 1RSOB 3N27A 4EKWA 2E74B 4X88A 3OUSA 3AK1A 2YXHA 2B5UA 3SYOA 2P67A 4OPHA 2HJFC 2P4KA 2PI5A 2JS5A 4UFZA 2QR4A 4JF3A 1M56B 4TQFA 4LBEC 3SPGA 2ZINA 1I7FA 4ASUG 3ABMB 2V7QG 2WLKA 4CS2A 1P7BA 1BHBA 3WB2A 4U3FH 3SYQA 1XL4A 5L3FA 5LMNO 1H2LA 2MK3A 4MW8A 1DTOA 5CA1A 4B3MO 3CCSV 1VQMV 1SESA 3ABTA 2LGQA 5BZBA 1XREA 1TAEA 4P30A 2KB1A 3AG7A 1VARA 2IW5A 2Q73A 1F51A 3JASA 4FLTA 3ZRVA 1ZL8B 5KAFZ 1GAXA 4YJ2B 1RM1C 4DR4O 4CH3A 4DV7O 3T1YB 4X89A 4WBNB 4UUJC 2UUAO 4BIUA 2EJ7A 4GCZA 3BFRA 1XI1A 1V54B 1H2GA 2H8PC 2OIGA 2YSUB 5LHIA 2Q69A 1CP9A 1LUVA 1Q6UA 2DJVA 1J5EB 4X64B 1R3IC 1V55B 4YIPA 3ZN0A 2PZSA 4X65B 4JI3B 4DV0B 4P9OA 5EBMC 1Q8IA 4EB6A 1R3LC 2R72A 2ZE7A 3D36C 1AR4A 4NKGB 3BHPA 2YDEA 1KUQA 1FPOA 1I5XA 4TUYB 1PNMA 4AQYB 3FYEB 2DYRB 2XAGA 1XOUA 4ZHQA 1IBMO 3A8TA 3VQYA 3QVNA 3RW0A 1NQTA 4D6TH 3B2EE 1N36O 4LFAO 4U7NA 4PDVA 1SQFA 4UV9A 3CCJV 1XEQA 3E22A 4GX5A 2XAQA 5L3BA 1YHQV 4NTYA 1L1FA 2QM7A 1K9MW 4TV9A 4G27B 5LP6A 4UB6Z 1DF5A 4ZIBA 3H1IH 4YJ3A 3S3WA 4LF4O 1XQ8A 2JGDA 4DV2O 3E8GA 3IC9A 4C7UA 3OMIB 1XUQA 1NTMH 1Y76A 1HNZO 1AJQA 4CS3A 2N04A 4TT3G 1GTOA 1J95A 1FFXA 3AK3A 2NLJC 2WA4A 3JATA 1MABG 1UPGA 3OW2U 4H33A 4JYYA 4X64O 2XASA 5B1BB 3SJCC 1URFA 1HWYA 1GH6A 4LFCB 5GW7A 5BMVB 3T1HO 3TCUA 4DV0O 4DR7B 3JD0A 5K1PA 1AI4A 2JVDA 5CB4A 4RUFA 1AI5A 3CC2V 3CPWU 1ZTEA 1M57C 4X8AA 1FXVA 5EIBD 1G6UA 1XNQB 2QWQB 3RFRA 3OD4A 3ICXA 5KHJA 3UCSC 1VQ5V 3JARA 2GHYA 3K5MA 3DXRB 3B8NA 2WLHA 2XAFA 1QLEC 1G1XB 1OCOC 2FB5A 2BOBC 3JD4A 3WG7C 2X0LA 3L74H 4ZBMA 4I4TB 4LF5O 1D5AA 4YY3B 3ZHSA 2EIJC 2N05A 3ETEA 1EFRG 1H2SB 5CA0A 1AI7A 5EBWC 3ASOB 5LXTA 1HP8A 2WLMA 2CE4A 2LW1A 1QNMA 2RN9A 3BY6A 2KQXA 5KX5B 1N8RW 4H13B 4FZ0A 1I0HA 4I55A 3OR7C 1P49A 1Q6IA 5H5NA 1EM1A 1BQZA 2Z5UA 3ZRWB 1YTFD 3JAKA 3H1JH 2CDYA 4X1KB 3X2QC 1X59A 1NS1A 4FM1A 3CCEV 1S5HC 2XNDG 2CH7B 5B1AC 2HR3A 4E4EA 4GX2A 3RYHB 1SRYA 4DR6O 3RYFB 3AG3B 4F6RB 4DR1O 2VWKA 4LFCO 3OM3B 2D2CB 3JD2A 5J2TB 1I94B 1NVPD 4DW0A 1KD1W 4FLXA 2JEUA 1ENVA 2JS3A 3FYIB 5LP6C 5DN6G 1BZKA 3ZHQA 3JALB 1XL6A 3KCYA 4N23A 4XDLA 4PHZA 1KB9F 2CTPA 1XNQO 1JFFA 4DO2A 4KL1A 4MVSA 4JZGA 5KA6A 1BE3H 2HHHO 5LL6Y 1AR1B 1OCCC 5GTHZ 4BW9A 1RPRA 2CUGA 2FL4A 3CCMV 5GONA 1KBHA 3HKDB 4LF6B 3ABKB 4NXNB 2QA4V 5DM6V 3SGIA 1EZVH 1NZ6A 1ZAUA 2BTQB 2AHYA 3RYCB 4JTCB 3B40A 1N33O 1Y67A 3OGCC 1RP3B 1SS3A 3A0RA 3U10A 1FJGB 2Y69C 5LA6B 1SQPH 3AG4B 1Q82W 1IXBA 4DV5O 4FJCC 3CRAA 3FB6C 5IE9A 1NR7A 1OCRC 3TGUH 2HEPA 1CXZB 1VQ4V 4X1IB 4X1YA 4U3JB 4WFBV 4DUYB 1PNKA 1R6NA 2M7WA 1LUWA 3ETGA 4Q6GA 4JYCA 2PF4E 4LH6A 4DK1A 5KMGB 5L3GA 4WFAV 2DE0X 2JDIG 1Y4MA 3K3WA 2OTJV 2A0LA 1YJNV 1Q3EA 3JD1A 5KAIZ 1I94O 2X6CA 4QGPA 4AILC 5JQGA 2YEVB 1M5IA 2PUSA 2NNUA 2BSKB 4MTGA 3IJ4A 3JSLA 2HJDA 2ITCC 3S3XA 4O4HB 3QTCA 4FZ1A 4J11A 1P84F 1GM9A 2FTKA 4ZI7A 5A2QN 5JVDA 4BWAA 3JSNA 1YIJV 4LWSB 1IBLB 4HAMA 3OUFA 1R73A 2WWWA 2NN4A 4NXNO 5BXZA 4RQFA 5H6QA 1KP2A 4DRXA 1H8HG 3G71V 3N2KA 1TUBB 3H01A 5LYJA 1SC5B 3CHXA 4J80A 3ABLB 2CK3G 1KQSU 2AZ0A 4JASA 3ZN1A 3ZRXA 1FJGO 2ZM6B 1Y74B 2E75B 3TXQA 4G2KA 2ARHA 4O4LB 1MSWD 2UXXA 3K06A 1KKCA 2W6IG 3L70H 3HPLC 1K33A 5JJNB 1VQ6V 2DN9A 5LBQA 4O2BB 3FKSG 1WAZA 2UUCB 3NR7A 5EC2C 1YTFB 4JI6B 3H1HH 3QO8A 1ZWIC 3HR0A 3OE7G 2B1GA 5EZYA 5IYZB 4MSWC 4WF9V 3TJTA 1WNSA 4CH4A 5A9GA 3I5DA 4KXRA 4X20B 1NKDA 4P9PA 1NVPB 4UCOA 4MW3A 1AJPA 3O9OA 1YJWV 2JJ1G 2UUBB 3LNMB 5IJ9B 1GM7A 4PA4A 1SA0A 2YUAA 1RSOA 3IC7A 5E79Z 1SERA 4B3RO 1WJZA 3MHHC 5IY5C 2JJ2G 1QBZA 3THOA 4I9QA 4GYCB 2GSMB 3D8CA 3SPJA 1QCEA 1COWG 1L0NH 3FFQA 1VQPV 3K04A 5FPOA 4JZ2A 2ZXWC 5JJEB 1NTZH 3K0GA 3JCZA 3FB8C 2ZKOA 1SZTA 3EFFK 5KHIA 3T4ZA 4PDMA 3ZBHA 1US6A 4MTOA 4PV1B 2UUCO 4Z1MG 1AI6A 4XBFA 2OIEA 3LNNA 2Z3YA 2EILC 4H44B 4ZOLB 2OYQA 2RJZA 4PI2A 4X66B 1Q86W 4TV8B 2VQFB 2PY5A 3VQWA 2AGAA 1ZL8A 4YJ2A 2IH3C 4RUEA 4HYOA 4FFKA 4WBNA 2F43G 4WFEA 2PYJA 1B04A 3OR6C 1NH2B 1VQKV 4YHHO 1WPXA 3E8BA 2RCVA 4L87A 2K1EA 5DEDA 2AXTZ 4KFMA 4B7EA 2UUBO 1NTKH 1TGOA 3N2GB 1Z2GA 1O9GA 2QTSA 1WN7A 2Q4PA 2YXYA 3FX7A 4CS4A 1WB7A 2K9PA 4X62O 1E79G 2DYSB 1K5SA 2OCHA 1H2MA 4TUYA 5BY1A 2F1MA 3CC4V 4BW5A 2ZR2A 5L3CA 2BCCH 3VQVA 2ZD9A 1JCHA 2F93B 1R6TA 2Q8VA 1N4CA 1TA8A 4AI8A 1KC8W 5HFLA 2QWNB 3ZJZA 1FFTB 1FXHA 2BE3A 2H3OA 1G8MA 2ZNJA 3G6BA 3OMNB 3Q4HB 4NXMO 1VIBA 4LNUB 4UCUA 3GWKC 4J9YB 3HKBB 5IYDO 2D3OW 1K3EA 1NR1A 4B7KA 4QNHB 1Q6HA 3AG1C 3SJBC 1MG1A 1AROP 1MNGA 1W0JG 3OMAB 4X66O 1IVSA 2WPDG 3OTOB 4O4JB 3TETA 2PTMA 5KLVH 4MS2A 2WLIB 1GK9A 3CB2A 1KP3A 3EXAA 4RWUA 1D2DA 2GUZB 4K8ZA 1MMMA 1OCOB 5LOVB 3BA9A 3WG7B 1FXKB 5H6RA 4RQEA 3P32A 2EIMB 3RVYA 3ABMC 3W7WA 3P3NA 2WLNA 1OCZC 2ZIOA 1U97A 5BMVA 3CJHB 3AG2B 2EIJB 4DR2B 5E1AC 2A7WA 2Q6AA 3QO7A 3BA8A 4IHJB 5KHGA 1GRJA 3CEIA 3ZMVA 2ETNA 4ICGA 3W7XA 3VBBA 1NT2B 3C3SA 4IIJB 3T1YO 3K5OA 4D7SA 2QSAA 1V9PA 1XILA 1XMQB 1UFIA 3DXRA 2XAJA 3T1CA 4U7OA 5H9CA 2ZQMA 5CBFA 1BCCH 4UCRA 1JQ0A 3CWBH 1MSDA 5JH7B 5CMUA 5LGUA 1J5EO 4I4TA 3M99B 4FPPA 1XNRB 5D5QA 1M4UA 4J7ZA 1V54C 1PL0A 2X6BA 3BAAA 4NTXA 4X65O 2WSSG 4JI3O 2G38A 2IJIA 4JI2B 5IWAB 1T5EA 1ROPA 4O2AB 1GKFA 3I56V 2R9RB 1V55C 3G67A 5KX5A 3CCLV 3DTUB 1H2KA 1JJOA 3KG2A 3OTOO 4AQYO 3K0DA 1GM8A 1YDXA 4J9ZB 1QR8A 2QM8A 1S3JA 3CCQV 4PJ0Z 4JAUA 4Z1VA 2HG5C 4NTWA 3ZRWA 2A3QA 3C90A 2JRIA 4X1KA 2DYRC 5GTIZ 3ZEDA 1H8EG 5EBLC 1OCCB 3ASNB 1R3KC 3RN4A 5CA3A 2QE7G 2CH7A 1PP9H 5IYCO 1JOYA 1I08A 1K73W 3RYFA 1KKDA 4F6RA 2FKXA 1M90W 1FFXB 4BIOA 4LF8B 2Y0IA 2Y4TA 5B66Z 3RT3C 5J2TA 4MT8A 3CRCA 3QNEA 4CBCA 4GKKB 4J7KA 1Q43A 3JALA 3K58A 2PGGA 1K4DC 2VQEB 1S0VA 2QWOB 1SQGA 2ATKC 4I0XB 2IJJA 2F4VB 1OCRB 1JJ2U 1B06A 4DV3B 1S5JA 4WFHA 2GTSA 1Q81W 5B1NA 3UT5B 1QQCA 3L9DA 3VQXA 3HKDA 3LSSA 3CMEV 3EHBB 1VQLV 3RVZA 1XNRO 3F5WC 4QIWF 3JAWB 2Y48A 3SPIA 5C8YB 4DR7O 5TISZ 2BTQA 4JI2O 1PM9A 5CBGA 1NI8A 2A9HA 4BR6A 4IYHA 3WB1A 4CH5A 5ITZB 1XHZA 1S76D 1JX9A 3UM7A 5LA6A 3JD3A 1QVFU 4BIZA 3CCVV 2ZT9B 3VOUA 1JA8A 3CS5A 3L72H 4OXSA 4PA9A 4X1IA 4U3JA 3SYCA 4QPJA 2HP8A 3HKCB 4L8JA 2ZIMA 1I5YA 1JVMA 1EZJA 2YI9A 2IU0A 4N21A 5L3DA 3H9VA 1TVKB 4LC1A 4FM0A 4YY3O 5KMGA 5KHKA 4EEQA 2UXCB 5IT9N 2YIBD 2LW7A 1XDCA 1AVMA 1WA8B 4CC6A 2EJRA 4I9WA 3SJQC 2QWPB 3EVKA 3RYIB 1Z5VA 3RWRD 4UB8Z 2ODMA 1W2BU 1U96A 2JEXA 4GKKO 1Z5WA 2YEVA 1VF7A 4JPRA 1SETA 2BSKA 4JI4B 1X4TA 3H1LH 1YCIA 3L75H 1S5LZ 4EFBA 2HVJC 2RDCA 4O4HA 3B09A 1L0LH 4LWSA 1WP8A 1HNWB 2NR5A 2PYLA 1GO3F 4JI7B 4EFEA 1FKAO 3BVOA 4WCEV 2HKOA 3DGEA 4D7TA 1TUBA 2Q7GA 1HNXB 1S72V 4W4LA 3FD9A 1F4MA 3I55V 1NH2D 3CCUV 2QKAA 3AG3C 2OCCB 3G6EV 1NBMG 1EN5A 1Y74A 1IDSA 3SYPA 4MVZA 4O4IB 4J10A 3LDCA 4O4LA 1LNQA 2EIKB 2QKCA 3RGBA 2YS8A 3G4SV 2W0FC 4QJFB 1P4RA 2W6JG 2KSDA 1ZLZA 2KG7B 3ZCCA 4JV5B 4O2BA 2WLLB 1B6QA 4KHPB 4UCSA 5CN0A 5B3SB 4LF6O 5EK0A 2C2AA 1K97A 1SQXH 1MOFA 2UXCO 2LFRA 3SR2C 2DQ0A 5FLXN 4FLZA 5IYZA 2RMKB 4DR3B 3ABKC 2VRZA 2Y0PA 1JPXA 5IJ0B 4HNAB 1H38A 4X20A 2B9ZA 4MVUA 3K08A 1AR5A 2F95B 4JI8B 3M7MX 2E76B 1HR0B 3WFVA 2KKWA 2EINC 2ZXWB 2Z0AA 3AG4C 2DMXA 2XOKG 1GN3A 4DUYO 2L35A 5IJ9A 1WPBA 4RAIA 1HNWO 4QPKA 2H94A 3HKEB 4JI7O 4LR3A 4HZ3A 1WP7A 3BPZA 5J2UB 2EILB 3STZC 5FL7G 2UXDB 4F4LA 2JGUA 1QU7A 1YSCA 1HNXO 4BAYA 1Q90D 1ZSPA 4TOIA 2QWRB 4I50B 2P7TC 2GDSA 1PL4A 1VQ9V 3DSQA 2HVKC 2M6YA 2YIDA 2DOSA 2XHBA 2LJ2A 4JYAB 4J42A 1N32B 3STLC 4LF7B 3K9AA 4DK0A 2XAHA 4JI0B 3K03A 5EYPB 5EIBC 1GN2A 2BOCC 1BS3A 1IBLO 1VEWA 1JR9A 1A32A 2Q0AA 4MVRA 1YXBA 5LMNB 4ZOLA 3LDEA 1K34A 4B3MB 4GKJB 1DGSA 4TV8A 2QEXV 3APOA 1DLBA 5FNVB 3T2MA 1AP6A 2JIZG 4DR3O 1RM1B 2ZM6O 3FAVB 1VF6A 4MTFA 3ZHVA 5LHHA 2E5LB 2WA3A 3ETDA 1GN6A 4QE9A 4IT5A 4JTDB 1VQ7V 4R8CA 5KUMA 5B1OA 4PA6A 4FLYA 4I7ZB 1K4CC 2UUAB 4FM2A 1KYOF 3OTFA 3K5NA 1CPYA 3N2GA 4WFFA 2HFEC 1F23A 1SQQH 4K3AA 2CTQA 4PDRA 4UVAA 4B3TB 4DW1A 4NYKA 1VQ8V 4JI6O 4J41A 3M8AA 4FFBB 2PI4A 4PD4F 4R50A 2R9AA 3E83A 3H1KH 5K1XA 2P90A 3CXHF 4W4KA 5HFMA 3ZX6A 1IZ3A 1M93A 3W7SA 1CEZA 3ZHRA 3KKYA 2CGOA 2Q0OC 1FS0G 1H2NA 2UXBB 5D5PA 2IBZH 1EN6A 3B4SA 1E1QG 1VMGA 4JYAO 1N32O 3FB5C 2Q7EA 3MD0A 2QJ1A 1RPOA 4LF7O 1IBMB 2RQ6A 4JI0O 5FPRA 3Q4HA 1N36B 3IFXA 4LNUA 4LFAB 5BR8B 1S77D 1F4NA 1OCZB 3HKBA 1THZA 3PJSK 1MA1A 1K8AW 3J81N 1GN4A 2EULA 1M9NA 4DYLA 4OGQB 3CRRA 4FK5C 2P4VA 3SPHA 4GKJO 1WB8A 1BMFG 1L8DA 2HLDG 3DC6A 1QHTA 3R66A 2QTOA 4O4JA 1Y6XA 1Q7YW 5IDJA 4WFGA 4LF4B 4FLUA 2WLIA 5AG2A 5CBHA 1AJNA 2E5LO 4DV2B 3K5LA 2GUZA 3UQ8A 3BABA 3CX5F 5LOVA 1FXKA 4GX1A 3L71H 5B5EZ 1HNZB 2IU3A 3RBZA 3D3IA 4NVPA 5DECA 3CJHA 1NU1H 2VWJA 4B3TO 4YIOA 3F7YC 4IHJA 5CA1B 3J80N 3P30A 4JAVA 2VQFO 1M57B 4R6ZA 2QGNA 3T1HB 4IIJA 2AW9A 1AP5A 1XHXA 2DQ3A 3JASB 3CSXA 3E89A 4MVMA 2UXBO 3APQA 2R9IA 1QLEB 3F5TA 3WB0A 1M56C 2B1IA 5JH7A 4PDLA 1VF6C 2P06A 3NXSA
chains in the Genus database with same CATH topology
4WFHA 1Q81W 1EBOA 2ITCC 5B1NA 1M1KW 4UVBA 4PELA 1GM9A 2FTKA 3LSSA 3CMEV 1YIJV 3EHBB 1VQLV 3RVZA 3FB7C 3AG1B 3F5WC 3OFNG 4HAMA 5L3EA 4QIWF 2A79B 3CD6V 2Y48A 3OUFA 3SPIA 1R73A 2WWWA 4Q20A 2DWEC 3CC7V 4EKWA 4RQFA 4R7CA 5H6QA 5CBGA 1KP2A 4CZZA 1H8HG 3G71V 4X88A 2A9HA 3OUSA 3ZMUA 3H01A 2V1DA 2B5UA 3SYOA 1S76D 2P67A 1JX9A 3UM7A 2HJFC 3ABLB 2CK3G 3JD3A 4BIZA 1KQSU 1QVFU 2PI5A 4JASA 3ZN1A 3CCVV 3ZRXA 5CA3A 2DYSC 3VOUA 3TK1A 4JF3A 1M56B 4G2KA 4LBEC 4OXSA 4PA9A 1MSWD 4GX0A 2UXXA 3K06A 3SPGA 2W6IG 3SYCA 3X2QB 4ASUG 4QPJA 1GMGA 3HPLC 3ABMB 2V7QG 2WLKA 1K33A 1I5YA 1JVMA 1P7BA 5B1AB 1EZJA 4DXWA 2IU0A 3IGAC 4N21A 1BHBA 5L3DA 1VQ6V 5LBQA 3SYQA 1XL4A 3UKMA 3FKSG 4LC1A 5L3FA 2MK3A 4MW8A 1DTOA 3CCSV 1VQMV 5EC2C 1YTFB 3E8FA 3LSQA 3QO8A 1SESA 1ZWIC 3ABTA 3OE7G 5BZBA 5IYBO 2EJRA 1YJ9V 4I9WA 2B1GA 4P30A 2KB1A 3SJQC 4KUMA 2IW5A 1F51A 4MSWC 1K5QA 4WF9V 3ZRVA 1W2BU 2JEXA 2YEVA 1QR9A 1RM1C 4JPRA 1SETA 4JGSA 1NKDA 4X89A 4P9PA 1NVPB 4UUJC 4MW3A 4BIUA 1AJPA 2DW4A 4GCZA 2HVJC 3GWOA 1V54B 1YJWV 1H2GA 3W7TA 2JJ1G 2H8PC 2YSUB 5LHIA 2Q69A 3LNMB 1CP9A 1GM7A 1GO3F 3B77A 4PA4A 3CYOA 1K7DA 1R3IC 1FXKC 3IC7A 1SERA 2EIMC 1V55B 4PA3A 4WCEV 3ZN0A 3W7UA 3ZMZA 3MHHC 2HKOA 3DGEA 3QO5A 5IY5C 4P9OA 2JJ2G 1QBZA 5EBMC 1PKXA 1S72V 1NH2D 1F4MA 3I55V 1NJIW 3CCUV 2Y69B 3AG2C 3F7VC 3AG3C 2OCCB 2GSMB 3G6EV 1NBMG 1R3LC 3SPJA 1QCEA 1COWG 3SYPA 4MVZA 2LFSA 1I5XA 4MVOA 1PNMA 3LDCA 1VQPV 1LNQA 2EIKB 3FYEB 3K04A 2DYRB 5LHGA 2XAGA 3K79A 4RO2A 3G4SV 2ZXWC 3K0GA 3JCZA 3FB8C 1SZTA 2W0FC 1NQTA 1P4RA 3E86A 3EFFK 2ITDC 3RW0A 4QJFB 2W6JG 4E2LA 3R65A 3ZCCA 2WLLB 4U7NA 4PDVA 4JTAB 3CMAV 1B6QA 4UV9A 3T4ZA 3CCJV 4PDMA 4UV8A 4GX5A 5CN0A 2XAQA 4MTOA 5B3SB 5L3BA 1YHQV 2ZDIA 5EK0A 2C2AA 1K97A 4QE7A 2IJHA 1MOFA 4Z1MG 1AI6A 4XBFA 5KUKA 1L1FA 2LFRA 2QM7A 2Z3YA 2EILC 5B1BC 2OT5A 2DQ0A 1K9MW 3ABUA 4G27B 4TSFG 1DF5A 3ABKC 1Q86W 3T4DA 1JPXA 1OHHG 1DF4A 2IH3C 4RUEA 2JK5C 1G4YB 1H38A 3ZIAG 4HYOA 3E8GA 4MVUA 3K08A 2F43G 4WFEA 3OMIB 3OR6C 1NH2B 3WFVA 1VQNV 1VQKV 2ZXWB 2EINC 1WPXA 4P2ZA 3AG4C 2UXNA 3E8BA 5J9PC 2XOKG 1AJQA 3CCRV 4L87A 5LGNA 2K1EA 4TT3G 1GTOA 4KFMA 1J95A 2NLJC 4RAIA 1MABG 4ZKIA 4QPKA 3OW2U 2H94A 3OEHG 4H33A 3ASNC 4HZ3A 2XASA 3LDDA 2EILB 5B1BB 1PNLA 3STZC 4UXNA 5FL7G 1HWYA 4F4LA 5GW7A 1YSCA 3OAAG 3TCUA 1YI2V 2EZOA 3JD0A 1AI4A 4BAYA 4RUFA 1AI5A 1E79G 1QLNA 3CC2V 2DYSB 1K5SA 1K92A 3SYAA 3ASOC 1M57C 3CPWU 4X8AA 1FXVA 3JYCA 1Y66A 2P7TC 3CC4V 4BW5A 1VQ9V 2HVKC 1W0KG 3E2EA 2OTLV 2ZR2A 3OEEG 3STLC 5L3CA 2EINB 1VQ5V 4PA7A 3CXCU 2ZD9A 1JCHA 2GHYA 3K9AA 2WLLA 3B8NA 2WLHA 2XAFA 2XAHA 3K03A 1QLEC 1OCOC 1KC8W 2BOBC 3JD4A 3WG7C 2BOCC 5HFLA 2Q68A 3ZJZA 2X0LA 1R6KA 1FFTB 4ZBMA 1FXHA 3OMNB 1G8MA 4MVRA 3B8MA 4J9YB 3LDEA 1K34A 4YXWG 5IYDO 3ZRSA 2EIJC 2D3OW 3ETEA 2QEXV 1K3EA 1NR1A 1ORQC 4QNHB 3AG1C 1DLBA 1MG1A 1AROP 1EFRG 3T2MA 2JIZG 1W0JG 3OMAB 5KA5A 1RM1B 1QVGU 1AI7A 5EBWC 3ASOB 2WPDG 2WLMA 4MTFA 3BY6A 1IXMA 2EZPA 5LHHA 3TETA 3ETDA 4QE9A 4JTDB 1VQ7V 4R8CA 1N8RW 3E8HA 3MHSC 5KUMA 4MS2A 2WLIB 2DWDC 1GK9A 5B1OA 4PA6A 1KP3A 3OR7C 1K4CC 1KECA 1R3JC 1YITV 1OCOB 2Z5UA 3ZRWB 3WG7B 1FXKB 2AHZA 2EBOA 5H6RA 4RQEA 1CPYA 3ZMSA 3P32A 1YTFD 4WFFA 2HFEC 2EIMB 1F23A 3X2QC 3RVYA 2X7RB 3ABMC 4PDRA 4UVAA 3W7WA 3CCEV 2WLNA 1S5HC 5IY5B 2XNDG 1OCZC 2IJKA 2HR3A 5B1AC 1VQ8V 4GX2A 2PI4A 1SRYA 2EIJB 3AG2B 3AG3B 4UVCA 4R50A 3E83A 1VQOV 5E1AC 2P90A 3SPCA 2Q6AA 3QO7A 4KP4A 1PD3A 2X6AA 3OM3B 2ZDIC 5HFMA 3W7SA 1CEZA 3JD2A 1OZ0A 3ZMVA 3W7XA 3VBBA 1NVPD 1KD1W 3HB3B 4LP8A 2JEUA 4XDJA 1FS0G 1ENVA 3FYIB 5DN6G 4TWKA 1XL6A 4XDLA 4N23A 1E1QG 2IH1C 2ZR3A 2XAJA 3T1CA 4U7OA 5H9CA 4DO2A 2ZQMA 3AEIA 3FB5C 5CBFA 4MVSA 3MD0A 4LCUC 1RPOA 5KA6A 1JQ0A 5LGTA 1AR1B 5CMUA 5LGUA 4GT1A 1BL8A 3M99B 1OCCC 1S77D 3IFXA 4FPPA 1F4NA 1RPRA 1OCZB 3CCMV 1V54C 1PL0A 2X6BA 1THZA 3PJSK 2WSSG 3ABKB 1K8AW 4MTXA 1M9NA 2IJIA 2QA4V 5DM6V 4FK5C 3SPHA 1BMFG 1ROPA 2WAMA 1GKFA 3I56V 2R9RB 3E35A 2HLDG 1V55C 2AHYA 5C93A 4JTCB 3ML0A 3OGCC 2QTOA 3CCLV 3DTUB 1Q7YW 5IDJA 3A0RA 4I5SA 4WFGA 3KG2A 2Y69C 4FIPC 2WLIA 4FMTA 5CBHA 2OCCC 3AG4B 1AJNA 1Q82W 3K0DA 1GM8A 4J9ZB 1QR8A 2QM8A 4FJCC 1S3JA 2WLJA 3FB6C 3CCQV 3BEHA 4JAUA 1NR7A 1OCRC 2HG5C 3ZRWA 1FXKA 4GX1A 1VQ4V 2EIKC 1WLEA 4JYBA 2DYRC 4WFBV 2QKSA 2IU3A 1H8EG 5EBLC 1OCCB 1PNKA 1R3KC 1R6NA 3ASNB 3RBZA 2QE7G 2M7WA 3D3IA 5IYCO 4MVQA 3ETGA 1JOYA 5EC1C 4JYCA 1K73W 3ZMTA 1KKDA 1E1RG 2P6JA 3F7YC 1M90W 5B3SC 3D36A 5L3GA 4WFAV 1UJWB 3P30A 4JAVA 2JDIG 1M57B 1Y4MA 3K3WA 4R6ZA 2OTJV 2A0LA 1BHAA 4MT8A 3GB7C 1YJNV 3QNEA 4CBCA 3JD1A 2DQ3A 2X6CA 3ABLC 1K4DC 1S0VA 3E89A 4H37A 2Q67A 4MVMA 4G28B 4XDKA 2YEVB 2R9IA 2ATKC 1QLEB 2IJJA 1M56C 1OCRB 1JJ2U 2NNUA 4MTGA 2B1IA 3CP1A 4PDLA 1TUEB 3LUTB 2LP7A 3NXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3I C;  4WFH A;  4RUF A;  4TWK A;  1XL6 A;  4XDL A;  2ITC C;  2EIM C;  4PA3 A;  3SYA A;  3ASO C;  1M57 C;  2IH1 C;  4X8A A;  3T1C A;  5CBF A;  3FB5 C;  3JYC A;  2P7T C;  4MVS A;  5IY5 C;  4LCU C;  4P9O A;  5EBM C;  4BW5 A;  3RVZ A;  3FB7 C;  2HVK C;  3AG2 C;  3F5W C;  3F7V C;  3AG3 C;  2A79 B;  3OUF A;  3SPI A;  3STL C;  1R3L C;  1BL8 A;  3SPJ A;  1OCC C;  4PA7 A;  2DWE C;  2ZD9 A;  3IFX A;  4EKW A;  4R7C A;  5CBG A;  3SYP A;  2WLL A;  1V54 C;  4MVZ A;  2X6B A;  2WLH A;  3K03 A;  3PJS K;  1QLE C;  2A9H A;  3OUS A;  4MVO A;  4X88 A;  3LDC A;  1LNQ A;  1OCO C;  2BOB C;  3SYO A;  3K04 A;  3WG7 C;  2BOC C;  3UM7 A;  2Q68 A;  2HJF C;  3ZJZ A;  4RO2 A;  3SPH A;  2ZXW C;  4ZBM A;  3K0G A;  2R9R B;  3FB8 C;  4MVR A;  2W0F C;  3E86 A;  3EFF K;  3RW0 A;  2DYS C;  1V55 C;  2AHY A;  2ITD C;  3VOU A;  4JTC B;  3R65 A;  4J9Y B;  3LDE A;  2WLL B;  3OGC C;  4PDV A;  2QTO A;  4JTA B;  3ZRS A;  3T4Z A;  2EIJ C;  4PDM A;  4LBE C;  4GX5 A;  4OXS A;  4WFG A;  4MTO A;  1ORQ C;  4PA9 A;  3KG2 A;  4GX0 A;  3AG1 C;  3K06 A;  3SPG A;  2Y69 C;  5EK0 A;  2WLI A;  3SYC A;  3T2M A;  4QNH B;  5CBH A;  2OCC C;  3HPL C;  2WLK A;  4QE7 A;  3K0D A;  5KUK A;  4J9Z B;  1P7B A;  1JVM A;  5EBW C;  4DXW A;  2WLJ A;  2EIL C;  3FB6 C;  2WLM A;  3IGA C;  5B1B C;  3BEH A;  1OCR C;  2HG5 C;  4MTF A;  4G27 B;  3SYQ A;  1XL4 A;  3UKM A;  4MW8 A;  4GX1 A;  3ABK C;  3TET A;  2EIK C;  4QE9 A;  4JTD B;  2DYR C;  4R8C A;  3E8H A;  3T4D A;  5EC2 C;  2QKS A;  4MS2 A;  2WLI B;  3E8F A;  5KUM A;  5EBL C;  1R3K C;  3RBZ A;  2DWD C;  2IH3 C;  4RUE A;  1ZWI C;  2JK5 C;  4PA6 A;  3OR7 C;  5BZB A;  4MVQ A;  1G4Y B;  1K4C C;  4HYO A;  3E8G A;  5EC1 C;  4I9W A;  4MVU A;  4P30 A;  2KB1 A;  1R3J C;  3K08 A;  1KKD A;  3SJQ C;  4WFE A;  3F7Y C;  2AHZ A;  3OR6 C;  5B3S C;  4MSW C;  4WFF A;  2HFE C;  2EIN C;  3X2Q C;  3RVY A;  4P2Z A;  4R6Z A;  3AG4 C;  3ABM C;  3E8B A;  4PDR A;  2YEV A;  5J9P C;  2WLN A;  1S5H C;  2A0L A;  1OCZ C;  5B1A C;  4GX2 A;  2K1E A;  3GB7 C;  4X89 A;  4P9P A;  4KFM A;  1J95 A;  4CBC A;  4UUJ C;  4R50 A;  3E83 A;  2NLJ C;  4MW3 A;  5E1A C;  4RAI A;  3SPC A;  2X6C A;  2Q6A A;  3ABL C;  2X6A A;  2HVJ C;  1K4D C;  3E89 A;  4H37 A;  4H33 A;  2Q67 A;  4MVM A;  3ASN C;  4G28 B;  4HZ3 A;  4XDK A;  3LDD A;  2ATK C;  2H8P C;  2Q69 A;  1M56 C;  3STZ C;  3LNM B;  4LP8 A;  4F4L A;  4XDJ A;  4MTG A;  4PDL A;  3TCU A;  4PA4 A;  3LUT B; 
#chains in the Genus database with same CATH topology
 1EBO A;  3SJA C;  4GUN A;  2LO1 A;  5BR8 O;  3MDS A;  1SKV A;  3OFN G;  5L3E A;  4FLW A;  2A79 B;  3CD6 V;  3ETQ A;  4LF5 B;  4O2A A;  2N74 A;  2Q7H A;  4A5U B;  3KZI Z;  4Q20 A;  2DWE C;  3CC7 V;  2Q5Z A;  4DV4 B;  2RNB A;  4R7C A;  2ZNI A;  4CZZ A;  3ZMU A;  2V1D A;  4B3S B;  2MW2 B;  3K9S A;  4EB6 B;  2DYS C;  3TK1 A;  2L6L A;  2ADP A;  4TQD A;  4DR5 B;  4GX0 A;  3X2Q B;  1GMG A;  4ZHQ B;  5B1A B;  4DXW A;  3IAY A;  3IGA C;  3A0H Z;  3UKM A;  1KU9 A;  2LQT A;  3E22 B;  4FVM A;  3E8F A;  3JAM N;  3LSQ A;  2P22 C;  3K59 A;  1F7Y A;  2YIC A;  4DR6 B;  1FD9 A;  5IYB O;  1YJ9 V;  4DR1 B;  4JAA A;  4TV9 B;  4KUM A;  2F66 C;  5LP6 B;  2YXL A;  4YJ3 B;  1K5Q A;  3A2F A;  1QR9 A;  4I0X A;  1YVW A;  2JGD B;  2ADQ B;  4JGS A;  2GV9 A;  4OX9 B;  3PN1 A;  2DW4 A;  1IX9 A;  2VS0 A;  3GWO A;  3UT5 A;  1Y76 B;  2Q9L A;  4NB5 A;  3RYH A;  3W7T A;  2HHH B;  2OWO A;  4DV1 B;  3B77 A;  3JAW A;  3CYO A;  1K7D A;  3JAT B;  1FXK C;  1BQ0 A;  5C8Y A;  4DR2 O;  3SDL A;  1SQB H;  2EIM C;  1N0N A;  1BGY H;  4PA3 A;  3W7U A;  3ZMZ A;  3QO5 A;  3DC5 A;  1PKX A;  5ITZ A;  4DV4 O;  1NJI W;  2Y69 B;  3AG2 C;  3F7V C;  1YF2 A;  3U0Z A;  4IL6 Z;  2LGW A;  3ZHT A;  5CB4 B;  4K35 A;  4DUZ B;  1N33 B;  4B3S O;  1XMQ O;  2LFS A;  4MVO A;  5LHG A;  1HDJ A;  1BT8 A;  3K79 A;  4RO2 A;  4DV5 B;  3BRC A;  3HKC A;  4DR5 O;  2ZCE A;  2CTW A;  3E86 A;  3G80 A;  3JAR B;  2ITD C;  4E2L A;  3R65 A;  4K8X A;  1TVK A;  3CMA V;  4JTA B;  1XMO B;  4UV8 A;  2ZDI A;  3U11 A;  3TXS A;  5H2F Z;  3RYC A;  4QE7 A;  2IJH A;  5KUK A;  5IWA O;  1WA8 A;  4JI1 B;  4ABM A;  4Z2W A;  5B1B C;  2OT5 A;  4CH6 A;  3OT7 A;  3ABU A;  4TSF G;  3BCC H;  3ZHU A;  3RYI A;  1IUR A;  3T4D A;  2FYU H;  1LR1 A;  1OHH G;  1DF4 A;  1VP7 A;  2JK5 C;  5CA0 B;  5JWP A;  4NR1 A;  1G4Y B;  1B3Q A;  3ZIA G;  5LXT B;  2Y4U A;  2XT9 A;  1VQN V;  2CGN A;  4P2Z A;  4OX9 O;  2UXN A;  5J9P C;  2UU9 B;  4I55 B;  3CCR V;  5LGN A;  3D3Q A;  1YZB A;  4FLV A;  4DV1 O;  3JAK B;  2FML A;  4ZKI A;  3P3P A;  3OEH G;  2W0X A;  3ASN C;  1RFY A;  3LDD A;  4LF8 O;  1PNL A;  4UXN A;  3CE2 A;  3OAA G;  1YI2 V;  2EZO A;  1QLN A;  1K92 A;  3SYA A;  3ASO C;  5F2V O;  2XTA A;  3CRM A;  2ZE8 A;  2VQE O;  4O4I A;  3JYC A;  1Y66 A;  4DUZ O;  4LFB B;  1W0K G;  2F4V O;  3E2E A;  2OTL V;  1ZUQ A;  3OEE G;  1HW7 A;  2EIN B;  4DV3 O;  4PA7 A;  3CXC U;  2KG7 A;  3KCX A;  2WLL A;  1JFF B;  1ZX3 A;  3A0B Z;  2O57 A;  2E3C A;  2Q68 A;  1R6K A;  1XMO O;  4B08 A;  5JCO A;  2CTR A;  2GTA A;  3B8M A;  5GON B;  4YXW G;  4JI1 O;  3ZRS A;  1ORQ C;  4GLX A;  1OV9 A;  2AZ2 A;  5IJ0 A;  2P5O A;  5KA5 A;  4LF9 B;  1OJH A;  1W59 A;  4HNA A;  4UCT A;  1QVG U;  4OPA A;  3J7A U;  1IXM A;  3CRQ A;  2EZP A;  1N34 B;  3E8H A;  3MHS C;  1DK1 A;  2DWD C;  3ZS8 C;  3QG5 A;  4PI0 A;  1KEC A;  1R3J C;  4F6E A;  1YIT V;  2UU9 O;  3OGI B;  2EBO A;  1N0J A;  2AHZ A;  3ZMS A;  3O65 A;  3HKE A;  4X1Y B;  1SF9 A;  2X7R B;  3K57 A;  5J2U A;  5IY5 B;  2QM4 A;  2IJK A;  2YI8 A;  1XBL A;  4GZR B;  4UVC A;  1VQO V;  4B3R B;  3SPC A;  4KP4 A;  1PD3 A;  2X6A A;  2ZDI C;  4I50 A;  1OZ0 A;  4IGG A;  1AB3 A;  4DV6 B;  3HB3 B;  4LP8 A;  3GVM A;  4XDJ A;  2QDO A;  4JI4 O;  1MZF A;  4UCV A;  4LFB O;  4TWK A;  3LSU A;  5JQG B;  2IH1 C;  2ZR3 A;  4H0L B;  3AEI A;  4K0K B;  4LCU C;  1IBK B;  5EYP A;  5LMU B;  3UO2 A;  4AHC A;  2IM9 A;  5LGT A;  1EN4 A;  5JJJ B;  1O9H A;  4GT1 A;  4HBN A;  1BL8 A;  3WU2 Z;  2F23 A;  4X9Q A;  4JI5 B;  1D5N A;  4ZI7 B;  5JVD B;  4MTX A;  5FNV A;  1PPJ H;  1Q5O A;  1FYJ A;  2YIB A;  1MZE A;  2WAM A;  2A06 H;  3E35 A;  5C93 A;  2CAZ C;  3FAV A;  1YEW A;  4DRX B;  3ML0 A;  4LF9 O;  3N2K B;  1VF5 B;  4I5S A;  2ILM A;  5LYJ B;  1FAF A;  4FMT A;  4FIP C;  2OCC C;  1N34 O;  2ZE5 A;  2WLJ A;  3BEH A;  2BTO A;  4JV5 O;  2R70 A;  2EIK C;  1WLE A;  4JYB A;  4KHP O;  4YHH B;  3MAQ A;  1KMI Z;  2QKS A;  3UO3 A;  4IYI A;  4FFB A;  4MVQ A;  5EC1 C;  3ZMT A;  1E1R G;  2P6J A;  5B3S C;  3D36 A;  1UJW B;  1R1B A;  2XUM A;  4J7J A;  1BHA A;  5JCO C;  3GB7 C;  2ZE6 A;  4X62 B;  5EZY B;  4DV6 O;  3C3T A;  3ABL C;  1P7G A;  1SZX A;  4DR4 B;  4DV7 B;  2GBO A;  4JI8 O;  4H37 A;  4LH7 A;  1HR0 O;  1JMK C;  2EX3 A;  2Q67 A;  4G28 B;  3AK2 A;  4XDK A;  3L73 H;  1BSM A;  3CP1 A;  1TUE B;  3LUT B;  4K0K O;  2LP7 A;  1AIL A;  1IBK O;  5LMU O;  1M1K W;  4UVB A;  2YIA A;  4PEL A;  5KHH A;  4CC5 A;  2V4D A;  1PV0 A;  3QF7 A;  2YC0 A;  3FB7 C;  3AG1 B;  4JI5 O;  2UXD O;  1SQV H;  3JCU Z;  1SA0 B;  4NXM B;  1RSO B;  3N27 A;  4EKW A;  2E74 B;  4X88 A;  3OUS A;  3AK1 A;  2YXH A;  2B5U A;  3SYO A;  2P67 A;  4OPH A;  2HJF C;  2P4K A;  2PI5 A;  2JS5 A;  4UFZ A;  2QR4 A;  4JF3 A;  1M56 B;  4TQF A;  4LBE C;  3SPG A;  2ZIN A;  1I7F A;  4ASU G;  3ABM B;  2V7Q G;  2WLK A;  4CS2 A;  1P7B A;  1BHB A;  3WB2 A;  4U3F H;  3SYQ A;  1XL4 A;  5L3F A;  5LMN O;  1H2L A;  2MK3 A;  4MW8 A;  1DTO A;  5CA1 A;  4B3M O;  3CCS V;  1VQM V;  1SES A;  3ABT A;  2LGQ A;  5BZB A;  1XRE A;  1TAE A;  4P30 A;  2KB1 A;  3AG7 A;  1VAR A;  2IW5 A;  2Q73 A;  1F51 A;  3JAS A;  4FLT A;  3ZRV A;  1ZL8 B;  5KAF Z;  1GAX A;  4YJ2 B;  1RM1 C;  4DR4 O;  4CH3 A;  4DV7 O;  3T1Y B;  4X89 A;  4WBN B;  4UUJ C;  2UUA O;  4BIU A;  2EJ7 A;  4GCZ A;  3BFR A;  1XI1 A;  1V54 B;  1H2G A;  2H8P C;  2OIG A;  2YSU B;  5LHI A;  2Q69 A;  1CP9 A;  1LUV A;  1Q6U A;  2DJV A;  1J5E B;  4X64 B;  1R3I C;  1V55 B;  4YIP A;  3ZN0 A;  2PZS A;  4X65 B;  4JI3 B;  4DV0 B;  4P9O A;  5EBM C;  1Q8I A;  4EB6 A;  1R3L C;  2R72 A;  2ZE7 A;  3D36 C;  1AR4 A;  4NKG B;  3BHP A;  2YDE A;  1KUQ A;  1FPO A;  1I5X A;  4TUY B;  1PNM A;  4AQY B;  3FYE B;  2DYR B;  2XAG A;  1XOU A;  4ZHQ A;  1IBM O;  3A8T A;  3VQY A;  3QVN A;  3RW0 A;  1NQT A;  4D6T H;  3B2E E;  1N36 O;  4LFA O;  4U7N A;  4PDV A;  1SQF A;  4UV9 A;  3CCJ V;  1XEQ A;  3E22 A;  4GX5 A;  2XAQ A;  5L3B A;  1YHQ V;  4NTY A;  1L1F A;  2QM7 A;  1K9M W;  4TV9 A;  4G27 B;  5LP6 A;  4UB6 Z;  1DF5 A;  4ZIB A;  3H1I H;  4YJ3 A;  3S3W A;  4LF4 O;  1XQ8 A;  2JGD A;  4DV2 O;  3E8G A;  3IC9 A;  4C7U A;  3OMI B;  1XUQ A;  1NTM H;  1Y76 A;  1HNZ O;  1AJQ A;  4CS3 A;  2N04 A;  4TT3 G;  1GTO A;  1J95 A;  1FFX A;  3AK3 A;  2NLJ C;  2WA4 A;  3JAT A;  1MAB G;  1UPG A;  3OW2 U;  4H33 A;  4JYY A;  4X64 O;  2XAS A;  5B1B B;  3SJC C;  1URF A;  1HWY A;  1GH6 A;  4LFC B;  5GW7 A;  5BMV B;  3T1H O;  3TCU A;  4DV0 O;  4DR7 B;  3JD0 A;  5K1P A;  1AI4 A;  2JVD A;  5CB4 A;  4RUF A;  1AI5 A;  3CC2 V;  3CPW U;  1ZTE A;  1M57 C;  4X8A A;  1FXV A;  5EIB D;  1G6U A;  1XNQ B;  2QWQ B;  3RFR A;  3OD4 A;  3ICX A;  5KHJ A;  3UCS C;  1VQ5 V;  3JAR A;  2GHY A;  3K5M A;  3DXR B;  3B8N A;  2WLH A;  2XAF A;  1QLE C;  1G1X B;  1OCO C;  2FB5 A;  2BOB C;  3JD4 A;  3WG7 C;  2X0L A;  3L74 H;  4ZBM A;  4I4T B;  4LF5 O;  1D5A A;  4YY3 B;  3ZHS A;  2EIJ C;  2N05 A;  3ETE A;  1EFR G;  1H2S B;  5CA0 A;  1AI7 A;  5EBW C;  3ASO B;  5LXT A;  1HP8 A;  2WLM A;  2CE4 A;  2LW1 A;  1QNM A;  2RN9 A;  3BY6 A;  2KQX A;  5KX5 B;  1N8R W;  4H13 B;  4FZ0 A;  1I0H A;  4I55 A;  3OR7 C;  1P49 A;  1Q6I A;  5H5N A;  1EM1 A;  1BQZ A;  2Z5U A;  3ZRW B;  1YTF D;  3JAK A;  3H1J H;  2CDY A;  4X1K B;  3X2Q C;  1X59 A;  1NS1 A;  4FM1 A;  3CCE V;  1S5H C;  2XND G;  2CH7 B;  5B1A C;  2HR3 A;  4E4E A;  4GX2 A;  3RYH B;  1SRY A;  4DR6 O;  3RYF B;  3AG3 B;  4F6R B;  4DR1 O;  2VWK A;  4LFC O;  3OM3 B;  2D2C B;  3JD2 A;  5J2T B;  1I94 B;  1NVP D;  4DW0 A;  1KD1 W;  4FLX A;  2JEU A;  1ENV A;  2JS3 A;  3FYI B;  5LP6 C;  5DN6 G;  1BZK A;  3ZHQ A;  3JAL B;  1XL6 A;  3KCY A;  4N23 A;  4XDL A;  4PHZ A;  1KB9 F;  2CTP A;  1XNQ O;  1JFF A;  4DO2 A;  4KL1 A;  4MVS A;  4JZG A;  5KA6 A;  1BE3 H;  2HHH O;  5LL6 Y;  1AR1 B;  1OCC C;  5GTH Z;  4BW9 A;  1RPR A;  2CUG A;  2FL4 A;  3CCM V;  5GON A;  1KBH A;  3HKD B;  4LF6 B;  3ABK B;  4NXN B;  2QA4 V;  5DM6 V;  3SGI A;  1EZV H;  1NZ6 A;  1ZAU A;  2BTQ B;  2AHY A;  3RYC B;  4JTC B;  3B40 A;  1N33 O;  1Y67 A;  3OGC C;  1RP3 B;  1SS3 A;  3A0R A;  3U10 A;  1FJG B;  2Y69 C;  5LA6 B;  1SQP H;  3AG4 B;  1Q82 W;  1IXB A;  4DV5 O;  4FJC C;  3CRA A;  3FB6 C;  5IE9 A;  1NR7 A;  1OCR C;  3TGU H;  2HEP A;  1CXZ B;  1VQ4 V;  4X1I B;  4X1Y A;  4U3J B;  4WFB V;  4DUY B;  1PNK A;  1R6N A;  2M7W A;  1LUW A;  3ETG A;  4Q6G A;  4JYC A;  2PF4 E;  4LH6 A;  4DK1 A;  5KMG B;  5L3G A;  4WFA V;  2DE0 X;  2JDI G;  1Y4M A;  3K3W A;  2OTJ V;  2A0L A;  1YJN V;  1Q3E A;  3JD1 A;  5KAI Z;  1I94 O;  2X6C A;  4QGP A;  4AIL C;  5JQG A;  2YEV B;  1M5I A;  2PUS A;  2NNU A;  2BSK B;  4MTG A;  3IJ4 A;  3JSL A;  2HJD A;  2ITC C;  3S3X A;  4O4H B;  3QTC A;  4FZ1 A;  4J11 A;  1P84 F;  1GM9 A;  2FTK A;  4ZI7 A;  5A2Q N;  5JVD A;  4BWA A;  3JSN A;  1YIJ V;  4LWS B;  1IBL B;  4HAM A;  3OUF A;  1R73 A;  2WWW A;  2NN4 A;  4NXN O;  5BXZ A;  4RQF A;  5H6Q A;  1KP2 A;  4DRX A;  1H8H G;  3G71 V;  3N2K A;  1TUB B;  3H01 A;  5LYJ A;  1SC5 B;  3CHX A;  4J80 A;  3ABL B;  2CK3 G;  1KQS U;  2AZ0 A;  4JAS A;  3ZN1 A;  3ZRX A;  1FJG O;  2ZM6 B;  1Y74 B;  2E75 B;  3TXQ A;  4G2K A;  2ARH A;  4O4L B;  1MSW D;  2UXX A;  3K06 A;  1KKC A;  2W6I G;  3L70 H;  3HPL C;  1K33 A;  5JJN B;  1VQ6 V;  2DN9 A;  5LBQ A;  4O2B B;  3FKS G;  1WAZ A;  2UUC B;  3NR7 A;  5EC2 C;  1YTF B;  4JI6 B;  3H1H H;  3QO8 A;  1ZWI C;  3HR0 A;  3OE7 G;  2B1G A;  5EZY A;  5IYZ B;  4MSW C;  4WF9 V;  3TJT A;  1WNS A;  4CH4 A;  5A9G A;  3I5D A;  4KXR A;  4X20 B;  1NKD A;  4P9P A;  1NVP B;  4UCO A;  4MW3 A;  1AJP A;  3O9O A;  1YJW V;  2JJ1 G;  2UUB B;  3LNM B;  5IJ9 B;  1GM7 A;  4PA4 A;  1SA0 A;  2YUA A;  1RSO A;  3IC7 A;  5E79 Z;  1SER A;  4B3R O;  1WJZ A;  3MHH C;  5IY5 C;  2JJ2 G;  1QBZ A;  3THO A;  4I9Q A;  4GYC B;  2GSM B;  3D8C A;  3SPJ A;  1QCE A;  1COW G;  1L0N H;  3FFQ A;  1VQP V;  3K04 A;  5FPO A;  4JZ2 A;  2ZXW C;  5JJE B;  1NTZ H;  3K0G A;  3JCZ A;  3FB8 C;  2ZKO A;  1SZT A;  3EFF K;  5KHI A;  3T4Z A;  4PDM A;  3ZBH A;  1US6 A;  4MTO A;  4PV1 B;  2UUC O;  4Z1M G;  1AI6 A;  4XBF A;  2OIE A;  3LNN A;  2Z3Y A;  2EIL C;  4H44 B;  4ZOL B;  2OYQ A;  2RJZ A;  4PI2 A;  4X66 B;  1Q86 W;  4TV8 B;  2VQF B;  2PY5 A;  3VQW A;  2AGA A;  1ZL8 A;  4YJ2 A;  2IH3 C;  4RUE A;  4HYO A;  4FFK A;  4WBN A;  2F43 G;  4WFE A;  2PYJ A;  1B04 A;  3OR6 C;  1NH2 B;  1VQK V;  4YHH O;  1WPX A;  3E8B A;  2RCV A;  4L87 A;  2K1E A;  5DED A;  2AXT Z;  4KFM A;  4B7E A;  2UUB O;  1NTK H;  1TGO A;  3N2G B;  1Z2G A;  1O9G A;  2QTS A;  1WN7 A;  2Q4P A;  2YXY A;  3FX7 A;  4CS4 A;  1WB7 A;  2K9P A;  4X62 O;  1E79 G;  2DYS B;  1K5S A;  2OCH A;  1H2M A;  4TUY A;  5BY1 A;  2F1M A;  3CC4 V;  4BW5 A;  2ZR2 A;  5L3C A;  2BCC H;  3VQV A;  2ZD9 A;  1JCH A;  2F93 B;  1R6T A;  2Q8V A;  1N4C A;  1TA8 A;  4AI8 A;  1KC8 W;  5HFL A;  2QWN B;  3ZJZ A;  1FFT B;  1FXH A;  2BE3 A;  2H3O A;  1G8M A;  2ZNJ A;  3G6B A;  3OMN B;  3Q4H B;  4NXM O;  1VIB A;  4LNU B;  4UCU A;  3GWK C;  4J9Y B;  3HKB B;  5IYD O;  2D3O W;  1K3E A;  1NR1 A;  4B7K A;  4QNH B;  1Q6H A;  3AG1 C;  3SJB C;  1MG1 A;  1ARO P;  1MNG A;  1W0J G;  3OMA B;  4X66 O;  1IVS A;  2WPD G;  3OTO B;  4O4J B;  3TET A;  2PTM A;  5KLV H;  4MS2 A;  2WLI B;  1GK9 A;  3CB2 A;  1KP3 A;  3EXA A;  4RWU A;  1D2D A;  2GUZ B;  4K8Z A;  1MMM A;  1OCO B;  5LOV B;  3BA9 A;  3WG7 B;  1FXK B;  5H6R A;  4RQE A;  3P32 A;  2EIM B;  3RVY A;  3ABM C;  3W7W A;  3P3N A;  2WLN A;  1OCZ C;  2ZIO A;  1U97 A;  5BMV A;  3CJH B;  3AG2 B;  2EIJ B;  4DR2 B;  5E1A C;  2A7W A;  2Q6A A;  3QO7 A;  3BA8 A;  4IHJ B;  5KHG A;  1GRJ A;  3CEI A;  3ZMV A;  2ETN A;  4ICG A;  3W7X A;  3VBB A;  1NT2 B;  3C3S A;  4IIJ B;  3T1Y O;  3K5O A;  4D7S A;  2QSA A;  1V9P A;  1XIL A;  1XMQ B;  1UFI A;  3DXR A;  2XAJ A;  3T1C A;  4U7O A;  5H9C A;  2ZQM A;  5CBF A;  1BCC H;  4UCR A;  1JQ0 A;  3CWB H;  1MSD A;  5JH7 B;  5CMU A;  5LGU A;  1J5E O;  4I4T A;  3M99 B;  4FPP A;  1XNR B;  5D5Q A;  1M4U A;  4J7Z A;  1V54 C;  1PL0 A;  2X6B A;  3BAA A;  4NTX A;  4X65 O;  2WSS G;  4JI3 O;  2G38 A;  2IJI A;  4JI2 B;  5IWA B;  1T5E A;  1ROP A;  4O2A B;  1GKF A;  3I56 V;  2R9R B;  1V55 C;  3G67 A;  5KX5 A;  3CCL V;  3DTU B;  1H2K A;  1JJO A;  3KG2 A;  3OTO O;  4AQY O;  3K0D A;  1GM8 A;  1YDX A;  4J9Z B;  1QR8 A;  2QM8 A;  1S3J A;  3CCQ V;  4PJ0 Z;  4JAU A;  4Z1V A;  2HG5 C;  4NTW A;  3ZRW A;  2A3Q A;  3C90 A;  2JRI A;  4X1K A;  2DYR C;  5GTI Z;  3ZED A;  1H8E G;  5EBL C;  1OCC B;  3ASN B;  1R3K C;  3RN4 A;  5CA3 A;  2QE7 G;  2CH7 A;  1PP9 H;  5IYC O;  1JOY A;  1I08 A;  1K73 W;  3RYF A;  1KKD A;  4F6R A;  2FKX A;  1M90 W;  1FFX B;  4BIO A;  4LF8 B;  2Y0I A;  2Y4T A;  5B66 Z;  3RT3 C;  5J2T A;  4MT8 A;  3CRC A;  3QNE A;  4CBC A;  4GKK B;  4J7K A;  1Q43 A;  3JAL A;  3K58 A;  2PGG A;  1K4D C;  2VQE B;  1S0V A;  2QWO B;  1SQG A;  2ATK C;  4I0X B;  2IJJ A;  2F4V B;  1OCR B;  1JJ2 U;  1B06 A;  4DV3 B;  1S5J A;  4WFH A;  2GTS A;  1Q81 W;  5B1N A;  3UT5 B;  1QQC A;  3L9D A;  3VQX A;  3HKD A;  3LSS A;  3CME V;  3EHB B;  1VQL V;  3RVZ A;  1XNR O;  3F5W C;  4QIW F;  3JAW B;  2Y48 A;  3SPI A;  5C8Y B;  4DR7 O;  5TIS Z;  2BTQ A;  4JI2 O;  1PM9 A;  5CBG A;  1NI8 A;  2A9H A;  4BR6 A;  4IYH A;  3WB1 A;  4CH5 A;  5ITZ B;  1XHZ A;  1S76 D;  1JX9 A;  3UM7 A;  5LA6 A;  3JD3 A;  1QVF U;  4BIZ A;  3CCV V;  2ZT9 B;  3VOU A;  1JA8 A;  3CS5 A;  3L72 H;  4OXS A;  4PA9 A;  4X1I A;  4U3J A;  3SYC A;  4QPJ A;  2HP8 A;  3HKC B;  4L8J A;  2ZIM A;  1I5Y A;  1JVM A;  1EZJ A;  2YI9 A;  2IU0 A;  4N21 A;  5L3D A;  3H9V A;  1TVK B;  4LC1 A;  4FM0 A;  4YY3 O;  5KMG A;  5KHK A;  4EEQ A;  2UXC B;  5IT9 N;  2YIB D;  2LW7 A;  1XDC A;  1AVM A;  1WA8 B;  4CC6 A;  2EJR A;  4I9W A;  3SJQ C;  2QWP B;  3EVK A;  3RYI B;  1Z5V A;  3RWR D;  4UB8 Z;  2ODM A;  1W2B U;  1U96 A;  2JEX A;  4GKK O;  1Z5W A;  2YEV A;  1VF7 A;  4JPR A;  1SET A;  2BSK A;  4JI4 B;  1X4T A;  3H1L H;  1YCI A;  3L75 H;  1S5L Z;  4EFB A;  2HVJ C;  2RDC A;  4O4H A;  3B09 A;  1L0L H;  4LWS A;  1WP8 A;  1HNW B;  2NR5 A;  2PYL A;  1GO3 F;  4JI7 B;  4EFE A;  1FKA O;  3BVO A;  4WCE V;  2HKO A;  3DGE A;  4D7T A;  1TUB A;  2Q7G A;  1HNX B;  1S72 V;  4W4L A;  3FD9 A;  1F4M A;  3I55 V;  1NH2 D;  3CCU V;  2QKA A;  3AG3 C;  2OCC B;  3G6E V;  1NBM G;  1EN5 A;  1Y74 A;  1IDS A;  3SYP A;  4MVZ A;  4O4I B;  4J10 A;  3LDC A;  4O4L A;  1LNQ A;  2EIK B;  2QKC A;  3RGB A;  2YS8 A;  3G4S V;  2W0F C;  4QJF B;  1P4R A;  2W6J G;  2KSD A;  1ZLZ A;  2KG7 B;  3ZCC A;  4JV5 B;  4O2B A;  2WLL B;  1B6Q A;  4KHP B;  4UCS A;  5CN0 A;  5B3S B;  4LF6 O;  5EK0 A;  2C2A A;  1K97 A;  1SQX H;  1MOF A;  2UXC O;  2LFR A;  3SR2 C;  2DQ0 A;  5FLX N;  4FLZ A;  5IYZ A;  2RMK B;  4DR3 B;  3ABK C;  2VRZ A;  2Y0P A;  1JPX A;  5IJ0 B;  4HNA B;  1H38 A;  4X20 A;  2B9Z A;  4MVU A;  3K08 A;  1AR5 A;  2F95 B;  4JI8 B;  3M7M X;  2E76 B;  1HR0 B;  3WFV A;  2KKW A;  2EIN C;  2ZXW B;  2Z0A A;  3AG4 C;  2DMX A;  2XOK G;  1GN3 A;  4DUY O;  2L35 A;  5IJ9 A;  1WPB A;  4RAI A;  1HNW O;  4QPK A;  2H94 A;  3HKE B;  4JI7 O;  4LR3 A;  4HZ3 A;  1WP7 A;  3BPZ A;  5J2U B;  2EIL B;  3STZ C;  5FL7 G;  2UXD B;  4F4L A;  2JGU A;  1QU7 A;  1YSC A;  1HNX O;  4BAY A;  1Q90 D;  1ZSP A;  4TOI A;  2QWR B;  4I50 B;  2P7T C;  2GDS A;  1PL4 A;  1VQ9 V;  3DSQ A;  2HVK C;  2M6Y A;  2YID A;  2DOS A;  2XHB A;  2LJ2 A;  4JYA B;  4J42 A;  1N32 B;  3STL C;  4LF7 B;  3K9A A;  4DK0 A;  2XAH A;  4JI0 B;  3K03 A;  5EYP B;  5EIB C;  1GN2 A;  2BOC C;  1BS3 A;  1IBL O;  1VEW A;  1JR9 A;  1A32 A;  2Q0A A;  4MVR A;  1YXB A;  5LMN B;  4ZOL A;  3LDE A;  1K34 A;  4B3M B;  4GKJ B;  1DGS A;  4TV8 A;  2QEX V;  3APO A;  1DLB A;  5FNV B;  3T2M A;  1AP6 A;  2JIZ G;  4DR3 O;  1RM1 B;  2ZM6 O;  3FAV B;  1VF6 A;  4MTF A;  3ZHV A;  5LHH A;  2E5L B;  2WA3 A;  3ETD A;  1GN6 A;  4QE9 A;  4IT5 A;  4JTD B;  1VQ7 V;  4R8C A;  5KUM A;  5B1O A;  4PA6 A;  4FLY A;  4I7Z B;  1K4C C;  2UUA B;  4FM2 A;  1KYO F;  3OTF A;  3K5N A;  1CPY A;  3N2G A;  4WFF A;  2HFE C;  1F23 A;  1SQQ H;  4K3A A;  2CTQ A;  4PDR A;  4UVA A;  4B3T B;  4DW1 A;  4NYK A;  1VQ8 V;  4JI6 O;  4J41 A;  3M8A A;  4FFB B;  2PI4 A;  4PD4 F;  4R50 A;  2R9A A;  3E83 A;  3H1K H;  5K1X A;  2P90 A;  3CXH F;  4W4K A;  5HFM A;  3ZX6 A;  1IZ3 A;  1M93 A;  3W7S A;  1CEZ A;  3ZHR A;  3KKY A;  2CGO A;  2Q0O C;  1FS0 G;  1H2N A;  2UXB B;  5D5P A;  2IBZ H;  1EN6 A;  3B4S A;  1E1Q G;  1VMG A;  4JYA O;  1N32 O;  3FB5 C;  2Q7E A;  3MD0 A;  2QJ1 A;  1RPO A;  4LF7 O;  1IBM B;  2RQ6 A;  4JI0 O;  5FPR A;  3Q4H A;  1N36 B;  3IFX A;  4LNU A;  4LFA B;  5BR8 B;  1S77 D;  1F4N A;  1OCZ B;  3HKB A;  1THZ A;  3PJS K;  1MA1 A;  1K8A W;  3J81 N;  1GN4 A;  2EUL A;  1M9N A;  4DYL A;  4OGQ B;  3CRR A;  4FK5 C;  2P4V A;  3SPH A;  4GKJ O;  1WB8 A;  1BMF G;  1L8D A;  2HLD G;  3DC6 A;  1QHT A;  3R66 A;  2QTO A;  4O4J A;  1Y6X A;  1Q7Y W;  5IDJ A;  4WFG A;  4LF4 B;  4FLU A;  2WLI A;  5AG2 A;  5CBH A;  1AJN A;  2E5L O;  4DV2 B;  3K5L A;  2GUZ A;  3UQ8 A;  3BAB A;  3CX5 F;  5LOV A;  1FXK A;  4GX1 A;  3L71 H;  5B5E Z;  1HNZ B;  2IU3 A;  3RBZ A;  3D3I A;  4NVP A;  5DEC A;  3CJH A;  1NU1 H;  2VWJ A;  4B3T O;  4YIO A;  3F7Y C;  4IHJ A;  5CA1 B;  3J80 N;  3P30 A;  4JAV A;  2VQF O;  1M57 B;  4R6Z A;  2QGN A;  3T1H B;  4IIJ A;  2AW9 A;  1AP5 A;  1XHX A;  2DQ3 A;  3JAS B;  3CSX A;  3E89 A;  4MVM A;  2UXB O;  3APQ A;  2R9I A;  1QLE B;  3F5T A;  3WB0 A;  1M56 C;  2B1I A;  5JH7 A;  4PDL A;  1VF6 C;  2P06 A;  3NXS A; 
#chains in the Genus database with same CATH homology
 4WFH A;  1Q81 W;  1EBO A;  2ITC C;  5B1N A;  1M1K W;  4UVB A;  4PEL A;  1GM9 A;  2FTK A;  3LSS A;  3CME V;  1YIJ V;  3EHB B;  1VQL V;  3RVZ A;  3FB7 C;  3AG1 B;  3F5W C;  3OFN G;  4HAM A;  5L3E A;  4QIW F;  2A79 B;  3CD6 V;  2Y48 A;  3OUF A;  3SPI A;  1R73 A;  2WWW A;  4Q20 A;  2DWE C;  3CC7 V;  4EKW A;  4RQF A;  4R7C A;  5H6Q A;  5CBG A;  1KP2 A;  4CZZ A;  1H8H G;  3G71 V;  4X88 A;  2A9H A;  3OUS A;  3ZMU A;  3H01 A;  2V1D A;  2B5U A;  3SYO A;  1S76 D;  2P67 A;  1JX9 A;  3UM7 A;  2HJF C;  3ABL B;  2CK3 G;  3JD3 A;  4BIZ A;  1KQS U;  1QVF U;  2PI5 A;  4JAS A;  3ZN1 A;  3CCV V;  3ZRX A;  5CA3 A;  2DYS C;  3VOU A;  3TK1 A;  4JF3 A;  1M56 B;  4G2K A;  4LBE C;  4OXS A;  4PA9 A;  1MSW D;  4GX0 A;  2UXX A;  3K06 A;  3SPG A;  2W6I G;  3SYC A;  3X2Q B;  4ASU G;  4QPJ A;  1GMG A;  3HPL C;  3ABM B;  2V7Q G;  2WLK A;  1K33 A;  1I5Y A;  1JVM A;  1P7B A;  5B1A B;  1EZJ A;  4DXW A;  2IU0 A;  3IGA C;  4N21 A;  1BHB A;  5L3D A;  1VQ6 V;  5LBQ A;  3SYQ A;  1XL4 A;  3UKM A;  3FKS G;  4LC1 A;  5L3F A;  2MK3 A;  4MW8 A;  1DTO A;  3CCS V;  1VQM V;  5EC2 C;  1YTF B;  3E8F A;  3LSQ A;  3QO8 A;  1SES A;  1ZWI C;  3ABT A;  3OE7 G;  5BZB A;  5IYB O;  2EJR A;  1YJ9 V;  4I9W A;  2B1G A;  4P30 A;  2KB1 A;  3SJQ C;  4KUM A;  2IW5 A;  1F51 A;  4MSW C;  1K5Q A;  4WF9 V;  3ZRV A;  1W2B U;  2JEX A;  2YEV A;  1QR9 A;  1RM1 C;  4JPR A;  1SET A;  4JGS A;  1NKD A;  4X89 A;  4P9P A;  1NVP B;  4UUJ C;  4MW3 A;  4BIU A;  1AJP A;  2DW4 A;  4GCZ A;  2HVJ C;  3GWO A;  1V54 B;  1YJW V;  1H2G A;  3W7T A;  2JJ1 G;  2H8P C;  2YSU B;  5LHI A;  2Q69 A;  3LNM B;  1CP9 A;  1GM7 A;  1GO3 F;  3B77 A;  4PA4 A;  3CYO A;  1K7D A;  1R3I C;  1FXK C;  3IC7 A;  1SER A;  2EIM C;  1V55 B;  4PA3 A;  4WCE V;  3ZN0 A;  3W7U A;  3ZMZ A;  3MHH C;  2HKO A;  3DGE A;  3QO5 A;  5IY5 C;  4P9O A;  2JJ2 G;  1QBZ A;  5EBM C;  1PKX A;  1S72 V;  1NH2 D;  1F4M A;  3I55 V;  1NJI W;  3CCU V;  2Y69 B;  3AG2 C;  3F7V C;  3AG3 C;  2OCC B;  2GSM B;  3G6E V;  1NBM G;  1R3L C;  3SPJ A;  1QCE A;  1COW G;  3SYP A;  4MVZ A;  2LFS A;  1I5X A;  4MVO A;  1PNM A;  3LDC A;  1VQP V;  1LNQ A;  2EIK B;  3FYE B;  3K04 A;  2DYR B;  5LHG A;  2XAG A;  3K79 A;  4RO2 A;  3G4S V;  2ZXW C;  3K0G A;  3JCZ A;  3FB8 C;  1SZT A;  2W0F C;  1NQT A;  1P4R A;  3E86 A;  3EFF K;  2ITD C;  3RW0 A;  4QJF B;  2W6J G;  4E2L A;  3R65 A;  3ZCC A;  2WLL B;  4U7N A;  4PDV A;  4JTA B;  3CMA V;  1B6Q A;  4UV9 A;  3T4Z A;  3CCJ V;  4PDM A;  4UV8 A;  4GX5 A;  5CN0 A;  2XAQ A;  4MTO A;  5B3S B;  5L3B A;  1YHQ V;  2ZDI A;  5EK0 A;  2C2A A;  1K97 A;  4QE7 A;  2IJH A;  1MOF A;  4Z1M G;  1AI6 A;  4XBF A;  5KUK A;  1L1F A;  2LFR A;  2QM7 A;  2Z3Y A;  2EIL C;  5B1B C;  2OT5 A;  2DQ0 A;  1K9M W;  3ABU A;  4G27 B;  4TSF G;  1DF5 A;  3ABK C;  1Q86 W;  3T4D A;  1JPX A;  1OHH G;  1DF4 A;  2IH3 C;  4RUE A;  2JK5 C;  1G4Y B;  1H38 A;  3ZIA G;  4HYO A;  3E8G A;  4MVU A;  3K08 A;  2F43 G;  4WFE A;  3OMI B;  3OR6 C;  1NH2 B;  3WFV A;  1VQN V;  1VQK V;  2ZXW B;  2EIN C;  1WPX A;  4P2Z A;  3AG4 C;  2UXN A;  3E8B A;  5J9P C;  2XOK G;  1AJQ A;  3CCR V;  4L87 A;  5LGN A;  2K1E A;  4TT3 G;  1GTO A;  4KFM A;  1J95 A;  2NLJ C;  4RAI A;  1MAB G;  4ZKI A;  4QPK A;  3OW2 U;  2H94 A;  3OEH G;  4H33 A;  3ASN C;  4HZ3 A;  2XAS A;  3LDD A;  2EIL B;  5B1B B;  1PNL A;  3STZ C;  4UXN A;  5FL7 G;  1HWY A;  4F4L A;  5GW7 A;  1YSC A;  3OAA G;  3TCU A;  1YI2 V;  2EZO A;  3JD0 A;  1AI4 A;  4BAY A;  4RUF A;  1AI5 A;  1E79 G;  1QLN A;  3CC2 V;  2DYS B;  1K5S A;  1K92 A;  3SYA A;  3ASO C;  1M57 C;  3CPW U;  4X8A A;  1FXV A;  3JYC A;  1Y66 A;  2P7T C;  3CC4 V;  4BW5 A;  1VQ9 V;  2HVK C;  1W0K G;  3E2E A;  2OTL V;  2ZR2 A;  3OEE G;  3STL C;  5L3C A;  2EIN B;  1VQ5 V;  4PA7 A;  3CXC U;  2ZD9 A;  1JCH A;  2GHY A;  3K9A A;  2WLL A;  3B8N A;  2WLH A;  2XAF A;  2XAH A;  3K03 A;  1QLE C;  1OCO C;  1KC8 W;  2BOB C;  3JD4 A;  3WG7 C;  2BOC C;  5HFL A;  2Q68 A;  3ZJZ A;  2X0L A;  1R6K A;  1FFT B;  4ZBM A;  1FXH A;  3OMN B;  1G8M A;  4MVR A;  3B8M A;  4J9Y B;  3LDE A;  1K34 A;  4YXW G;  5IYD O;  3ZRS A;  2EIJ C;  2D3O W;  3ETE A;  2QEX V;  1K3E A;  1NR1 A;  1ORQ C;  4QNH B;  3AG1 C;  1DLB A;  1MG1 A;  1ARO P;  1EFR G;  3T2M A;  2JIZ G;  1W0J G;  3OMA B;  5KA5 A;  1RM1 B;  1QVG U;  1AI7 A;  5EBW C;  3ASO B;  2WPD G;  2WLM A;  4MTF A;  3BY6 A;  1IXM A;  2EZP A;  5LHH A;  3TET A;  3ETD A;  4QE9 A;  4JTD B;  1VQ7 V;  4R8C A;  1N8R W;  3E8H A;  3MHS C;  5KUM A;  4MS2 A;  2WLI B;  2DWD C;  1GK9 A;  5B1O A;  4PA6 A;  1KP3 A;  3OR7 C;  1K4C C;  1KEC A;  1R3J C;  1YIT V;  1OCO B;  2Z5U A;  3ZRW B;  3WG7 B;  1FXK B;  2AHZ A;  2EBO A;  5H6R A;  4RQE A;  1CPY A;  3ZMS A;  3P32 A;  1YTF D;  4WFF A;  2HFE C;  2EIM B;  1F23 A;  3X2Q C;  3RVY A;  2X7R B;  3ABM C;  4PDR A;  4UVA A;  3W7W A;  3CCE V;  2WLN A;  1S5H C;  5IY5 B;  2XND G;  1OCZ C;  2IJK A;  2HR3 A;  5B1A C;  1VQ8 V;  4GX2 A;  2PI4 A;  1SRY A;  2EIJ B;  3AG2 B;  3AG3 B;  4UVC A;  4R50 A;  3E83 A;  1VQO V;  5E1A C;  2P90 A;  3SPC A;  2Q6A A;  3QO7 A;  4KP4 A;  1PD3 A;  2X6A A;  3OM3 B;  2ZDI C;  5HFM A;  3W7S A;  1CEZ A;  3JD2 A;  1OZ0 A;  3ZMV A;  3W7X A;  3VBB A;  1NVP D;  1KD1 W;  3HB3 B;  4LP8 A;  2JEU A;  4XDJ A;  1FS0 G;  1ENV A;  3FYI B;  5DN6 G;  4TWK A;  1XL6 A;  4XDL A;  4N23 A;  1E1Q G;  2IH1 C;  2ZR3 A;  2XAJ A;  3T1C A;  4U7O A;  5H9C A;  4DO2 A;  2ZQM A;  3AEI A;  3FB5 C;  5CBF A;  4MVS A;  3MD0 A;  4LCU C;  1RPO A;  5KA6 A;  1JQ0 A;  5LGT A;  1AR1 B;  5CMU A;  5LGU A;  4GT1 A;  1BL8 A;  3M99 B;  1OCC C;  1S77 D;  3IFX A;  4FPP A;  1F4N A;  1RPR A;  1OCZ B;  3CCM V;  1V54 C;  1PL0 A;  2X6B A;  1THZ A;  3PJS K;  2WSS G;  3ABK B;  1K8A W;  4MTX A;  1M9N A;  2IJI A;  2QA4 V;  5DM6 V;  4FK5 C;  3SPH A;  1BMF G;  1ROP A;  2WAM A;  1GKF A;  3I56 V;  2R9R B;  3E35 A;  2HLD G;  1V55 C;  2AHY A;  5C93 A;  4JTC B;  3ML0 A;  3OGC C;  2QTO A;  3CCL V;  3DTU B;  1Q7Y W;  5IDJ A;  3A0R A;  4I5S A;  4WFG A;  3KG2 A;  2Y69 C;  4FIP C;  2WLI A;  4FMT A;  5CBH A;  2OCC C;  3AG4 B;  1AJN A;  1Q82 W;  3K0D A;  1GM8 A;  4J9Z B;  1QR8 A;  2QM8 A;  4FJC C;  1S3J A;  2WLJ A;  3FB6 C;  3CCQ V;  3BEH A;  4JAU A;  1NR7 A;  1OCR C;  2HG5 C;  3ZRW A;  1FXK A;  4GX1 A;  1VQ4 V;  2EIK C;  1WLE A;  4JYB A;  2DYR C;  4WFB V;  2QKS A;  2IU3 A;  1H8E G;  5EBL C;  1OCC B;  1PNK A;  1R3K C;  1R6N A;  3ASN B;  3RBZ A;  2QE7 G;  2M7W A;  3D3I A;  5IYC O;  4MVQ A;  3ETG A;  1JOY A;  5EC1 C;  4JYC A;  1K73 W;  3ZMT A;  1KKD A;  1E1R G;  2P6J A;  3F7Y C;  1M90 W;  5B3S C;  3D36 A;  5L3G A;  4WFA V;  1UJW B;  3P30 A;  4JAV A;  2JDI G;  1M57 B;  1Y4M A;  3K3W A;  4R6Z A;  2OTJ V;  2A0L A;  1BHA A;  4MT8 A;  3GB7 C;  1YJN V;  3QNE A;  4CBC A;  3JD1 A;  2DQ3 A;  2X6C A;  3ABL C;  1K4D C;  1S0V A;  3E89 A;  4H37 A;  2Q67 A;  4MVM A;  4G28 B;  4XDK A;  2YEV B;  2R9I A;  2ATK C;  1QLE B;  2IJJ A;  1M56 C;  1OCR B;  1JJ2 U;  2NNU A;  4MTG A;  2B1I A;  3CP1 A;  4PDL A;  1TUE B;  3LUT B;  2LP7 A;  3NXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...