2A9HA

Nmr structural studies of a potassium channel / charybdotoxin complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance structural studies of a potassium channel-charybdotoxin complex.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport, membrane protein
molecule keywords Voltage-gated potassium channel
total genus 32
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2a9hA00
3T2MA 2WLIB 2AHYA 4RUFA 5CBHA 4H37A 4QE7A 4GX5A 3E89A 5EBLC 2WLKA 4P30A 4G28B 3RVYA 2HG5C 4WFEA 3AG3C 4I9WA 3ZRSA 4GX1A 4DXWA 2ITCC 3OGCC 5EK0A 3RVZA 3FB7C 4J9ZB 4R6ZA 4WFGA 2ZXWC 2R9RB 4RUEA 1XL6A 5EBWC 4CBCA 2X6AA 2KB1A 4PA7A 2HVKC 2A9HA 2ITDC 4WFFA 2A79B 2EIKC 3OR7C 4PDLA 3RW0A 2HVJC 2WLNA 3F7VC 4RO2A 2DYRC 1J95A 3BEHA 3ASOC 1LNQA 4MW3A 3RBZA 1JVMA 1OCRC 2WLLB 4LCUC 3WG7C 3T4DA 5CBGA 2EILC 1V54C 4MTFA 4PDMA 4ZBMA 4R7CA 2WLJA 4X89A 4MVQA 1M57C 5KUMA 3ASNC 4H33A 2A0LA 2AHZA 3SPCA 1ZWIC 3TCUA 3K08A 1ORQC 2ATKC 4QNHB 3ABMC 3F7YC 1OCZC 4MS2A 3UM7A 1V55C 2HJFC 2WLLA 3OR6C 5B1BC 3SPGA 1M56C 5E1AC 3KG2A 3K0DA 4JTDB 1R3JC 3LDEA 3AG4C 4MVRA 3SPIA 4X88A 3STZC 3LNMB 4UUJC 4OXSA 2BOCC 2EINC 3K04A 3SJQC 3HPLC 4R50A 3AG2C 3ABKC 4MVMA 4G27B 4P2ZA 5B3SC 4WFHA 3PJSK 1K4CC 4J9YB 4BW5A 5EC2C 1KKDA 5J9PC 2EIJC 2Q68A 2YEVA 4PA6A 5IY5C 4R8CA 1R3KC 1G4YB 3GB7C 4LP8A 3STLC 4PA4A 2Q69A 3IFXA 1S5HC 2IH3C 3K03A 3E83A 3EFFK 4PA9A 2Q67A 3E8GA 1R3IC 2EIMC 3SYCA 2BOBC 2HFEC 3SYPA 3SYOA 3X2QC 3SPJA 4EKWA 3E86A 3OUSA 4X8AA 5EC1C 3T1CA 4TWKA 1P7BA 5CBFA 3FB5C 2DYSC 5B1AC 3FB6C 2K1EA 2X6CA 4JTAB 3TETA 2IH1C 3JYCA 4HYOA 2DWEC 4PDRA 3F5WC 3OUFA 4MVOA 2P7TC 2ZD9A 3E8FA 2W0FC 4XDJA 4MVSA 4XDKA 3VOUA 3E8HA 3SYAA 2Y69C 4F4LA 4KFMA 4HZ3A 3LDCA 5KUKA 4RAIA 4P9OA 1BL8A 2H8PC 3E8BA 4PA3A 2JK5C 1OCOC 3K0GA 5BZBA 3UKMA 4QE9A 1QLEC 2QTOA 4MVUA 2Q6AA 5EBMC 4MW8A 4GX0A 1K4DC 4P9PA 3FB8C 4MVZA 3ZJZA 1OCCC 2OCCC 2WLMA 2QKSA 3LDDA 2DWDC 2X6BA 3ABLC 3T4ZA 3LUTB 4MTOA 4PDVA 1XL4A 4JTCB 2NLJC 3AG1C 4XDLA 3SYQA 2WLIA 3K06A 3SPHA 3R65A 2WLHA 3IGAC 4LBEC 4GX2A 4MTGA 4MSWC 1R3LC
chains in the Genus database with same CATH superfamily
1QLEB 4Z1VA 1FXKC 1FFTB 5H2FZ 2Q0OC 2N74A 2UXXA 2YC0A 4B3MO 4IT5A 1UPGA 4C7UA 4RUEA 3OMAB 5B1NA 2OTLV 3RGBA 4H0LB 4FLZA 2OIEA 1AI7A 3CC4V 3BEHA 4O4JA 1OCRC 3CC2V 3DSQA 2ARHA 3GWKC 4DUZB 4BIUA 3JATB 5LHGA 5IDJA 4JI7B 2DJVA 4MS2A 1TGOA 5IJ0A 1PKXA 4H13B 1M9NA 2ZE5A 4JAAA 1BHBA 3LDEA 4IGGA 2JRIA 5H6RA 3P30A 2CDYA 3G6EV 1RPOA 4R50A 4G27B 4X1KB 1VQOV 2QA4V 4UVCA 4X64B 3ZS8C 4BR6A 3CCSV 3X2QC 1Q7YW 4TWKA 4KHPB 1H2KA 2FB5A 5LOVA 1F23A 5JQGB 2JGDA 3SYAA 4KFMA 1MSDA 2H8PC 3E8BA 4PA3A 2PYLA 1URFA 2VQFB 1HNXO 4FIPC 2F1MA 2VQEO 2G38A 1FXKA 3O65A 1VF7A 3IC7A 1K33A 3LDDA 5IWAB 4YHHO 2CGOA 1I7FA 4QGPA 2CK3G 1M4UA 3FX7A 1AR4A 1WB7A 4DV1O 4JYYA 1ZL8A 1WLEA 1ZSPA 1Q8IA 1KECA 4G28B 1NZ6A 4Q20A 4DV5O 4WFEA 5C8YA 1M57B 2VRZA 3BRCA 1SA0A 1Q6IA 5JJNB 3CYOA 2KB1A 4PA7A 1IBKO 4IHJB 1N4CA 3DGEA 5K1PA 1FJGO 1S76D 4FFBB 4JYAB 3ASOC 3ZHUA 4DV2B 2JEXA 2GTAA 2OYQA 4LH7A 2EJRA 4I9QA 3UM7A 1T5EA 1YIJV 2E3CA 4X65O 3K0DA 3STZC 5LBQA 1KP2A 1HNWB 2PI5A 3JARA 3RYIB 3MD0A 1R6TA 1YSCA 2DOSA 5B5EZ 5EC2C 3PN1A 2F66C 1N32B 4O4IB 1BQ0A 3EFFK 1WP8A 1NTZH 2UUAO 4GZRB 4B3MB 4X8AA 1I94B 2R9AA 5HFLA 2Y48A 1SERA 2QWQB 5TISZ 2ZINA 2B9ZA 1XI1A 4MT8A 4F6RA 2EILB 2EIJB 2P7TC 1SQXH 1IXMA 4YJ2B 4DW1A 4AHCA 2P67A 4DR2B 2JK5C 3K0GA 3OT7A 2GDSA 2DE0X 3SR2C 5L3CA 2WWWA 2X6BA 3ZBHA 1GK9A 3J81N 2XOKG 3HKEB 4K35A 1I94O 3K06A 3DTUB 1AROP 3ZRXA 3WB1A 2EBOA 1OCOB 3M8AA 1JPXA 3H1KH 4O4HA 5D5PA 1HW7A 4GX5A 1Q6UA 4UV8A 3AK3A 1Q43A 5EK0A 3U11A 3ABMB 2WPDG 2X6AA 2Z3YA 4YJ3A 4EB6B 3T1YB 2DN9A 1Z5WA 4J7KA 4I50B 1WB8A 4JPRA 3RFRA 3DXRA 3RYFB 3TK1A 2QM4A 4TV9A 1U97A 2QKAA 4X89A 5J2UA 1DLBA 1HNXB 3EHBB 2YIDA 5LHHA 1Z2GA 5JVDA 3KG2A 4MVRA 3MHSC 2JEUA 2Q0AA 5LA6B 2YIBD 2YS8A 3ABKB 5EYPA 4DK0A 5CB4A 1NJIW 1SQBH 3I56V 3SYCA 4CS3A 2ZM6B 3SPJA 2VS0A 1K3EA 2Z5UA 4NR1A 1H2LA 1KUQA 4PDRA 1Q6HA 3OUFA 1DTOA 1QNMA 4TUYA 5A9GA 1QQCA 4ZHQB 4F4LA 1VQPV 1JJ2U 1MOFA 1VF6A 1BL8A 2YUAA 4FLTA 4FM0A 4UB8Z 4KHPO 4LFBO 1A32A 2CTWA 3K79A 3APQA 4O2BA 3L73H 4WCEV 4MVZA 2V1DA 4PHZA 2ETNA 1PL4A 3TJTA 2QWOB 2ZIMA 3BCCH 2UXCO 3CSXA 3TXQA 1G1XB 1NT2B 4FK5C 4BIZA 1FXVA 5LHIA 2K9PA 2QSAA 1AI4A 2YXLA 2RCVA 5IYZA 2V7QG 5JVDB 5KA5A 3UCSC 1SC5B 3I5DA 5L3EA 2NN4A 4I9WA 3ZMZA 3APOA 2ZXWC 2N04A 3G6BA 4DUZO 3OMNB 1TA8A 1H2MA 4X66B 1K5SA 3K9AA 1M93A 4TQDA 1V54B 1D2DA 4N21A 2EILC 1F7YA 1GN2A 4R7CA 4FLXA 2FYUH 1VQKV 3FYIB 4CC5A 4QNHB 3N2GA 1TUBA 4CC6A 1N34O 1F51A 2GBOA 3CWBH 1FYJA 4E4EA 4DV2O 5BXZA 2JJ1G 2RQ6A 1OCRB 3K04A 3UO3A 3BY6A 1SS3A 1PPJH 5LGNA 3HKDB 4BW5A 3FKSG 4J7JA 4JYBA 3TXSA 1BCCH 4JGSA 3E83A 4PA9A 1EN4A 4FLWA 5EIBC 1R1BA 3SYPA 2NR5A 2XUMA 3T1YO 1K92A 1TUEB 2HHHB 4FLVA 2DYSC 2P22C 1S0VA 3JALB 2VQEB 5B1AB 3T1HB 1MZFA 2CE4A 5CA1A 2W0FC 4YHHB 3ZRWA 4UXNA 2H94A 2QR4A 4UCTA 3W7XA 5BZBA 4O2AA 4MVUA 1Q90D 5JJEB 2FTKA 3ZJZA 4YY3O 1H8HG 2P6JA 1IBLB 3ABTA 3SGIA 4XDLA 4YIOA 2PYJA 2ZNJA 4MSWC 1R3LC 4J11A 4NXNO 1OJHA 1NR7A 3P3NA 1WN7A 1Q82W 3CJHA 1NS1A 2UXDO 4JYAO 4FPPA 1J5EO 5IYDO 3D8CA 4X65B 1YDXA 3JCZA 4L8JA 4X1YA 4R6ZA 3OE7G 4DV4B 2P06A 2H3OA 1W2BU 1L0LH 2LP7A 3QO7A 1CEZA 4CH5A 2PTMA 3RW0A 1W0KG 4DK1A 4G2KA 5IYCO 5JH7A 1KQSU 5KUMA 1B04A 2IU3A 1VP7A 3TCUA 2D3OW 1US6A 3FFQA 1JFFA 4NTXA 1N0JA 1OCZC 3G80A 3SPIA 2EULA 4BAYA 3OFNG 2EINC 4DUYO 1KP3A 3SJQC 4GKJO 1DGSA 3HPLC 1F4MA 2IBZH 2QWRB 3PJSK 2Q68A 1GM7A 4R8CA 3GB7C 2RMKB 4UCVA 1EBOA 1EN6A 2QKCA 1M56B 3E22A 3FYEB 3LSQA 4LF6B 1IXBA 5IE9A 2BOBC 3OUSA 3B8MA 2MW2B 1TVKA 4CH4A 3E22B 1AB3A 3TETA 4GKKO 2YXYA 3W7UA 3K5OA 3JSNA 4HYOA 3G71V 3JD2A 3JASA 1WPBA 3ZMUA 4CS2A 3JAWB 3ZHTA 5LOVB 1FFXB 2YICA 1BZKA 2W6JG 1BT8A 4DR7B 5IWAO 4KP4A 3QTCA 4LR3A 1VEWA 2HKOA 3ETDA 3SPHA 2HEPA 1YHQV 2XAJA 3VQYA 5JCOC 2AZ0A 3SJBC 2R9IA 4E2LA 3CCEV 5KX5B 4FZ1A 5BMVA 4EFEA 1KC8W 1ROPA 2QGNA 5EBWC 4TUYB 3ZHQA 2RJZA 1CP9A 2Q73A 4X62B 2CTRA 5GW7A 1KD1W 3OR7C 4K0KO 1TAEA 1K5QA 3AEIA 1YITV 2YXHA 3OGIB 4JI0B 2NNUA 4U7OA 2YI8A 4LF9O 2Q7HA 1N33B 4MTFA 4DRXB 2M7WA 2WLJA 2QE7G 3JASB 1BS3A 1YZBA 1DF5A 1LUWA 3ZRVA 1NKDA 1V55C 2FMLA 5BY1A 4IIJB 4AI8A 2BTOA 3Q4HA 4DR3O 4LWSA 3S3WA 1I5XA 5LMNO 4IIJA 5EZYA 3UT5A 3AG2C 2OT5A 5B3SC 2UUAB 4PA6A 3A8TA 4UB6Z 4ZI7A 1Y74B 5J2TA 4B3SB 4UV9A 2IH3C 3JALA 4B7EA 1AR1B 1WPXA 2UU9B 2CH7B 2ZCEA 2P5OA 3K3WA 2F4VO 3AG3B 4X9QA 5AG2A 3G67A 2ZR3A 1WJZA 4JF3A 1YTFD 1H2NA 3UQ8A 4LNUA 1N36O 2Y4UA 3WB2A 3TGUH 4LFAB 1IBMB 5KHIA 3ZN1A 2BSKB 5C93A 2WLMA 2QKSA 3P3PA 1EN5A 1K7DA 2WLIA 1W0JG 4L87A 1KMIZ 2HP8A 4LBEC 4W4KA 4B3RB 1LR1A 4NB5A 4WFAV 5CBHA 2IJHA 2DYRB 3ZHVA 3RVYA 4DO2A 4LFAO 2O57A 1NH2D 3DC5A 2XAGA 2YEVB 4U3FH 3H01A 4CH6A 4DR5B 5LL6Y 4PV1B 1N8RW 2BTQA 4GCZA 2VWKA 2DYSB 3H1JH 3J7AU 3ZMVA 4DV6B 4LH6A 2BTQB 3H1HH 4DV4O 4DR7O 5GTIZ 1PNMA 2L35A 1MNGA 5HFMA 1XEQA 2HJDA 5CA3A 1SZXA 1P4RA 1QVFU 2ADPA 3JD0A 3LNMB 1YXBA 1EZVH 1Q3EA 1GKFA 4MVMA 3ASNB 1SZTA 1M90W 3HKDA 5J9PC 4DV0O 2UXNA 5IY5C 5B1OA 5KA6A 3L9DA 1P7GA 3CXHF 2JS5A 4X20A 2OCHA 1SESA 1P7BA 1K9MW 2JIZG 1FFXA 2UUCO 3BAAA 1YTFB 4X1IA 1KBHA 1AR5A 2F95B 2CTQA 2DWEC 4D7SA 1HP8A 3I55V 1XHXA 3E8FA 1IBLO 5CA1B 4UCOA 3SDLA 5LMUO 3KZIZ 1OCOC 1GM8A 3RN4A 4PI0A 1E1RG 4MW8A 1GM9A 4P9PA 3W7WA 3CXCU 1FAFA 3A0BZ 3W7SA 1AP5A 2VWJA 3FAVB 3OTOB 1VQLV 1ZUQA 4YIPA 1U96A 2WLKA 3HKBA 2HG5C 1EM1A 3AG3C 3JAMN 4GYCB 2EJ7A 1X59A 2YIBA 3OGCC 1XBLA 5JQGA 2D2CB 4UCUA 4DR6B 1CPYA 3RYCB 3IJ4A 1H2SB 2XASA 4JI3O 2XAFA 1Y76B 4X66O 1Q86W 4NYKA 1H38A 3A2FA 3OAAG 4H33A 3CCUV 4NTYA 1DF4A 4JI2O 3K08A 4ASUG 1QHTA 3CHXA 1JFFB 3VQWA 2HJFC 2WLLA 1I0HA 1DK1A 1XILA 1JCHA 3AG4B 3K5MA 2OWOA 3EXAA 2GHYA 1GAXA 1SETA 4D7TA 4GUNA 2KQXA 5LGTA 5KAIZ 3OW2U 1B6QA 4RQFA 4JI4O 2LGWA 4X1IB 4JTAB 5DEDA 4NTWA 4KL1A 2UXBB 2WA3A 3AK2A 4H44B 4CS4A 4DV3O 2EX3A 1RSOA 4XDKA 1AILA 3JAKB 3DXRB 2F4VB 1QLEC 1GTOA 1Y4MA 4GX0A 1JJOA 2ZKOA 5FPOA 3S3XA 4K0KB 2LFRA 2QM8A 4FFKA 5KHHA 2ZDIA 1CXZB 3IGAC 2XTAA 2PF4E 2BSKA 4UCSA 2Q9LA 1XNRB 2AHYA 3IC9A 4H37A 5CA0B 3KCXA 4DV3B 4PJ0Z 4P30A 3ZCCA 1ENVA 3FB7C 1AJNA 1I5YA 3CMEV 4YJ2A 2WLNA 5BR8O 1R6NA 4KUMA 1IDSA 2E5LB 3ASNC 4DR5O 1PD3A 4JAVA 1L1FA 2ZXWB 3F7YC 5IY5B 1IZ3A 1TVKB 1HWYA 4UCRA 5CN0A 1L8DA 4IL6Z 5L3DA 2Z0AA 1O9GA 1X4TA 3OTOO 2R70A 5GONB 4ABMA 3RYIA 3OM3B 1NR1A 3B2EE 1K4CC 3WFVA 2XNDG 4DUYB 1QVGU 3C3TA 5B3SB 3N2GB 1ZTEA 1MZEA 4LNUB 2UUBB 2HFEC 4CZZA 4EKWA 3SJCC 4Z2WA 5ITZB 3JSLA 3E86A 4FZ0A 4HNAB 4JI7O 4I50A 2CH7A 5CBFA 4W4LA 4DR1O 3JD3A 2AZ2A 1AJPA 1ZLZA 4I7ZB 3QO8A 1KB9F 3K57A 3E8HA 4NVPA 2Y69C 2UUCB 4U7NA 2P4KA 2Q6AA 2Q8VA 4JASA 2IJKA 4WBNB 3G4SV 1FXHA 5EZYB 3UT5B 2L6LA 3LUTB 3C90A 4BWAA 3JATA 1XNRO 2YSUB 3RYHB 1XREA 4Z1MG 1QR9A 4GX2A 4J10A 1NVPB 2E76B 2W0XA 1AI5A 3L74H 4X20B 4AQYB 4JI6O 4DXWA 1Y6XA 2JGUA 5H5NA 2QDOA 5LYJB 4LF4O 1MA1A 4LF9B 4ICGA 4Q6GA 1VQ6V 2KG7A 3F7VC 4DV0B 2EZOA 1MABG 1XMQO 1WP7A 4O4LA 1BQZA 2AGAA 1PNKA 4BW9A 3JAWA 5IJ0B 5B1BC 4JAUA 2LO1A 1R3JC 4QIWF 4UUJC 1FPOA 5IYBO 2YI9A 1IVSA 5IYZB 1KKDA 2EIJC 2QM7A 2YEVA 2UU9O 1IURA 4DV7O 1MMMA 4QJFB 3E8GA 1R3IC 2LW7A 3T1CA 4J41A 1YJNV 4DR4B 3FB6C 2K1EA 3HB3B 2ZE8A 1NU1H 2IH1C 4JZGA 3JYCA 1Q5OA 1ZX3A 3R66A 1SA0B 3CPWU 4FM2A 1JR9A 2E5LO 1K34A 3NR7A 2F43G 5KUKA 4U3JA 4QE9A 3JD1A 4TT3G 4N23A 3ZHRA 1VIBA 2WAMA 2M6YA 1XL4A 3AG1C 2N05A 5EYPB 4RWUA 5LXTB 1BSMA 2WLHA 2GUZB 1KYOF 4GKKB 1SQQH 4F6RB 3BHPA 1BHAA 3T2MA 2WLIB 4I55A 5H6QA 1FKAO 5EBLC 4IYIA 3ABLB 4XBFA 2HLDG 3RWRD 1YF2A 4DR2O 1HR0B 4ZI7B 2XT9A 3K58A 4JI2B 4FM1A 2A9HA 2ITDC 2MK3A 4TV9B 1GN4A 2X0LA 1RFYA 1LNQA 4MW3A 1JVMA 2Q7GA 3T4DA 1V54C 3O9OA 4PDMA 1M57C 5KMGB 1HDJA 3CCJV 1ZWIC 4B3TB 4UVAA 2DQ0A 5IJ9A 2QTSA 3KKYA 2IJIA 1M56C 3QF7A 4X88A 2KKWA 1HR0O 5FLXN 5CA0A 1AVMA 3BPZA 1M1KW 1BE3H 1KKCA 4FJCC 1R6KA 5D5QA 1SQVH 2LW1A 3K5NA 4DV1B 4JV5B 5GTHZ 1G4YB 3HKEA 4O4IA 4JI0O 4PD4F 4JI6B 1S5JA 4AQYO 5KX5A 1YVWA 3L75H 4LWSB 1VMGA 4B3TO 5L3GA 3FB5C 3A0HZ 4JI8B 1XUQA 4PI2A 2OIGA 2PY5A 5E79Z 3ETEA 1FJGB 5LP6C 4JI5O 1JA8A 3VOUA 4J42A 3AG7A 3LDCA 4RAIA 1XMQB 4LF8B 1XNQB 2IM9A 3CCLV 2QTOA 1QR8A 1QBZA 5EBMC 5KLVH 4FVMA 4YXWG 4B3SO 1Q81W 2DWDC 2DMXA 3RYCA 1P84F 1VQ9V 2NLJC 1VF5B 1V55B 2RDCA 4JI8O 2LFSA 1Z5VA 1SQPH 2AW9A 3ETGA 1NQTA 4OPHA 4JZ2A 1OHHG 1FD9A 4QE7A 4LF6O 5EIBD 1GO3F 5BR8B 3UO2A 1G8MA 4DV7B 3ZRSA 4GX1A 1RPRA 4J9ZB 3J80N 1N33O 3H9VA 1RSOB 3ZX6A 3BABA 1S77D 3OEEG 3OTFA 2FL4A 2DQ3A 2DYRC 3D36C 3RYFA 3K59A 4DR3B 4LCUC 4ZBMA 2Q4PA 3ASOB 3SJAC 1HNZO 1JMKC 3SPCA 4UFZA 4GT1A 2ATKC 1XMOO 1LUVA 3HKBB 3C3SA 1OZ0A 3IAYA 4OXSA 3ABUA 1RP3B 2XAHA 2ZR2A 1SRYA 3QVNA 1WA8A 2ODMA 1R3KC 5CB4B 3U10A 3K5LA 3IFXA 1S5HC 5C8YB 4YY3B 2EIMC 4TV8A 2EIKB 2LQTA 4JI5B 5JH7B 1VARA 4FMTA 3KCYA 5LP6A 4NXNB 4FFBA 1AJQA 4LFBB 3B77A 2C2AA 4KXRA 4HZ3A 1K8AW 4TSFG 1MG1A 5B1BB 3CCVV 2PZSA 1AI6A 1O9HA 3B8NA 4TV8B 3T4ZA 4U3JB 5JWPA 3W7TA 3B4SA 3LSUA 1E1QG 3T1HO 5ITZA 2LJ2A 3QNEA 2OTJV 1YJ9V 1OV9A 5KAFZ 4O4LB 3RVZA 4DV6O 4I0XA 2R9RB 3A0RA 1Y66A 4I5SA 5JJJB 2Q5ZA 5LYJA 1PV0A 2A79B 4PDLA 1VQ5V 2RN9A 1YEWA 4I4TA 1XHZA 2IJJA 1Y67A 1XDCA 4NXMB 5LGUA 1PNLA 3OEHG 2CUGA 3CCMV 4WFBV 5GONA 3U0ZA 3CX5F 1E79G 2Y0IA 2ZIOA 4TQFA 5DM6V 2BOCC 3H1LH 3QO5A 4ZIBA 1NTKH 3ABKC 5KHKA 2GTSA 5DECA 4LP8A 2WSSG 1GH6A 4PA4A 1Y74A 3FD9A 2HHHO 4EFBA 2RNBA 3F5TA 3LNNA 1PP9H 1S3JA 1SQFA 1QU7A 5F2VO 2LGQA 5B1AC 4J7ZA 4K8ZA 2Y4TA 5LP6B 1FS0G 3P32A 3CP1A 3ZMTA 2GUZA 2FKXA 5KMGA 4P9OA 5DN6G 2P90A 2WA4A 4OX9O 1B3QA 1N34B 2YIAA 2CGNA 1XMOB 4A5UB 4X62O 1D5AA 2F23A 3HKCB 3OMIB 1W59A 3NXSA 3R65A 2ZDIC 4EB6A 3ZRWB 3ZN0A 2B5UA 2BE3A 2P4VA 3CS5A 4RUFA 1D5NA 4DR6O 4BIOA 1JX9A 2CTPA 4JI1O 4NKGB 4LF7B 3WB0A 4JI3B 3CMAV 2PGGA 4DV5B 4B08A 3JARB 4ZOLA 4EEQA 2EIKC 1WNSA 2ILMA 1EFRG 1QCEA 3MDSA 3L71H 2HVJC 3DC6A 4I4TB 4QPJA 5K1XA 1J95A 3GWOA 4O4JB 4LF4B 3MAQA 1I08A 2WLLB 3WG7C 1VQMV 3AG2B 1H8EG 4MVQA 1VQNV 4JYCA 2A0LA 1V9PA 1ZL8B 2KSDA 2BCCH 3CRCA 5LXTA 3JAKA 3BA9A 4LF7O 2X7RB 3EVKA 2PUSA 1Y76A 5BMVB 3L70H 3ETQA 1G6UA 5E1AC 1JQ0A 4F6EA 3AG4C 1FXKB 3Q4HB 1COWG 1GN6A 4LC1A 4P2ZA 2DW4A 2KG7B 1HNWO 1QLNA 5LA6A 1S5LZ 3STLC 4OGQB 3VQXA 2Q69A 1NBMG 3CCQV 3CJHB 3WU2Z 2QEXV 3CD6V 4HNAA 3ICXA 1J5EB 4K8XA 2JS3A 4LF5B 5L3BA 4LF8O 1XNQO 3D36A 4WF9V 4MTXA 1S72V 1GN3A 3F5WC 2Y69B 4MVOA 1PL0A 5FL7G 4MVSA 1RM1C 1NH2B 2GSMB 4CH3A 1NTMH 3FB8C 1K97A 2ADQB 1F4NA 1YI2V 5FNVA 4PDVA 1P49A 4B7KA 5A2QN 3N27A 4GKJB 3SYQA 4O4HB 3M99B 4LF5O 1GMGA 3CE2A 4MTGA 1VQ7V 5KHGA 3E89A 3ZIAG 2IW5A 1SF9A 2XHBA 4J80A 2JVDA 2ITCC 4WFGA 1B06A 1XL6A 1HNZB 4JI4B 1OCZB 1ZAUA 3X2QB 4WFFA 1GRJA 5L3FA 3JD4A 4IYHA 3LSSA 5FNVB 2F93B 3RBZA 4FLYA 2AXTZ 3N2KB 4I55B 2ZNIA 3QG5A 3ABMC 4LFCO 1BMFG 4QPKA 3FAVA 1K73W 3N2KA 3E2EA 1WAZA 3H1IH 3ZMSA 5H9CA 2JDIG 4JTDB 1IX9A 4WBNA 3HKCA 2UUBO 4JV5O 2E75B 1YJWV 3B40A 2ZT9B 2EINB 4J9YB 3AK1A 4UVBA 4ZKIA 4GLXA 2ZM6O 4HAMA 4D6TH 2V4DA 4X1YB 5J2TB 4JI1B 2E74B 1EZJA 2GV9A 1AP6A 5EC1C 2Y0PA 1L0NH 2XAQA 1N36B 2CAZC 2EZPA 2ZD9A 4HBNA 4IHJA 1UJWB 3CRAA 3CRMA 3CB2A 4DRXA 3UKMA 2ZE6A 3RT3C 1KU9A 4O2AB 3CCRV 2QWPB 1N32O 4FLUA 3OD4A 1PM9A 1OCCB 2OCCB 3THOA 5LMNB 1UFIA 3BFRA 2A06H 4DW0A 4OX9B 3HR0A 2UXCB 4NXMO 3B09A 2B1IA 1TUBB 3ML0A 3BA8A 5LMUB 1BGYH 3WG7B 4X64O 3ZHSA 5KHJA 2QWNB 4YJ3B 1M5IA 3CRQA 1VQ8V 4CBCA 3BVOA 3E35A 2IU0A 2HVKC 3L72H 4RO2A 2ZQMA 2B1GA 1YCIA 4AILC 5CBGA 1VQ4V 4ZOLB 2Q7EA 2YDEA 2AHZA 1ORQC 1XOUA 3M7MX 5IJ9B 1SQGA 3OR6C 3RYHA 3CEIA 3SPGA 2UXBO 3D3IA 2QJ1A 2A7WA 4DYLA 4PELA 4OPAA 4DR4O 4WFHA 4I0XB 4B3RO 4X1KA 2JGDB 1N0NA 3VBBA 3K03A 5IT9N 2Q67A 1SKVA 1NI8A 3D3QA 3SYOA 4K3AA 1IBKB 1THZA 2X6CA 1VF6C 3K9SA 3VQVA 3GVMA 2A3QA 2HR3A 1NVPD 4ZHQA 4DR1B 1RM1B 2PI4A 4XDJA 2W6IG 3CRRA 2EIMB 1XQ8A 3MHHC 5J2UB 1WA8B 2R72A 4O2BB 1JOYA 5B66Z 3ZEDA 4RQEA 1R73A 5FPRA 1K4DC 5CMUA 2JJ2G 4LFCB 1OCCC 2OCCC 2VQFO 3ABLC 3JCUZ 1MSWD 4MTOA 4JTCB 5JCOA 4TOIA 3CC7V 2ZE7A 1H2GA 3AG1B 1IBMO 2UXDB
chains in the Genus database with same CATH topology
2AHYA 1QLEB 4H37A 3QNEA 1NR7A 1FXKC 1FFTB 2OTJV 1Q82W 2UXXA 4P30A 3ZCCA 1ENVA 1YJ9V 4FPPA 5IYDO 3JCZA 3RVZA 3FB7C 4R6ZA 1AJNA 3OE7G 2R9RB 3A0RA 3OMAB 4RUEA 1W2BU 5B1NA 1I5YA 2LP7A 3QO7A 1Y66A 1CEZA 2OTLV 4I5SA 3CMEV 2A79B 4PDLA 3RW0A 1W0KG 1VQ5V 1AI7A 2WLNA 3CC4V 3BEHA 1OCRC 4G2KA 3CC2V 1R6NA 2IJJA 5IYCO 4KUMA 1KQSU 5KUMA 3ASNC 5LGUA 4BIUA 2IU3A 1PD3A 3TCUA 4JAVA 1PNLA 2ZXWB 1E1QG 1L1FA 5IDJA 3OEHG 3F7YC 5IY5B 5LHGA 2D3OW 1OCZC 4MS2A 3CCMV 1HWYA 1PKXA 5CN0A 4WFBV 1M9NA 3SPIA 5L3DA 1BHBA 3LDEA 1E79G 4BAYA 3OFNG 5H6RA 3P30A 5DM6V 3G6EV 2BOCC 2EINC 1KP3A 3SJQC 3QO5A 3HPLC 1RPOA 1F4MA 4R50A 3ABKC 1NR1A 3OM3B 4G27B 3PJSK 1K4CC 3WFVA 1VQOV 2XNDG 2Q68A 1QVGU 1GM7A 4R8CA 5B3SB 3GB7C 4LP8A 2WSSG 2QA4V 4UVCA 4PA4A 1EBOA 1M56B 3LSQA 3FYEB 2BOBC 2HFEC 3CCSV 3X2QC 4CZZA 4EKWA 1Q7YW 3E86A 3OUSA 4TWKA 5CBFA 1S3JA 3B8MA 3JD3A 5B1AC 3TETA 3W7UA 1F23A 4HYOA 1AJPA 3G71V 1FS0G 3JD2A 3ZMUA 3P32A 3CP1A 3QO8A 3ZMTA 3E8HA 3SYAA 2Y69C 4KFMA 2W6JG 4P9OA 2H8PC 4PA3A 3E8BA 4U7NA 5DN6G 2P90A 4FIPC 2Q6AA 4JASA 4KP4A 2IJKA 3G4SV 1FXHA 1FXKA 3IC7A 1K33A 3LDDA 2HKOA 3LUTB 3ETDA 3OMIB 3SPHA 2CK3G 3NXSA 3R65A 2ZDIC 2YSUB 3ZRWB 2XAJA 1YHQV 4Z1MG 3ZN0A 1QR9A 2B5UA 4GX2A 1NVPB 2R9IA 4RUFA 1WLEA 1AI5A 1JX9A 4E2LA 3CCEV 1KECA 4G28B 4Q20A 4WFEA 1KC8W 1M57B 4DXWA 1ROPA 3CMAV 3CYOA 5EBWC 2KB1A 4PA7A 1CP9A 3DGEA 5GW7A 1KD1W 2EIKC 3OR7C 1EFRG 1QCEA 1S76D 1VQ6V 2HVJC 3F7VC 1K5QA 2EZOA 3AEIA 4QPJA 1J95A 3GWOA 1YITV 3ASOC 2NNUA 4U7OA 2WLLB 1MABG 2JEXA 3WG7C 1VQMV 3AG2B 1H8EG 4MTFA 2M7WA 2WLJA 4MVQA 2QE7G 1VQNV 4JYCA 2A0LA 2EJRA 1DF5A 1PNKA 3ZRVA 3UM7A 1NKDA 1V55C 2X7RB 1YIJV 5B1BC 4JAUA 5E1AC 3K0DA 1JQ0A 1R3JC 3AG4C 4QIWF 3STZC 5LBQA 1KP2A 4UUJC 2PI5A 5IYBO 1I5XA 1FXKB 3AG2C 3MD0A 1COWG 2OT5A 4LC1A 4P2ZA 5B3SC 1YSCA 2DW4A 5EC2C 1QLNA 1KKDA 2EIJC 2QM7A 2YEVA 4PA6A 3STLC 4UV9A 2Q69A 1NBMG 2IH3C 3CCQV 3EFFK 4QJFB 3E8GA 1R3IC 1AR1B 1WPXA 2QEXV 3CD6V 3T1CA 4X8AA 3K3WA 1YJNV 5HFLA 3AG3B 2Y48A 5L3BA 3FB6C 2K1EA 3D36A 3HB3B 4MTXA 2IH1C 4WF9V 1SERA 1S72V 3JYCA 4MT8A 2EILB 3F5WC 2Y69B 4MVOA 1PL0A 2EIJB 2P7TC 2ZR3A 3CPWU 5FL7G 4MVSA 4JF3A 1IXMA 1YTFD 1K34A 1RM1C 2F43G 5KUKA 2P67A 1NH2B 2JK5C 3K0GA 2GSMB 4QE9A 3JD1A 4TT3G 4N23A 3ZN1A 3FB8C 1K97A 5C93A 2WLMA 5L3CA 2QKSA 2WAMA 2WWWA 2X6BA 1F4NA 1GK9A 1YI2V 4PDVA 1XL4A 3AG1C 2XOKG 3SYQA 1K7DA 2WLIA 3K06A 1W0JG 3M99B 3DTUB 1AROP 2WLHA 4L87A 3ZRXA 1GMGA 4LBEC 2EBOA 1OCOB 4MTGA 1JPXA 3T2MA 1BHAA 4WFAV 2WLIB 5CBHA 2IJHA 2DYRB 5H6QA 4GX5A 1VQ7V 3E89A 3ZIAG 5EBLC 2IW5A 4UV8A 3ABLB 3RVYA 4XBFA 2HLDG 4DO2A 2ITCC 5EK0A 4WFGA 1NH2D 2XAGA 2YEVB 1XL6A 3ABMB 2WPDG 2X6AA 2Z3YA 3H01A 1OCZB 3X2QB 2A9HA 2ITDC 4WFFA 2MK3A 5L3FA 1N8RW 3JD4A 2X0LA 3LSSA 4GCZA 2DYSB 4JPRA 1LNQA 4MW3A 3RBZA 1JVMA 3TK1A 3ZMVA 3T4DA 1V54C 4PDMA 4X89A 1M57C 1PNMA 1DLBA 3CCJV 1ZWIC 5HFMA 3ABMC 4UVAA 2DQ0A 1BMFG 4QPKA 1K73W 3EHBB 3E2EA 5CA3A 5LHHA 1P4RA 3ZMSA 2IJIA 1M56C 5H9CA 2JDIG 3KG2A 4JTDB 4MVRA 1QVFU 4X88A 3MHSC 3JD0A 3LNMB 1YJWV 1M1KW 4FJCC 1R6KA 1GKFA 2JEUA 3ASNB 2EINB 1SZTA 4MVMA 1M90W 4J9YB 4UVBA 4ZKIA 5J9PC 2UXNA 3ABKB 5IY5C 4HAMA 1G4YB 1NJIW 5B1OA 3I56V 5KA6A 1EZJA 3SYCA 3SPJA 1SESA 5EC1C 5L3GA 1P7BA 1K9MW 2JIZG 3FB5C 1YTFB 1K3EA 2Z5UA 2XAQA 2DWEC 4PDRA 3ETEA 3OUFA 1DTOA 2EZPA 3I55V 2ZD9A 3E8FA 3VOUA 4F4LA 1VQPV 1UJWB 1MOFA 1JJ2U 3LDCA 4RAIA 1BL8A 1OCOC 3UKMA 1GM8A 3CCLV 2QTOA 3K79A 1E1RG 1QR8A 1QBZA 5EBMC 4YXWG 4MW8A 4WCEV 1GM9A 3CCRV 4P9PA 1Q81W 3W7WA 4MVZA 3CXCU 2V1DA 2DWDC 1VQ9V 1OCCB 2NLJC 2OCCB 1V55B 3W7SA 4FK5C 4BIZA 1FXVA 5LHIA 1AI4A 2LFSA 1VQLV 3ETGA 1NQTA 2V7QG 1OHHG 5KA5A 4QE7A 2B1IA 2WLKA 1GO3F 3ML0A 3WG7B 2HG5C 5L3EA 1G8MA 3AG3C 4I9WA 3ZMZA 3ZRSA 4GX1A 1RPRA 3OGCC 4J9ZB 2ZXWC 1VQ8V 4CBCA 3E35A 1S77D 3OMNB 2IU0A 3OEEG 2HVKC 1CPYA 1K5SA 2DQ3A 4RO2A 3K9AA 2DYRC 2ZQMA 2B1GA 1V54B 2XASA 2XAFA 4LCUC 4N21A 5CBGA 2EILC 1VQ4V 4ZBMA 1Q86W 3ASOB 4R7CA 1H38A 3OAAG 4H33A 3CCUV 2AHZA 3SPCA 1VQKV 1DF4A 3FYIB 3K08A 1ORQC 4GT1A 2ATKC 4ASUG 4QNHB 1OZ0A 2HJFC 2WLLA 1F51A 3OR6C 3SPGA 3D3IA 2JJ1G 1OCRB 1JCHA 3ABUA 3K04A 4OXSA 4PELA 3AG4B 2XAHA 3BY6A 2ZR2A 1SRYA 2GHYA 5LGNA 4WFHA 4BW5A 1SETA 3FKSG 1R3KC 4JYBA 5LGTA 3VBBA 3IFXA 1S5HC 3K03A 4JGSA 3E83A 3OW2U 4PA9A 2Q67A 2EIMC 1B6QA 4RQFA 3SYPA 3SYOA 2EIKB 1K92A 1TUEB 1THZA 2DYSC 4JTAB 2X6CA 4FMTA 1S0VA 5B1AB 2HR3A 1NVPD 1AJQA 1RM1B 3B77A 2PI4A 2W0FC 2C2AA 4XDJA 4XDKA 3ZRWA 2W6IG 4UXNA 2H94A 4HZ3A 3W7XA 1K8AW 4TSFG 2EIMB 5BZBA 3MHHC 1MG1A 5B1BB 1QLEC 3CCVV 1GTOA 1Y4MA 1JOYA 4MVUA 2FTKA 1AI6A 4RQEA 1R73A 4GX0A 1K4DC 5CMUA 2JJ2G 3ZJZA 1OCCC 2OCCC 1H8HG 3B8NA 2P6JA 3ABLC 3T4ZA 1MSWD 2LFRA 4MTOA 4JTCB 3ABTA 3W7TA 4XDLA 2QM8A 3CC7V 2ZDIA 3IGAC 1H2GA 3AG1B 4MSWC 1R3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2M A;  2WLI B;  2AHY A;  4RUF A;  5CBH A;  4H37 A;  4QE7 A;  4GX5 A;  3E89 A;  5EBL C;  2WLK A;  4P30 A;  4G28 B;  3RVY A;  2HG5 C;  4WFE A;  3AG3 C;  4I9W A;  3ZRS A;  4GX1 A;  4DXW A;  2ITC C;  3OGC C;  5EK0 A;  3RVZ A;  3FB7 C;  4J9Z B;  4R6Z A;  4WFG A;  2ZXW C;  2R9R B;  4RUE A;  1XL6 A;  5EBW C;  4CBC A;  2X6A A;  2KB1 A;  4PA7 A;  2HVK C;  2A9H A;  2ITD C;  4WFF A;  2A79 B;  2EIK C;  3OR7 C;  4PDL A;  3RW0 A;  2HVJ C;  2WLN A;  3F7V C;  4RO2 A;  2DYR C;  1J95 A;  3BEH A;  3ASO C;  1LNQ A;  4MW3 A;  3RBZ A;  1JVM A;  1OCR C;  2WLL B;  4LCU C;  3WG7 C;  3T4D A;  5CBG A;  2EIL C;  1V54 C;  4MTF A;  4PDM A;  4ZBM A;  4R7C A;  2WLJ A;  4X89 A;  4MVQ A;  1M57 C;  5KUM A;  3ASN C;  4H33 A;  2A0L A;  2AHZ A;  3SPC A;  1ZWI C;  3TCU A;  3K08 A;  1ORQ C;  2ATK C;  4QNH B;  3ABM C;  3F7Y C;  1OCZ C;  4MS2 A;  3UM7 A;  1V55 C;  2HJF C;  2WLL A;  3OR6 C;  5B1B C;  3SPG A;  1M56 C;  5E1A C;  3KG2 A;  3K0D A;  4JTD B;  1R3J C;  3LDE A;  3AG4 C;  4MVR A;  3SPI A;  4X88 A;  3STZ C;  3LNM B;  4UUJ C;  4OXS A;  2BOC C;  2EIN C;  3K04 A;  3SJQ C;  3HPL C;  4R50 A;  3AG2 C;  3ABK C;  4MVM A;  4G27 B;  4P2Z A;  5B3S C;  4WFH A;  3PJS K;  1K4C C;  4J9Y B;  4BW5 A;  5EC2 C;  1KKD A;  5J9P C;  2EIJ C;  2Q68 A;  2YEV A;  4PA6 A;  5IY5 C;  4R8C A;  1R3K C;  1G4Y B;  3GB7 C;  4LP8 A;  3STL C;  4PA4 A;  2Q69 A;  3IFX A;  1S5H C;  2IH3 C;  3K03 A;  3E83 A;  3EFF K;  4PA9 A;  2Q67 A;  3E8G A;  1R3I C;  2EIM C;  3SYC A;  2BOB C;  2HFE C;  3SYP A;  3SYO A;  3X2Q C;  3SPJ A;  4EKW A;  3E86 A;  3OUS A;  4X8A A;  5EC1 C;  3T1C A;  4TWK A;  1P7B A;  5CBF A;  3FB5 C;  2DYS C;  5B1A C;  3FB6 C;  2K1E A;  2X6C A;  4JTA B;  3TET A;  2IH1 C;  3JYC A;  4HYO A;  2DWE C;  4PDR A;  3F5W C;  3OUF A;  4MVO A;  2P7T C;  2ZD9 A;  3E8F A;  2W0F C;  4XDJ A;  4MVS A;  4XDK A;  3VOU A;  3E8H A;  3SYA A;  2Y69 C;  4F4L A;  4KFM A;  4HZ3 A;  3LDC A;  5KUK A;  4RAI A;  4P9O A;  1BL8 A;  2H8P C;  3E8B A;  4PA3 A;  2JK5 C;  1OCO C;  3K0G A;  5BZB A;  3UKM A;  4QE9 A;  1QLE C;  2QTO A;  4MVU A;  2Q6A A;  5EBM C;  4MW8 A;  4GX0 A;  1K4D C;  4P9P A;  3FB8 C;  4MVZ A;  3ZJZ A;  1OCC C;  2OCC C;  2WLM A;  2QKS A;  3LDD A;  2DWD C;  2X6B A;  3ABL C;  3T4Z A;  3LUT B;  4MTO A;  4PDV A;  1XL4 A;  4JTC B;  2NLJ C;  3AG1 C;  4XDL A;  3SYQ A;  2WLI A;  3K06 A;  3SPH A;  3R65 A;  2WLH A;  3IGA C;  4LBE C;  4GX2 A;  4MTG A;  4MSW C;  1R3L C; 
#chains in the Genus database with same CATH topology
 1QLE B;  4Z1V A;  1FXK C;  1FFT B;  5H2F Z;  2Q0O C;  2N74 A;  2UXX A;  2YC0 A;  4B3M O;  4IT5 A;  1UPG A;  4C7U A;  4RUE A;  3OMA B;  5B1N A;  2OTL V;  3RGB A;  4H0L B;  4FLZ A;  2OIE A;  1AI7 A;  3CC4 V;  3BEH A;  4O4J A;  1OCR C;  3CC2 V;  3DSQ A;  2ARH A;  3GWK C;  4DUZ B;  4BIU A;  3JAT B;  5LHG A;  5IDJ A;  4JI7 B;  2DJV A;  4MS2 A;  1TGO A;  5IJ0 A;  1PKX A;  4H13 B;  1M9N A;  2ZE5 A;  4JAA A;  1BHB A;  3LDE A;  4IGG A;  2JRI A;  5H6R A;  3P30 A;  2CDY A;  3G6E V;  1RPO A;  4R50 A;  4G27 B;  4X1K B;  1VQO V;  2QA4 V;  4UVC A;  4X64 B;  3ZS8 C;  4BR6 A;  3CCS V;  3X2Q C;  1Q7Y W;  4TWK A;  4KHP B;  1H2K A;  2FB5 A;  5LOV A;  1F23 A;  5JQG B;  2JGD A;  3SYA A;  4KFM A;  1MSD A;  2H8P C;  3E8B A;  4PA3 A;  2PYL A;  1URF A;  2VQF B;  1HNX O;  4FIP C;  2F1M A;  2VQE O;  2G38 A;  1FXK A;  3O65 A;  1VF7 A;  3IC7 A;  1K33 A;  3LDD A;  5IWA B;  4YHH O;  2CGO A;  1I7F A;  4QGP A;  2CK3 G;  1M4U A;  3FX7 A;  1AR4 A;  1WB7 A;  4DV1 O;  4JYY A;  1ZL8 A;  1WLE A;  1ZSP A;  1Q8I A;  1KEC A;  4G28 B;  1NZ6 A;  4Q20 A;  4DV5 O;  4WFE A;  5C8Y A;  1M57 B;  2VRZ A;  3BRC A;  1SA0 A;  1Q6I A;  5JJN B;  3CYO A;  2KB1 A;  4PA7 A;  1IBK O;  4IHJ B;  1N4C A;  3DGE A;  5K1P A;  1FJG O;  1S76 D;  4FFB B;  4JYA B;  3ASO C;  3ZHU A;  4DV2 B;  2JEX A;  2GTA A;  2OYQ A;  4LH7 A;  2EJR A;  4I9Q A;  3UM7 A;  1T5E A;  1YIJ V;  2E3C A;  4X65 O;  3K0D A;  3STZ C;  5LBQ A;  1KP2 A;  1HNW B;  2PI5 A;  3JAR A;  3RYI B;  3MD0 A;  1R6T A;  1YSC A;  2DOS A;  5B5E Z;  5EC2 C;  3PN1 A;  2F66 C;  1N32 B;  4O4I B;  1BQ0 A;  3EFF K;  1WP8 A;  1NTZ H;  2UUA O;  4GZR B;  4B3M B;  4X8A A;  1I94 B;  2R9A A;  5HFL A;  2Y48 A;  1SER A;  2QWQ B;  5TIS Z;  2ZIN A;  2B9Z A;  1XI1 A;  4MT8 A;  4F6R A;  2EIL B;  2EIJ B;  2P7T C;  1SQX H;  1IXM A;  4YJ2 B;  4DW1 A;  4AHC A;  2P67 A;  4DR2 B;  2JK5 C;  3K0G A;  3OT7 A;  2GDS A;  2DE0 X;  3SR2 C;  5L3C A;  2WWW A;  2X6B A;  3ZBH A;  1GK9 A;  3J81 N;  2XOK G;  3HKE B;  4K35 A;  1I94 O;  3K06 A;  3DTU B;  1ARO P;  3ZRX A;  3WB1 A;  2EBO A;  1OCO B;  3M8A A;  1JPX A;  3H1K H;  4O4H A;  5D5P A;  1HW7 A;  4GX5 A;  1Q6U A;  4UV8 A;  3AK3 A;  1Q43 A;  5EK0 A;  3U11 A;  3ABM B;  2WPD G;  2X6A A;  2Z3Y A;  4YJ3 A;  4EB6 B;  3T1Y B;  2DN9 A;  1Z5W A;  4J7K A;  4I50 B;  1WB8 A;  4JPR A;  3RFR A;  3DXR A;  3RYF B;  3TK1 A;  2QM4 A;  4TV9 A;  1U97 A;  2QKA A;  4X89 A;  5J2U A;  1DLB A;  1HNX B;  3EHB B;  2YID A;  5LHH A;  1Z2G A;  5JVD A;  3KG2 A;  4MVR A;  3MHS C;  2JEU A;  2Q0A A;  5LA6 B;  2YIB D;  2YS8 A;  3ABK B;  5EYP A;  4DK0 A;  5CB4 A;  1NJI W;  1SQB H;  3I56 V;  3SYC A;  4CS3 A;  2ZM6 B;  3SPJ A;  2VS0 A;  1K3E A;  2Z5U A;  4NR1 A;  1H2L A;  1KUQ A;  4PDR A;  1Q6H A;  3OUF A;  1DTO A;  1QNM A;  4TUY A;  5A9G A;  1QQC A;  4ZHQ B;  4F4L A;  1VQP V;  1JJ2 U;  1MOF A;  1VF6 A;  1BL8 A;  2YUA A;  4FLT A;  4FM0 A;  4UB8 Z;  4KHP O;  4LFB O;  1A32 A;  2CTW A;  3K79 A;  3APQ A;  4O2B A;  3L73 H;  4WCE V;  4MVZ A;  2V1D A;  4PHZ A;  2ETN A;  1PL4 A;  3TJT A;  2QWO B;  2ZIM A;  3BCC H;  2UXC O;  3CSX A;  3TXQ A;  1G1X B;  1NT2 B;  4FK5 C;  4BIZ A;  1FXV A;  5LHI A;  2K9P A;  2QSA A;  1AI4 A;  2YXL A;  2RCV A;  5IYZ A;  2V7Q G;  5JVD B;  5KA5 A;  3UCS C;  1SC5 B;  3I5D A;  5L3E A;  2NN4 A;  4I9W A;  3ZMZ A;  3APO A;  2ZXW C;  2N04 A;  3G6B A;  4DUZ O;  3OMN B;  1TA8 A;  1H2M A;  4X66 B;  1K5S A;  3K9A A;  1M93 A;  4TQD A;  1V54 B;  1D2D A;  4N21 A;  2EIL C;  1F7Y A;  1GN2 A;  4R7C A;  4FLX A;  2FYU H;  1VQK V;  3FYI B;  4CC5 A;  4QNH B;  3N2G A;  1TUB A;  4CC6 A;  1N34 O;  1F51 A;  2GBO A;  3CWB H;  1FYJ A;  4E4E A;  4DV2 O;  5BXZ A;  2JJ1 G;  2RQ6 A;  1OCR B;  3K04 A;  3UO3 A;  3BY6 A;  1SS3 A;  1PPJ H;  5LGN A;  3HKD B;  4BW5 A;  3FKS G;  4J7J A;  4JYB A;  3TXS A;  1BCC H;  4JGS A;  3E83 A;  4PA9 A;  1EN4 A;  4FLW A;  5EIB C;  1R1B A;  3SYP A;  2NR5 A;  2XUM A;  3T1Y O;  1K92 A;  1TUE B;  2HHH B;  4FLV A;  2DYS C;  2P22 C;  1S0V A;  3JAL B;  2VQE B;  5B1A B;  3T1H B;  1MZF A;  2CE4 A;  5CA1 A;  2W0F C;  4YHH B;  3ZRW A;  4UXN A;  2H94 A;  2QR4 A;  4UCT A;  3W7X A;  5BZB A;  4O2A A;  4MVU A;  1Q90 D;  5JJE B;  2FTK A;  3ZJZ A;  4YY3 O;  1H8H G;  2P6J A;  1IBL B;  3ABT A;  3SGI A;  4XDL A;  4YIO A;  2PYJ A;  2ZNJ A;  4MSW C;  1R3L C;  4J11 A;  4NXN O;  1OJH A;  1NR7 A;  3P3N A;  1WN7 A;  1Q82 W;  3CJH A;  1NS1 A;  2UXD O;  4JYA O;  4FPP A;  1J5E O;  5IYD O;  3D8C A;  4X65 B;  1YDX A;  3JCZ A;  4L8J A;  4X1Y A;  4R6Z A;  3OE7 G;  4DV4 B;  2P06 A;  2H3O A;  1W2B U;  1L0L H;  2LP7 A;  3QO7 A;  1CEZ A;  4CH5 A;  2PTM A;  3RW0 A;  1W0K G;  4DK1 A;  4G2K A;  5IYC O;  5JH7 A;  1KQS U;  5KUM A;  1B04 A;  2IU3 A;  1VP7 A;  3TCU A;  2D3O W;  1US6 A;  3FFQ A;  1JFF A;  4NTX A;  1N0J A;  1OCZ C;  3G80 A;  3SPI A;  2EUL A;  4BAY A;  3OFN G;  2EIN C;  4DUY O;  1KP3 A;  3SJQ C;  4GKJ O;  1DGS A;  3HPL C;  1F4M A;  2IBZ H;  2QWR B;  3PJS K;  2Q68 A;  1GM7 A;  4R8C A;  3GB7 C;  2RMK B;  4UCV A;  1EBO A;  1EN6 A;  2QKC A;  1M56 B;  3E22 A;  3FYE B;  3LSQ A;  4LF6 B;  1IXB A;  5IE9 A;  2BOB C;  3OUS A;  3B8M A;  2MW2 B;  1TVK A;  4CH4 A;  3E22 B;  1AB3 A;  3TET A;  4GKK O;  2YXY A;  3W7U A;  3K5O A;  3JSN A;  4HYO A;  3G71 V;  3JD2 A;  3JAS A;  1WPB A;  3ZMU A;  4CS2 A;  3JAW B;  3ZHT A;  5LOV B;  1FFX B;  2YIC A;  1BZK A;  2W6J G;  1BT8 A;  4DR7 B;  5IWA O;  4KP4 A;  3QTC A;  4LR3 A;  1VEW A;  2HKO A;  3ETD A;  3SPH A;  2HEP A;  1YHQ V;  2XAJ A;  3VQY A;  5JCO C;  2AZ0 A;  3SJB C;  2R9I A;  4E2L A;  3CCE V;  5KX5 B;  4FZ1 A;  5BMV A;  4EFE A;  1KC8 W;  1ROP A;  2QGN A;  5EBW C;  4TUY B;  3ZHQ A;  2RJZ A;  1CP9 A;  2Q73 A;  4X62 B;  2CTR A;  5GW7 A;  1KD1 W;  3OR7 C;  4K0K O;  1TAE A;  1K5Q A;  3AEI A;  1YIT V;  2YXH A;  3OGI B;  4JI0 B;  2NNU A;  4U7O A;  2YI8 A;  4LF9 O;  2Q7H A;  1N33 B;  4MTF A;  4DRX B;  2M7W A;  2WLJ A;  2QE7 G;  3JAS B;  1BS3 A;  1YZB A;  1DF5 A;  1LUW A;  3ZRV A;  1NKD A;  1V55 C;  2FML A;  5BY1 A;  4IIJ B;  4AI8 A;  2BTO A;  3Q4H A;  4DR3 O;  4LWS A;  3S3W A;  1I5X A;  5LMN O;  4IIJ A;  5EZY A;  3UT5 A;  3AG2 C;  2OT5 A;  5B3S C;  2UUA B;  4PA6 A;  3A8T A;  4UB6 Z;  4ZI7 A;  1Y74 B;  5J2T A;  4B3S B;  4UV9 A;  2IH3 C;  3JAL A;  4B7E A;  1AR1 B;  1WPX A;  2UU9 B;  2CH7 B;  2ZCE A;  2P5O A;  3K3W A;  2F4V O;  3AG3 B;  4X9Q A;  5AG2 A;  3G67 A;  2ZR3 A;  1WJZ A;  4JF3 A;  1YTF D;  1H2N A;  3UQ8 A;  4LNU A;  1N36 O;  2Y4U A;  3WB2 A;  3TGU H;  4LFA B;  1IBM B;  5KHI A;  3ZN1 A;  2BSK B;  5C93 A;  2WLM A;  2QKS A;  3P3P A;  1EN5 A;  1K7D A;  2WLI A;  1W0J G;  4L87 A;  1KMI Z;  2HP8 A;  4LBE C;  4W4K A;  4B3R B;  1LR1 A;  4NB5 A;  4WFA V;  5CBH A;  2IJH A;  2DYR B;  3ZHV A;  3RVY A;  4DO2 A;  4LFA O;  2O57 A;  1NH2 D;  3DC5 A;  2XAG A;  2YEV B;  4U3F H;  3H01 A;  4CH6 A;  4DR5 B;  5LL6 Y;  4PV1 B;  1N8R W;  2BTQ A;  4GCZ A;  2VWK A;  2DYS B;  3H1J H;  3J7A U;  3ZMV A;  4DV6 B;  4LH6 A;  2BTQ B;  3H1H H;  4DV4 O;  4DR7 O;  5GTI Z;  1PNM A;  2L35 A;  1MNG A;  5HFM A;  1XEQ A;  2HJD A;  5CA3 A;  1SZX A;  1P4R A;  1QVF U;  2ADP A;  3JD0 A;  3LNM B;  1YXB A;  1EZV H;  1Q3E A;  1GKF A;  4MVM A;  3ASN B;  1SZT A;  1M90 W;  3HKD A;  5J9P C;  4DV0 O;  2UXN A;  5IY5 C;  5B1O A;  5KA6 A;  3L9D A;  1P7G A;  3CXH F;  2JS5 A;  4X20 A;  2OCH A;  1SES A;  1P7B A;  1K9M W;  2JIZ G;  1FFX A;  2UUC O;  3BAA A;  1YTF B;  4X1I A;  1KBH A;  1AR5 A;  2F95 B;  2CTQ A;  2DWE C;  4D7S A;  1HP8 A;  3I55 V;  1XHX A;  3E8F A;  1IBL O;  5CA1 B;  4UCO A;  3SDL A;  5LMU O;  3KZI Z;  1OCO C;  1GM8 A;  3RN4 A;  4PI0 A;  1E1R G;  4MW8 A;  1GM9 A;  4P9P A;  3W7W A;  3CXC U;  1FAF A;  3A0B Z;  3W7S A;  1AP5 A;  2VWJ A;  3FAV B;  3OTO B;  1VQL V;  1ZUQ A;  4YIP A;  1U96 A;  2WLK A;  3HKB A;  2HG5 C;  1EM1 A;  3AG3 C;  3JAM N;  4GYC B;  2EJ7 A;  1X59 A;  2YIB A;  3OGC C;  1XBL A;  5JQG A;  2D2C B;  4UCU A;  4DR6 B;  1CPY A;  3RYC B;  3IJ4 A;  1H2S B;  2XAS A;  4JI3 O;  2XAF A;  1Y76 B;  4X66 O;  1Q86 W;  4NYK A;  1H38 A;  3A2F A;  3OAA G;  4H33 A;  3CCU V;  4NTY A;  1DF4 A;  4JI2 O;  3K08 A;  4ASU G;  1QHT A;  3CHX A;  1JFF B;  3VQW A;  2HJF C;  2WLL A;  1I0H A;  1DK1 A;  1XIL A;  1JCH A;  3AG4 B;  3K5M A;  2OWO A;  3EXA A;  2GHY A;  1GAX A;  1SET A;  4D7T A;  4GUN A;  2KQX A;  5LGT A;  5KAI Z;  3OW2 U;  1B6Q A;  4RQF A;  4JI4 O;  2LGW A;  4X1I B;  4JTA B;  5DED A;  4NTW A;  4KL1 A;  2UXB B;  2WA3 A;  3AK2 A;  4H44 B;  4CS4 A;  4DV3 O;  2EX3 A;  1RSO A;  4XDK A;  1AIL A;  3JAK B;  3DXR B;  2F4V B;  1QLE C;  1GTO A;  1Y4M A;  4GX0 A;  1JJO A;  2ZKO A;  5FPO A;  3S3X A;  4K0K B;  2LFR A;  2QM8 A;  4FFK A;  5KHH A;  2ZDI A;  1CXZ B;  3IGA C;  2XTA A;  2PF4 E;  2BSK A;  4UCS A;  2Q9L A;  1XNR B;  2AHY A;  3IC9 A;  4H37 A;  5CA0 B;  3KCX A;  4DV3 B;  4PJ0 Z;  4P30 A;  3ZCC A;  1ENV A;  3FB7 C;  1AJN A;  1I5Y A;  3CME V;  4YJ2 A;  2WLN A;  5BR8 O;  1R6N A;  4KUM A;  1IDS A;  2E5L B;  3ASN C;  4DR5 O;  1PD3 A;  4JAV A;  1L1F A;  2ZXW B;  3F7Y C;  5IY5 B;  1IZ3 A;  1TVK B;  1HWY A;  4UCR A;  5CN0 A;  1L8D A;  4IL6 Z;  5L3D A;  2Z0A A;  1O9G A;  1X4T A;  3OTO O;  2R70 A;  5GON B;  4ABM A;  3RYI A;  3OM3 B;  1NR1 A;  3B2E E;  1K4C C;  3WFV A;  2XND G;  4DUY B;  1QVG U;  3C3T A;  5B3S B;  3N2G B;  1ZTE A;  1MZE A;  4LNU B;  2UUB B;  2HFE C;  4CZZ A;  4EKW A;  3SJC C;  4Z2W A;  5ITZ B;  3JSL A;  3E86 A;  4FZ0 A;  4HNA B;  4JI7 O;  4I50 A;  2CH7 A;  5CBF A;  4W4L A;  4DR1 O;  3JD3 A;  2AZ2 A;  1AJP A;  1ZLZ A;  4I7Z B;  3QO8 A;  1KB9 F;  3K57 A;  3E8H A;  4NVP A;  2Y69 C;  2UUC B;  4U7N A;  2P4K A;  2Q6A A;  2Q8V A;  4JAS A;  2IJK A;  4WBN B;  3G4S V;  1FXH A;  5EZY B;  3UT5 B;  2L6L A;  3LUT B;  3C90 A;  4BWA A;  3JAT A;  1XNR O;  2YSU B;  3RYH B;  1XRE A;  4Z1M G;  1QR9 A;  4GX2 A;  4J10 A;  1NVP B;  2E76 B;  2W0X A;  1AI5 A;  3L74 H;  4X20 B;  4AQY B;  4JI6 O;  4DXW A;  1Y6X A;  2JGU A;  5H5N A;  2QDO A;  5LYJ B;  4LF4 O;  1MA1 A;  4LF9 B;  4ICG A;  4Q6G A;  1VQ6 V;  2KG7 A;  3F7V C;  4DV0 B;  2EZO A;  1MAB G;  1XMQ O;  1WP7 A;  4O4L A;  1BQZ A;  2AGA A;  1PNK A;  4BW9 A;  3JAW A;  5IJ0 B;  5B1B C;  4JAU A;  2LO1 A;  1R3J C;  4QIW F;  4UUJ C;  1FPO A;  5IYB O;  2YI9 A;  1IVS A;  5IYZ B;  1KKD A;  2EIJ C;  2QM7 A;  2YEV A;  2UU9 O;  1IUR A;  4DV7 O;  1MMM A;  4QJF B;  3E8G A;  1R3I C;  2LW7 A;  3T1C A;  4J41 A;  1YJN V;  4DR4 B;  3FB6 C;  2K1E A;  3HB3 B;  2ZE8 A;  1NU1 H;  2IH1 C;  4JZG A;  3JYC A;  1Q5O A;  1ZX3 A;  3R66 A;  1SA0 B;  3CPW U;  4FM2 A;  1JR9 A;  2E5L O;  1K34 A;  3NR7 A;  2F43 G;  5KUK A;  4U3J A;  4QE9 A;  3JD1 A;  4TT3 G;  4N23 A;  3ZHR A;  1VIB A;  2WAM A;  2M6Y A;  1XL4 A;  3AG1 C;  2N05 A;  5EYP B;  4RWU A;  5LXT B;  1BSM A;  2WLH A;  2GUZ B;  1KYO F;  4GKK B;  1SQQ H;  4F6R B;  3BHP A;  1BHA A;  3T2M A;  2WLI B;  4I55 A;  5H6Q A;  1FKA O;  5EBL C;  4IYI A;  3ABL B;  4XBF A;  2HLD G;  3RWR D;  1YF2 A;  4DR2 O;  1HR0 B;  4ZI7 B;  2XT9 A;  3K58 A;  4JI2 B;  4FM1 A;  2A9H A;  2ITD C;  2MK3 A;  4TV9 B;  1GN4 A;  2X0L A;  1RFY A;  1LNQ A;  4MW3 A;  1JVM A;  2Q7G A;  3T4D A;  1V54 C;  3O9O A;  4PDM A;  1M57 C;  5KMG B;  1HDJ A;  3CCJ V;  1ZWI C;  4B3T B;  4UVA A;  2DQ0 A;  5IJ9 A;  2QTS A;  3KKY A;  2IJI A;  1M56 C;  3QF7 A;  4X88 A;  2KKW A;  1HR0 O;  5FLX N;  5CA0 A;  1AVM A;  3BPZ A;  1M1K W;  1BE3 H;  1KKC A;  4FJC C;  1R6K A;  5D5Q A;  1SQV H;  2LW1 A;  3K5N A;  4DV1 B;  4JV5 B;  5GTH Z;  1G4Y B;  3HKE A;  4O4I A;  4JI0 O;  4PD4 F;  4JI6 B;  1S5J A;  4AQY O;  5KX5 A;  1YVW A;  3L75 H;  4LWS B;  1VMG A;  4B3T O;  5L3G A;  3FB5 C;  3A0H Z;  4JI8 B;  1XUQ A;  4PI2 A;  2OIG A;  2PY5 A;  5E79 Z;  3ETE A;  1FJG B;  5LP6 C;  4JI5 O;  1JA8 A;  3VOU A;  4J42 A;  3AG7 A;  3LDC A;  4RAI A;  1XMQ B;  4LF8 B;  1XNQ B;  2IM9 A;  3CCL V;  2QTO A;  1QR8 A;  1QBZ A;  5EBM C;  5KLV H;  4FVM A;  4YXW G;  4B3S O;  1Q81 W;  2DWD C;  2DMX A;  3RYC A;  1P84 F;  1VQ9 V;  2NLJ C;  1VF5 B;  1V55 B;  2RDC A;  4JI8 O;  2LFS A;  1Z5V A;  1SQP H;  2AW9 A;  3ETG A;  1NQT A;  4OPH A;  4JZ2 A;  1OHH G;  1FD9 A;  4QE7 A;  4LF6 O;  5EIB D;  1GO3 F;  5BR8 B;  3UO2 A;  1G8M A;  4DV7 B;  3ZRS A;  4GX1 A;  1RPR A;  4J9Z B;  3J80 N;  1N33 O;  3H9V A;  1RSO B;  3ZX6 A;  3BAB A;  1S77 D;  3OEE G;  3OTF A;  2FL4 A;  2DQ3 A;  2DYR C;  3D36 C;  3RYF A;  3K59 A;  4DR3 B;  4LCU C;  4ZBM A;  2Q4P A;  3ASO B;  3SJA C;  1HNZ O;  1JMK C;  3SPC A;  4UFZ A;  4GT1 A;  2ATK C;  1XMO O;  1LUV A;  3HKB B;  3C3S A;  1OZ0 A;  3IAY A;  4OXS A;  3ABU A;  1RP3 B;  2XAH A;  2ZR2 A;  1SRY A;  3QVN A;  1WA8 A;  2ODM A;  1R3K C;  5CB4 B;  3U10 A;  3K5L A;  3IFX A;  1S5H C;  5C8Y B;  4YY3 B;  2EIM C;  4TV8 A;  2EIK B;  2LQT A;  4JI5 B;  5JH7 B;  1VAR A;  4FMT A;  3KCY A;  5LP6 A;  4NXN B;  4FFB A;  1AJQ A;  4LFB B;  3B77 A;  2C2A A;  4KXR A;  4HZ3 A;  1K8A W;  4TSF G;  1MG1 A;  5B1B B;  3CCV V;  2PZS A;  1AI6 A;  1O9H A;  3B8N A;  4TV8 B;  3T4Z A;  4U3J B;  5JWP A;  3W7T A;  3B4S A;  3LSU A;  1E1Q G;  3T1H O;  5ITZ A;  2LJ2 A;  3QNE A;  2OTJ V;  1YJ9 V;  1OV9 A;  5KAF Z;  4O4L B;  3RVZ A;  4DV6 O;  4I0X A;  2R9R B;  3A0R A;  1Y66 A;  4I5S A;  5JJJ B;  2Q5Z A;  5LYJ A;  1PV0 A;  2A79 B;  4PDL A;  1VQ5 V;  2RN9 A;  1YEW A;  4I4T A;  1XHZ A;  2IJJ A;  1Y67 A;  1XDC A;  4NXM B;  5LGU A;  1PNL A;  3OEH G;  2CUG A;  3CCM V;  4WFB V;  5GON A;  3U0Z A;  3CX5 F;  1E79 G;  2Y0I A;  2ZIO A;  4TQF A;  5DM6 V;  2BOC C;  3H1L H;  3QO5 A;  4ZIB A;  1NTK H;  3ABK C;  5KHK A;  2GTS A;  5DEC A;  4LP8 A;  2WSS G;  1GH6 A;  4PA4 A;  1Y74 A;  3FD9 A;  2HHH O;  4EFB A;  2RNB A;  3F5T A;  3LNN A;  1PP9 H;  1S3J A;  1SQF A;  1QU7 A;  5F2V O;  2LGQ A;  5B1A C;  4J7Z A;  4K8Z A;  2Y4T A;  5LP6 B;  1FS0 G;  3P32 A;  3CP1 A;  3ZMT A;  2GUZ A;  2FKX A;  5KMG A;  4P9O A;  5DN6 G;  2P90 A;  2WA4 A;  4OX9 O;  1B3Q A;  1N34 B;  2YIA A;  2CGN A;  1XMO B;  4A5U B;  4X62 O;  1D5A A;  2F23 A;  3HKC B;  3OMI B;  1W59 A;  3NXS A;  3R65 A;  2ZDI C;  4EB6 A;  3ZRW B;  3ZN0 A;  2B5U A;  2BE3 A;  2P4V A;  3CS5 A;  4RUF A;  1D5N A;  4DR6 O;  4BIO A;  1JX9 A;  2CTP A;  4JI1 O;  4NKG B;  4LF7 B;  3WB0 A;  4JI3 B;  3CMA V;  2PGG A;  4DV5 B;  4B08 A;  3JAR B;  4ZOL A;  4EEQ A;  2EIK C;  1WNS A;  2ILM A;  1EFR G;  1QCE A;  3MDS A;  3L71 H;  2HVJ C;  3DC6 A;  4I4T B;  4QPJ A;  5K1X A;  1J95 A;  3GWO A;  4O4J B;  4LF4 B;  3MAQ A;  1I08 A;  2WLL B;  3WG7 C;  1VQM V;  3AG2 B;  1H8E G;  4MVQ A;  1VQN V;  4JYC A;  2A0L A;  1V9P A;  1ZL8 B;  2KSD A;  2BCC H;  3CRC A;  5LXT A;  3JAK A;  3BA9 A;  4LF7 O;  2X7R B;  3EVK A;  2PUS A;  1Y76 A;  5BMV B;  3L70 H;  3ETQ A;  1G6U A;  5E1A C;  1JQ0 A;  4F6E A;  3AG4 C;  1FXK B;  3Q4H B;  1COW G;  1GN6 A;  4LC1 A;  4P2Z A;  2DW4 A;  2KG7 B;  1HNW O;  1QLN A;  5LA6 A;  1S5L Z;  3STL C;  4OGQ B;  3VQX A;  2Q69 A;  1NBM G;  3CCQ V;  3CJH B;  3WU2 Z;  2QEX V;  3CD6 V;  4HNA A;  3ICX A;  1J5E B;  4K8X A;  2JS3 A;  4LF5 B;  5L3B A;  4LF8 O;  1XNQ O;  3D36 A;  4WF9 V;  4MTX A;  1S72 V;  1GN3 A;  3F5W C;  2Y69 B;  4MVO A;  1PL0 A;  5FL7 G;  4MVS A;  1RM1 C;  1NH2 B;  2GSM B;  4CH3 A;  1NTM H;  3FB8 C;  1K97 A;  2ADQ B;  1F4N A;  1YI2 V;  5FNV A;  4PDV A;  1P49 A;  4B7K A;  5A2Q N;  3N27 A;  4GKJ B;  3SYQ A;  4O4H B;  3M99 B;  4LF5 O;  1GMG A;  3CE2 A;  4MTG A;  1VQ7 V;  5KHG A;  3E89 A;  3ZIA G;  2IW5 A;  1SF9 A;  2XHB A;  4J80 A;  2JVD A;  2ITC C;  4WFG A;  1B06 A;  1XL6 A;  1HNZ B;  4JI4 B;  1OCZ B;  1ZAU A;  3X2Q B;  4WFF A;  1GRJ A;  5L3F A;  3JD4 A;  4IYH A;  3LSS A;  5FNV B;  2F93 B;  3RBZ A;  4FLY A;  2AXT Z;  3N2K B;  4I55 B;  2ZNI A;  3QG5 A;  3ABM C;  4LFC O;  1BMF G;  4QPK A;  3FAV A;  1K73 W;  3N2K A;  3E2E A;  1WAZ A;  3H1I H;  3ZMS A;  5H9C A;  2JDI G;  4JTD B;  1IX9 A;  4WBN A;  3HKC A;  2UUB O;  4JV5 O;  2E75 B;  1YJW V;  3B40 A;  2ZT9 B;  2EIN B;  4J9Y B;  3AK1 A;  4UVB A;  4ZKI A;  4GLX A;  2ZM6 O;  4HAM A;  4D6T H;  2V4D A;  4X1Y B;  5J2T B;  4JI1 B;  2E74 B;  1EZJ A;  2GV9 A;  1AP6 A;  5EC1 C;  2Y0P A;  1L0N H;  2XAQ A;  1N36 B;  2CAZ C;  2EZP A;  2ZD9 A;  4HBN A;  4IHJ A;  1UJW B;  3CRA A;  3CRM A;  3CB2 A;  4DRX A;  3UKM A;  2ZE6 A;  3RT3 C;  1KU9 A;  4O2A B;  3CCR V;  2QWP B;  1N32 O;  4FLU A;  3OD4 A;  1PM9 A;  1OCC B;  2OCC B;  3THO A;  5LMN B;  1UFI A;  3BFR A;  2A06 H;  4DW0 A;  4OX9 B;  3HR0 A;  2UXC B;  4NXM O;  3B09 A;  2B1I A;  1TUB B;  3ML0 A;  3BA8 A;  5LMU B;  1BGY H;  3WG7 B;  4X64 O;  3ZHS A;  5KHJ A;  2QWN B;  4YJ3 B;  1M5I A;  3CRQ A;  1VQ8 V;  4CBC A;  3BVO A;  3E35 A;  2IU0 A;  2HVK C;  3L72 H;  4RO2 A;  2ZQM A;  2B1G A;  1YCI A;  4AIL C;  5CBG A;  1VQ4 V;  4ZOL B;  2Q7E A;  2YDE A;  2AHZ A;  1ORQ C;  1XOU A;  3M7M X;  5IJ9 B;  1SQG A;  3OR6 C;  3RYH A;  3CEI A;  3SPG A;  2UXB O;  3D3I A;  2QJ1 A;  2A7W A;  4DYL A;  4PEL A;  4OPA A;  4DR4 O;  4WFH A;  4I0X B;  4B3R O;  4X1K A;  2JGD B;  1N0N A;  3VBB A;  3K03 A;  5IT9 N;  2Q67 A;  1SKV A;  1NI8 A;  3D3Q A;  3SYO A;  4K3A A;  1IBK B;  1THZ A;  2X6C A;  1VF6 C;  3K9S A;  3VQV A;  3GVM A;  2A3Q A;  2HR3 A;  1NVP D;  4ZHQ A;  4DR1 B;  1RM1 B;  2PI4 A;  4XDJ A;  2W6I G;  3CRR A;  2EIM B;  1XQ8 A;  3MHH C;  5J2U B;  1WA8 B;  2R72 A;  4O2B B;  1JOY A;  5B66 Z;  3ZED A;  4RQE A;  1R73 A;  5FPR A;  1K4D C;  5CMU A;  2JJ2 G;  4LFC B;  1OCC C;  2OCC C;  2VQF O;  3ABL C;  3JCU Z;  1MSW D;  4MTO A;  4JTC B;  5JCO A;  4TOI A;  3CC7 V;  2ZE7 A;  1H2G A;  3AG1 B;  1IBM O;  2UXD B; 
#chains in the Genus database with same CATH homology
 2AHY A;  1QLE B;  4H37 A;  3QNE A;  1NR7 A;  1FXK C;  1FFT B;  2OTJ V;  1Q82 W;  2UXX A;  4P30 A;  3ZCC A;  1ENV A;  1YJ9 V;  4FPP A;  5IYD O;  3JCZ A;  3RVZ A;  3FB7 C;  4R6Z A;  1AJN A;  3OE7 G;  2R9R B;  3A0R A;  3OMA B;  4RUE A;  1W2B U;  5B1N A;  1I5Y A;  2LP7 A;  3QO7 A;  1Y66 A;  1CEZ A;  2OTL V;  4I5S A;  3CME V;  2A79 B;  4PDL A;  3RW0 A;  1W0K G;  1VQ5 V;  1AI7 A;  2WLN A;  3CC4 V;  3BEH A;  1OCR C;  4G2K A;  3CC2 V;  1R6N A;  2IJJ A;  5IYC O;  4KUM A;  1KQS U;  5KUM A;  3ASN C;  5LGU A;  4BIU A;  2IU3 A;  1PD3 A;  3TCU A;  4JAV A;  1PNL A;  2ZXW B;  1E1Q G;  1L1F A;  5IDJ A;  3OEH G;  3F7Y C;  5IY5 B;  5LHG A;  2D3O W;  1OCZ C;  4MS2 A;  3CCM V;  1HWY A;  1PKX A;  5CN0 A;  4WFB V;  1M9N A;  3SPI A;  5L3D A;  1BHB A;  3LDE A;  1E79 G;  4BAY A;  3OFN G;  5H6R A;  3P30 A;  5DM6 V;  3G6E V;  2BOC C;  2EIN C;  1KP3 A;  3SJQ C;  3QO5 A;  3HPL C;  1RPO A;  1F4M A;  4R50 A;  3ABK C;  1NR1 A;  3OM3 B;  4G27 B;  3PJS K;  1K4C C;  3WFV A;  1VQO V;  2XND G;  2Q68 A;  1QVG U;  1GM7 A;  4R8C A;  5B3S B;  3GB7 C;  4LP8 A;  2WSS G;  2QA4 V;  4UVC A;  4PA4 A;  1EBO A;  1M56 B;  3LSQ A;  3FYE B;  2BOB C;  2HFE C;  3CCS V;  3X2Q C;  4CZZ A;  4EKW A;  1Q7Y W;  3E86 A;  3OUS A;  4TWK A;  5CBF A;  1S3J A;  3B8M A;  3JD3 A;  5B1A C;  3TET A;  3W7U A;  1F23 A;  4HYO A;  1AJP A;  3G71 V;  1FS0 G;  3JD2 A;  3ZMU A;  3P32 A;  3CP1 A;  3QO8 A;  3ZMT A;  3E8H A;  3SYA A;  2Y69 C;  4KFM A;  2W6J G;  4P9O A;  2H8P C;  4PA3 A;  3E8B A;  4U7N A;  5DN6 G;  2P90 A;  4FIP C;  2Q6A A;  4JAS A;  4KP4 A;  2IJK A;  3G4S V;  1FXH A;  1FXK A;  3IC7 A;  1K33 A;  3LDD A;  2HKO A;  3LUT B;  3ETD A;  3OMI B;  3SPH A;  2CK3 G;  3NXS A;  3R65 A;  2ZDI C;  2YSU B;  3ZRW B;  2XAJ A;  1YHQ V;  4Z1M G;  3ZN0 A;  1QR9 A;  2B5U A;  4GX2 A;  1NVP B;  2R9I A;  4RUF A;  1WLE A;  1AI5 A;  1JX9 A;  4E2L A;  3CCE V;  1KEC A;  4G28 B;  4Q20 A;  4WFE A;  1KC8 W;  1M57 B;  4DXW A;  1ROP A;  3CMA V;  3CYO A;  5EBW C;  2KB1 A;  4PA7 A;  1CP9 A;  3DGE A;  5GW7 A;  1KD1 W;  2EIK C;  3OR7 C;  1EFR G;  1QCE A;  1S76 D;  1VQ6 V;  2HVJ C;  3F7V C;  1K5Q A;  2EZO A;  3AEI A;  4QPJ A;  1J95 A;  3GWO A;  1YIT V;  3ASO C;  2NNU A;  4U7O A;  2WLL B;  1MAB G;  2JEX A;  3WG7 C;  1VQM V;  3AG2 B;  1H8E G;  4MTF A;  2M7W A;  2WLJ A;  4MVQ A;  2QE7 G;  1VQN V;  4JYC A;  2A0L A;  2EJR A;  1DF5 A;  1PNK A;  3ZRV A;  3UM7 A;  1NKD A;  1V55 C;  2X7R B;  1YIJ V;  5B1B C;  4JAU A;  5E1A C;  3K0D A;  1JQ0 A;  1R3J C;  3AG4 C;  4QIW F;  3STZ C;  5LBQ A;  1KP2 A;  4UUJ C;  2PI5 A;  5IYB O;  1I5X A;  1FXK B;  3AG2 C;  3MD0 A;  1COW G;  2OT5 A;  4LC1 A;  4P2Z A;  5B3S C;  1YSC A;  2DW4 A;  5EC2 C;  1QLN A;  1KKD A;  2EIJ C;  2QM7 A;  2YEV A;  4PA6 A;  3STL C;  4UV9 A;  2Q69 A;  1NBM G;  2IH3 C;  3CCQ V;  3EFF K;  4QJF B;  3E8G A;  1R3I C;  1AR1 B;  1WPX A;  2QEX V;  3CD6 V;  3T1C A;  4X8A A;  3K3W A;  1YJN V;  5HFL A;  3AG3 B;  2Y48 A;  5L3B A;  3FB6 C;  2K1E A;  3D36 A;  3HB3 B;  4MTX A;  2IH1 C;  4WF9 V;  1SER A;  1S72 V;  3JYC A;  4MT8 A;  2EIL B;  3F5W C;  2Y69 B;  4MVO A;  1PL0 A;  2EIJ B;  2P7T C;  2ZR3 A;  3CPW U;  5FL7 G;  4MVS A;  4JF3 A;  1IXM A;  1YTF D;  1K34 A;  1RM1 C;  2F43 G;  5KUK A;  2P67 A;  1NH2 B;  2JK5 C;  3K0G A;  2GSM B;  4QE9 A;  3JD1 A;  4TT3 G;  4N23 A;  3ZN1 A;  3FB8 C;  1K97 A;  5C93 A;  2WLM A;  5L3C A;  2QKS A;  2WAM A;  2WWW A;  2X6B A;  1F4N A;  1GK9 A;  1YI2 V;  4PDV A;  1XL4 A;  3AG1 C;  2XOK G;  3SYQ A;  1K7D A;  2WLI A;  3K06 A;  1W0J G;  3M99 B;  3DTU B;  1ARO P;  2WLH A;  4L87 A;  3ZRX A;  1GMG A;  4LBE C;  2EBO A;  1OCO B;  4MTG A;  1JPX A;  3T2M A;  1BHA A;  4WFA V;  2WLI B;  5CBH A;  2IJH A;  2DYR B;  5H6Q A;  4GX5 A;  1VQ7 V;  3E89 A;  3ZIA G;  5EBL C;  2IW5 A;  4UV8 A;  3ABL B;  3RVY A;  4XBF A;  2HLD G;  4DO2 A;  2ITC C;  5EK0 A;  4WFG A;  1NH2 D;  2XAG A;  2YEV B;  1XL6 A;  3ABM B;  2WPD G;  2X6A A;  2Z3Y A;  3H01 A;  1OCZ B;  3X2Q B;  2A9H A;  2ITD C;  4WFF A;  2MK3 A;  5L3F A;  1N8R W;  3JD4 A;  2X0L A;  3LSS A;  4GCZ A;  2DYS B;  4JPR A;  1LNQ A;  4MW3 A;  3RBZ A;  1JVM A;  3TK1 A;  3ZMV A;  3T4D A;  1V54 C;  4PDM A;  4X89 A;  1M57 C;  1PNM A;  1DLB A;  3CCJ V;  1ZWI C;  5HFM A;  3ABM C;  4UVA A;  2DQ0 A;  1BMF G;  4QPK A;  1K73 W;  3EHB B;  3E2E A;  5CA3 A;  5LHH A;  1P4R A;  3ZMS A;  2IJI A;  1M56 C;  5H9C A;  2JDI G;  3KG2 A;  4JTD B;  4MVR A;  1QVF U;  4X88 A;  3MHS C;  3JD0 A;  3LNM B;  1YJW V;  1M1K W;  4FJC C;  1R6K A;  1GKF A;  2JEU A;  3ASN B;  2EIN B;  1SZT A;  4MVM A;  1M90 W;  4J9Y B;  4UVB A;  4ZKI A;  5J9P C;  2UXN A;  3ABK B;  5IY5 C;  4HAM A;  1G4Y B;  1NJI W;  5B1O A;  3I56 V;  5KA6 A;  1EZJ A;  3SYC A;  3SPJ A;  1SES A;  5EC1 C;  5L3G A;  1P7B A;  1K9M W;  2JIZ G;  3FB5 C;  1YTF B;  1K3E A;  2Z5U A;  2XAQ A;  2DWE C;  4PDR A;  3ETE A;  3OUF A;  1DTO A;  2EZP A;  3I55 V;  2ZD9 A;  3E8F A;  3VOU A;  4F4L A;  1VQP V;  1UJW B;  1MOF A;  1JJ2 U;  3LDC A;  4RAI A;  1BL8 A;  1OCO C;  3UKM A;  1GM8 A;  3CCL V;  2QTO A;  3K79 A;  1E1R G;  1QR8 A;  1QBZ A;  5EBM C;  4YXW G;  4MW8 A;  4WCE V;  1GM9 A;  3CCR V;  4P9P A;  1Q81 W;  3W7W A;  4MVZ A;  3CXC U;  2V1D A;  2DWD C;  1VQ9 V;  1OCC B;  2NLJ C;  2OCC B;  1V55 B;  3W7S A;  4FK5 C;  4BIZ A;  1FXV A;  5LHI A;  1AI4 A;  2LFS A;  1VQL V;  3ETG A;  1NQT A;  2V7Q G;  1OHH G;  5KA5 A;  4QE7 A;  2B1I A;  2WLK A;  1GO3 F;  3ML0 A;  3WG7 B;  2HG5 C;  5L3E A;  1G8M A;  3AG3 C;  4I9W A;  3ZMZ A;  3ZRS A;  4GX1 A;  1RPR A;  3OGC C;  4J9Z B;  2ZXW C;  1VQ8 V;  4CBC A;  3E35 A;  1S77 D;  3OMN B;  2IU0 A;  3OEE G;  2HVK C;  1CPY A;  1K5S A;  2DQ3 A;  4RO2 A;  3K9A A;  2DYR C;  2ZQM A;  2B1G A;  1V54 B;  2XAS A;  2XAF A;  4LCU C;  4N21 A;  5CBG A;  2EIL C;  1VQ4 V;  4ZBM A;  1Q86 W;  3ASO B;  4R7C A;  1H38 A;  3OAA G;  4H33 A;  3CCU V;  2AHZ A;  3SPC A;  1VQK V;  1DF4 A;  3FYI B;  3K08 A;  1ORQ C;  4GT1 A;  2ATK C;  4ASU G;  4QNH B;  1OZ0 A;  2HJF C;  2WLL A;  1F51 A;  3OR6 C;  3SPG A;  3D3I A;  2JJ1 G;  1OCR B;  1JCH A;  3ABU A;  3K04 A;  4OXS A;  4PEL A;  3AG4 B;  2XAH A;  3BY6 A;  2ZR2 A;  1SRY A;  2GHY A;  5LGN A;  4WFH A;  4BW5 A;  1SET A;  3FKS G;  1R3K C;  4JYB A;  5LGT A;  3VBB A;  3IFX A;  1S5H C;  3K03 A;  4JGS A;  3E83 A;  3OW2 U;  4PA9 A;  2Q67 A;  2EIM C;  1B6Q A;  4RQF A;  3SYP A;  3SYO A;  2EIK B;  1K92 A;  1TUE B;  1THZ A;  2DYS C;  4JTA B;  2X6C A;  4FMT A;  1S0V A;  5B1A B;  2HR3 A;  1NVP D;  1AJQ A;  1RM1 B;  3B77 A;  2PI4 A;  2W0F C;  2C2A A;  4XDJ A;  4XDK A;  3ZRW A;  2W6I G;  4UXN A;  2H94 A;  4HZ3 A;  3W7X A;  1K8A W;  4TSF G;  2EIM B;  5BZB A;  3MHH C;  1MG1 A;  5B1B B;  1QLE C;  3CCV V;  1GTO A;  1Y4M A;  1JOY A;  4MVU A;  2FTK A;  1AI6 A;  4RQE A;  1R73 A;  4GX0 A;  1K4D C;  5CMU A;  2JJ2 G;  3ZJZ A;  1OCC C;  2OCC C;  1H8H G;  3B8N A;  2P6J A;  3ABL C;  3T4Z A;  1MSW D;  2LFR A;  4MTO A;  4JTC B;  3ABT A;  3W7T A;  4XDL A;  2QM8 A;  3CC7 V;  2ZDI A;  3IGA C;  1H2G A;  3AG1 B;  4MSW C;  1R3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...