2A9HA

Nmr structural studies of a potassium channel / charybdotoxin complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel
publication title Nuclear magnetic resonance structural studies of a potassium channel-charybdotoxin complex.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Metal transport, membrane protein
total genus 32
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2a9hA00
2HVJC 4GX5A 4RUFA 4P9OA 2YEVA 4MVZA 3WG7C 1LNQA 2DYRC 2OCCC 4WFHA 5BZBA 3SPIA 1V55C 2BOCC 3E83A 3AG2C 4P2ZA 3E8GA 1M57C 2WLLB 2DWEC 1ORQC 4GX2A 4MS2A 4PDMA 4J9YB 1OCRC 2EIJC 3SYAA 3ZJZA 3F7YC 4QNHB 4DXWA 3T2MA 3FB5C 3ABLC 5B3SC 4MTGA 3FB8C 2Q67A 3E89A 3LDEA 5IY5C 3LNMB 2A9HA 3LDDA 3SPHA 1M56C 4XDJA 2WLLA 2W0FC 2WLIB 3SYCA 1JVMA 3SYQA 2EIKC 4HZ3A 2ITCC 1XL6A 3OUSA 3LDCA 5EK0A 1R3LC 1P7BA 2ZD9A 3AG3C 4G28B 4HYOA 2ITDC 3T1CA 2KB1A 3RBZA 2BOBC 2NLJC 2WLIA 4PDVA 4PA3A 1R3IC 4H37A 2A0LA 2WLNA 1K4CC 4MW3A 3FB7C 3K08A 3F7VC 3X2QC 3ABKC 4RO2A 4R8CA 3K03A 2H8PC 3SYOA 2ZXWC 2WLHA 2X6BA 4XDLA 1KKDA 2X6AA 3OR6C 4TWKA 2WLJA 4X8AA 1ZWIC 4G27B 3E8FA 4XDKA 2Q69A 1OCCC 4MVMA 4WFFA 4KFMA 4J9ZB 2AHZA 2R9RB 3K04A 3E86A 1S5HC 5EC1C 4EKWA 3T4ZA 2EINC 2EIMC 4OXSA 5E1AC 3PJSK 1QLEC 2Q68A 4QE9A 4CBCA 2AHYA 4MVSA 1G4YB 2WLMA 3UKMA 3E8HA 3R65A 4PA4A 2QKSA 4H33A 3OR7C 4JTCB 4PA9A 2DYSC 4PDRA 1K4DC 3E8BA 1BL8A 5EBWC 4GX1A 3AG4C 4R6ZA 4LP8A 2IH3C 3SPGA 3STLC 1XL4A 4R7CA 5CBGA 2HFEC 3ABMC 3F5WC 4LBEC 3ASOC 4R50A 2HJFC 5KUKA 1OCZC 2P7TC 2K1EA 3IFXA 3K0DA 4JTDB 4MTFA 3RVYA 3UM7A 4F4LA 4PDLA 3BEHA 3AG1C 2EILC 5KUMA 3SPJA 4X88A 3SPCA 5CBHA 3ASNC 3IGAC 3RW0A 4MVQA 3VOUA 2WLKA 3ZRSA 4MW8A 3SJQC 1J95A 4RUEA 4UUJC 4MSWC 2ATKC 3STZC 3LUTB 4BW5A 5B1AC 4MVUA 2HG5C 4QE7A 4MVRA 1V54C 2X6CA 2A79B 1R3KC 2QTOA 3OGCC 3HPLC 3TCUA 3K0GA 4LCUC 5CBFA 3OUFA 5EC2C 4RAIA 3K06A 3EFFK 3JYCA 3KG2A 4ZBMA 4WFEA 3GB7C 4X89A 5B1BC 2JK5C 4MVOA 4PA6A 4JTAB 5J9PC 2IH1C 2Q6AA 4PA7A 3T4DA 5EBLC 3TETA 3FB6C 1R3JC 4GX0A 2HVKC 4P9PA 3SYPA 5EBMC 1OCOC 3RVZA 2DWDC 4WFGA 2Y69C 4P30A 4MTOA 4I9WA
chains in the Genus database with same CATH superfamily
1YJWV 4X20A 3N2KA 1VF6A 2DYRB 3AEIA 1SA0A 1YI2V 4LH6A 4B3TB 2F4VB 1MSDA 4U3JB 1NQTA 4GCZA 5B3SB 5IY5C 1SQXH 2L6LA 3H1LH 1AJQA 5LMNO 4H44B 3OUSA 3EXAA 3ZHRA 2OWOA 3ZMSA 1Q81W 5IYCO 4DV5B 1R3IC 2JVDA 4DW0A 2JEXA 4DR7O 4YY3B 1NTZH 1Y67A 2XUMA 3EVKA 1H38A 4XDKA 4LF9O 5GONA 5IY5B 4Q20A 4ZI7A 1OCCB 5IE9A 5EC1C 2E74B 1ROPA 3SDLA 2UUCB 1VQ4V 4AI8A 2YI9A 3OD4A 1G4YB 2BSKB 3AK3A 3E8HA 1EZVH 3OR7C 4B3SB 2UXBB 1VQ8V 4UFZA 4DUZB 2IH3C 4UVBA 4LF4B 3CCSV 4O2BB 1FAFA 1M1KW 5JQGB 4I50A 5KUMA 3CRRA 1VF5B 3ZRSA 1XBLA 4ZIBA 3D3IA 5GTHZ 1X59A 4ZHQA 1N32B 2H94A 3HKDA 1I0HA 3WU2Z 3J80N 3ABUA 3OM3B 2WA3A 5LBQA 2Q8VA 4OGQB 5H9CA 3CWBH 3OMAB 4B3TO 2ODMA 2F4VO 3MD0A 2DWDC 2Y69C 3CXHF 2Z0AA 4I9WA 5CA3A 1NTKH 4WFHA 2RJZA 1E79G 5CA1A 1V55B 1QVFU 1IX9A 1VQ7V 4X66B 3CCEV 2EIJB 2EJ7A 4K0KB 4DV5O 1VQLV 2EZOA 1VQKV 5KHGA 3B8NA 4K3AA 4CH3A 1M56B 4YY3O 1NH2B 5LMUB 1YCIA 1PNKA 2ZDIA 2IU3A 2EULA 1M4UA 2UXCO 5FL7G 2Y69B 1NS1A 4CC6A 3ZEDA 1N8RW 1R6KA 1MABG 3AK2A 5B5EZ 3CCUV 2CH7B 2M6YA 4FVMA 1N36B 2AGAA 4B3SO 1MZEA 2B1GA 5CN0A 3ZRWA 2ZM6B 5H2FZ 4NYKA 2AHZA 1NVPB 4LF4O 3CRMA 2Q5ZA 3QO7A 4BWAA 4EEQA 3RYCA 5C8YB 4H33A 4PA9A 3ZIAG 3ZHUA 2BTQA 2DW4A 3AG4C 1XL4A 4JV5B 3L73H 5IYZA 3ZHVA 3K57A 3HKCA 1S5JA 4D6TH 3SPCA 5IT9N 2HEPA 4X9QA 4FJCC 4QE7A 2X6CA 3JD3A 1GMGA 5B1AB 3ETGA 4D7SA 1MZFA 3K06A 3FAVA 1S77D 2P6JA 1O9HA 4MVOA 3ZHTA 1I5XA 2DOSA 4JAVA 1RM1C 4TQFA 5EBLC 1K34A 4X66O 4N23A 2F66C 5EBMC 2MK3A 2Q7GA 4K0KO 1XHZA 5KX5A 1XDCA 1GM8A 4U3JA 2CAZC 1JFFB 1KKCA 3SPIA 5LMUO 5LGUA 4W4LA 1YTFB 1PD3A 4LF5B 3CYOA 3FD9A 3ZJZA 2OT5A 4DXWA 2PZSA 3J7AU 3QTCA 3C90A 3D3QA 2YXYA 1N36O 3BVOA 4NTYA 3ZHQA 2ZE7A 3GWOA 1KBHA 4I55B 2ZM6O 2XHBA 4ZOLA 4K8ZA 4FPPA 4NKGB 1FXHA 3T1HB 1VARA 3FYIB 4FLXA 1Y4MA 4RO2A 4IHJB 3SYOA 2ZXWC 5BY1A 1Q86W 3P3PA 3HKBA 4CS2A 4F6EA 2F23A 1XHXA 4O2BA 5IWAB 1BZKA 5KAIZ 1QLEC 4MVSA 2R9AA 3HB3B 2ZQMA 2LW1A 2VRZA 2DYSC 4QGPA 1NBMG 1M93A 4UXNA 2LFSA 4JI3B 3TJTA 1DTOA 2ZXWB 2GUZA 4MTFA 3ABMB 1Q3EA 4MTXA 2OCHA 1J95A 1UJWB 4LH7A 1U97A 3OGCC 3HPLC 1QLEB 1WLEA 4RAIA 3RN4A 3UO3A 4PJ0Z 4WFEA 2LP7A 4LF5O 4YJ3B 4N21A 3OT7A 5IJ0B 1TAEA 2PF4E 4JI2B 2UXDB 4RUFA 4O4HB 4X1IB 3LSUA 2YS8A 3BRCA 1Q8IA 4Z2WA 3ABLC 3T1HO 4PELA 4WF9V 1JQ0A 1KU9A 3SYCA 2AZ0A 2FYUH 2CH7A 1F4MA 3CCRV 4JI1B 2BTOA 2D3OW 4UCSA 1SKVA 1SQFA 4EFEA 2NLJC 5IWAO 1K8AW 4B7EA 3JAWB 2DQ3A 2X6BA 4KHPB 2X6AA 3WB0A 4JI6B 2E76B 5J2UB 5KMGB 2RQ6A 3SR2C 5DECA 5L3CA 3JD4A 1EM1A 1KP3A 3IC9A 2R9RB 3U10A 1VQPV 1WB7A 1Q6IA 5A2QN 3RGBA 2DN9A 2XAJA 1DGSA 3H1KH 4UV9A 1WJZA 2Q68A 4QE9A 3ZBHA 2UUAB 2LO1A 2X0LA 3JAKB 2HP8A 1BL8A 1KECA 2NNUA 4QPJA 1RPRA 5KUKA 4I0XA 4JTDB 2UU9B 3RW0A 5LA6A 4MW8A 1S72V 2UUBB 1TA8A 1N33B 4PHZA 3OUFA 4JI2O 2UXDO 3A2FA 1NH2D 2Q6AA 1SQGA 4YHHO 3DGEA 4X1YA 1JMKC 4HBNA 2LW7A 4J7ZA 1OCOB 3H1HH 2YEVA 4O4JB 1K7DA 5JJNB 5BZBA 4DRXB 1SF9A 4JI1O 3ZX6A 1WNSA 1CXZB 1EN5A 4PDMA 4LF8O 4I55A 3F7YC 4JI8B 2RNBA 3CCQV 2XTAA 1NVPD 3L70H 2QKCA 3DXRB 4KHPO 4JI6O 4IGGA 3BHPA 3E2EA 2QSAA 1AP6A 2BOBC 2V7QG 1AI6A 3K9AA 4GKKB 2UUAO 2QA4V 3BPZA 1YDXA 3W7TA 3U0ZA 1FS0G 1KUQA 1RPOA 1G8MA 2QM7A 3K5MA 5EIBD 2YC0A 3CB2A 3TK1A 2UU9O 5D5QA 4JTCB 5DN6G 3K5LA 4GX1A 3CPWU 2QWOB 5L3FA 3IJ4A 2CTWA 3RYHA 2KG7A 3NXSA 4DV2B 5LMNB 1N33O 3HR0A 5CA0A 4CC5A 1XUQA 1JX9A 1GM7A 3VBBA 1YTFD 3C3SA 3OTOB 4DR7B 4TQDA 2GV9A 2N05A 5LHGA 1K73W 2KQXA 1F7YA 1BQ0A 1K5SA 4GYCB 2FMLA 4GX0A 1THZA 4P9PA 1GKFA 3QO8A 2Q0AA 1TUBB 2CTRA 3P3NA 2OYQA 1FJGO 2DYRC 3RYFA 4U3FH 3A0RA 4WCEV 3CP1A 4P2ZA 3JD2A 3AG2C 1XNQB 1ORQC 2P4KA 1P49A 2P4VA 4IT5A 5CB4B 2P67A 3MHHC 3FB5C 5B3SC 2ZT9B 2A7WA 4BAYA 3E22B 4GKKO 2W0FC 2ITCC 4WFBV 1BHAA 3JAWA 1KC8W 2EIKB 3CEIA 2ZD9A 3K79A 4FLVA 3UT5B 2R70A 2UXNA 2QWPB 5KMGA 2ZCEA 2R72A 2WLIA 2NR5A 3K5NA 4PA3A 1EBOA 3AG2B 3X2QC 2ZE8A 4DR5B 4FM0A 3ML0A 1XNRO 3CRAA 3JAKA 1FPOA 4G27B 2H3OA 1OCCC 1FXVA 1HNXB 4DV2O 2F1MA 4DR6O 5LP6B 1QCEA 1Z5VA 5FLXN 1Q5OA 3VQYA 2EIMB 2QWNB 3CJHB 1IBLO 2P90A 2QWQB 1MMMA 1J5EB 4O2AA 3OTOO 2Q7HA 3X2QB 4B08A 1IURA 2UXCB 1UFIA 5JH7A 1JJOA 3JCUZ 2WLKA 3H9VA 4DW1A 2B9ZA 4UUJC 4F6RB 2P06A 4U7NA 2VWJA 2A06H 3ZMTA 1RSOA 3GB7C 4O4JA 4TUYB 2JK5C 3ZN0A 4K8XA 1WP8A 1XNQO 2E3CA 2ZNIA 1RFYA 1YHQV 1AI5A 1B6QA 1IVSA 3K3WA 4MT8A 3ETDA 4LFAO 2GDSA 1V55C 3B09A 2RN9A 1HW7A 2EIJC 5DEDA 1FFXB 3T2MA 2F43G 1AROP 3BAAA 4J80A 3H01A 2YXLA 5B1NA 2YUAA 3N27A 1M56C 4OPAA 4IYIA 2WLLA 4Q6GA 3B8MA 2ILMA 4DR5O 1ZAUA 2Y0IA 3FFQA 3OE7G 2QJ1A 3I5DA 4NXMB 4O4IB 5EYPB 1FXKB 4I4TB 4AILC 1HNXO 1QLNA 4H37A 5L3DA 1AVMA 2XASA 4LC1A 2VQEB 1B06A 2JGUA 1YIJV 3N2GA 3IC7A 1H2NA 2Q69A 1J5EO 4ABMA 3CRQA 3BABA 2N04A 1XQ8A 5LYJB 4J10A 3PJSK 1SZXA 2AHYA 2YDEA 1AR5A 3JALB 1IBKB 4DR1B 4LP8A 2K9PA 3F5TA 1SESA 1D2DA 1QBZA 3IFXA 4TV9A 3FX7A 2EILC 1ZL8B 3G6BA 4FZ1A 3CCVV 2EJRA 1Z5WA 4RUEA 1VEWA 3STZC 3TGUH 5EIBC 5B1AC 4FLUA 5JVDB 4I9QA 1QR8A 2QTOA 1V54B 4CS3A 3JD1A 3KG2A 1JPXA 1H8EG 1TUBA 2GTSA 2JEUA 1PNMA 4PA7A 2HLDG 2Q9LA 3W7WA 5BXZA 1P4RA 5K1XA 5CB4A 1M9NA 2WPDG 2EILB 3WG7C 3BFRA 3E22A 1WP7A 4LF7B 1R6NA 3KKYA 4MS2A 4NXMO 3UQ8A 3SYAA 2IBZH 2F95B 1CEZA 4IIJB 2DQ0A 4JGSA 2PYJA 2W6JG 4YIOA 2VQEO 4UVAA 4J7JA 1P7BA 4NR1A 5J2TB 3AG3C 1JOYA 4PV1B 4UCRA 3RBZA 3WG7B 5KHHA 4FFBB 1R1BA 2GSMB 3RYIB 2JS3A 2O57A 2H8PC 3GWKC 4XDLA 4X8AA 1IBKO 3CJHA 1VIBA 1AJPA 4DR1O 4J42A 5KHKA 2PGGA 2Z3YA 3CE2A 5B1OA 4JYBA 2W6IG 5DM6V 2CGNA 1AP5A 2PI5A 1T5EA 4LFBB 4DK0A 3TXSA 2QE7G 2JDIG 3AG3B 1KD1W 3O9OA 4PDRA 4F6RA 1GH6A 3G4SV 3ABMC 3F5WC 1QU7A 4I5SA 4LBEC 4R50A 1ZTEA 1BHBA 2BSKA 1XREA 1WPBA 1XOUA 4TSFG 2BCCH 2QGNA 2QM4A 3VOUA 2P5OA 5LGTA 2EX3A 1WN7A 5BR8B 1K3EA 3OFNG 1GK9A 4QIWF 1R3KC 4WFAV 5JQGA 3LNNA 4Z1MG 4X65O 4UB8Z 2Q4PA 3JATB 4DV7O 3ZMZA 3CC7V 1YF2A 3JARB 4LF7O 3QF7A 4OX9B 5J9PC 1R3JC 3BY6A 4LFCO 3RVZA 1FFXA 4KL1A 4TT3G 1Q7YW 4J41A 4JPRA 2EZPA 2LGQA 4JI0B 1BE3H 2JIZG 4LNUB 1SZTA 3E8GA 1YITV 3H1IH 2V4DA 3PN1A 3MHSC 3MAQA 4O4IA 4PI0A 4I4TA 1QNMA 1P84F 1L8DA 5AG2A 3L74H 4O4LB 3ICXA 3CCMV 2OTJV 3LSSA 5EK0A 3JAMN 4LF6B 1H2GA 4YXWG 4LWSB 4DV0B 4LFBO 3BA8A 4PI2A 4YHHB 1Q43A 2WLJA 4L87A 3VQWA 3RWRD 1I94B 3JALA 3LSQA 1BT8A 4KFMA 4FMTA 1E1QG 4NB5A 3P30A 2CE4A 2DMXA 2KSDA 2ZIMA 5LOVB 4LF8B 1HR0B 4B3MB 2IU0A 2OTLV 1R6TA 1ZL8A 3E8BA 4CH6A 1EN4A 5BR8O 4DV4B 4JYCA 5LL6Y 4R7CA 1LUVA 5JVDA 1EN6A 3ASOC 2HJFC 3K0DA 5C8YA 3IGAC 3I55V 4OX9O 2XNDG 2ATKC 4DR3B 4MVRA 4RQEA 4JYAO 4JI0O 4G2KA 2DE0X 1QVGU 4X89A 2GTAA 1EFRG 3M99B 3UCSC 3B77A 1N4CA 1DF4A 3TETA 1EZJA 1M5IA 3ASOB 1OCOC 1XEQA 3O65A 2AZ2A 3SJCC 2UXXA 2QM8A 2HVJC 4GX5A 5LGNA 4DYLA 3ABTA 2YICA 2YXHA 1JA8A 3JASB 1B04A 2CK3G 1PNLA 2QDOA 1I5YA 2QKAA 3CX5F 1M57B 1NR7A 4QNHB 5E79Z 1OCRB 5J2TA 4LF6O 2ZNJA 1JFFA 3FB8C 5FPRA 5IYDO 4FFBA 1PKXA 4DV0O 5H6RA 1JVMA 3RYIA 1XL6A 2PY5A 5K1PA 1NU1H 2CTPA 1I94O 1U96A 5LXTB 1GRJA 2XAQA 3T1CA 4UCOA 1V9PA 5KHJA 4OPHA 1YJNV 4HNAB 2CDYA 5GONB 4TV8B 1AJNA 4ZI7B 1HDJA 3S3XA 1YVWA 4R8CA 1HR0O 4UCUA 4B3MO 5L3EA 4JI5O 5L3GA 2IW5A 2ARHA 4DV4O 1AB3A 3GVMA 1KMIZ 4MVMA 2JGDB 1FJGB 1N34O 4IHJA 5TISZ 2Y4UA 4EKWA 4H0LB 4NVPA 2XOKG 1OJHA 2AXTZ 3DSQA 1B3QA 1SRYA 1Q90D 4DR3O 3SGIA 2ZKOA 2FB5A 3M8AA 1Y74B 4DV1O 1VQMV 3RVYA 3W7UA 1SETA 3JATA 4L8JA 1ZLZA 1VMGA 3DC6A 1CP9A 3JARA 2ZR2A 4K35A 1ENVA 4BR6A 3ASNB 1QHTA 2JRIA 4LCUC 1H8HG 3B2EE 1XNRB 2FKXA 5JJEB 1HNWO 4JTAB 4DR6B 2IH1C 4NXNB 1WB8A 1FD9A 2IJHA 1LR1A 3SYPA 1N0JA 2P22C 4E2LA 2KKWA 2VQFB 4ZKIA 4NTWA 3ZHSA 4P9OA 1YEWA 1IBLB 1YXBA 2WSSG 2ZIOA 2YIBD 4O4LA 2JJ1G 4ICGA 4YJ3A 3BCCH 5IJ0A 1M90W 1K5QA 4CZZA 2LJ2A 4GLXA 4O4HA 2Q67A 4X1IA 3E89A 2HKOA 4GKJB 3LNMB 2PI4A 5ITZB 4LWSA 3EHBB 1K97A 4UVCA 2CUGA 2EIKC 4HAMA 2ZINA 4PDVA 3T1YB 4FM1A 3K08A 3F7VC 5LHIA 5LOVA 2D2CB 3KCYA 1BMFG 1GN2A 3RYCB 4LFAB 3L72H 3OTFA 5LP6C 1PPJH 5JJJB 4FLWA 3M7MX 5B66Z 1JCHA 5EZYB 4QPKA 2EIMC 4CBCA 5J2UA 1D5NA 3R65A 5FNVB 4BIZA 3HKCB 2ADPA 1O9GA 1Z2GA 3UO2A 2P7TC 4JZ2A 2B5UA 1SERA 1VQ9V 4NXNO 4E4EA 2NN4A 2IJKA 2VQFO 1G6UA 3G80A 4ZBMA 5KX5B 1PL4A 5B1BC 1W0KG 3OMIB 3K59A 3JASA 1SQQH 2FTKA 1SS3A 3WB1A 4GKJO 1GO3F 4KUMA 4A5UB 3IAYA 5KA6A 1VQ5V 1TUEB 5IJ9B 1Y76B 2N74A 2W0XA 4DUYO 5LXTA 4ZOLB 1S3JA 4DRXA 3T1YO 5B1BB 1PV0A 4HNAA 4TV8A 4TOIA 3SYQA 3APOA 2Z5UA 1YSCA 1FXKC 1ZUQA 2Q0OC 3ZMVA 2B1IA 2JGDA 2A0LA 4YJ2B 3RT3C 1H2SB 3DXRA 1S76D 3HKBB 4UB6Z 2HHHO 4DO2A 2Q73A 2EBOA 4FLZA 3A0BZ 1MNGA 4JI7O 1HWYA 1Y74A 2DJVA 1IXBA 3K9SA 3CD6V 1MSWD 2GUZB 1IDSA 3CHXA 4PA4A 2QKSA 4JF3A 5EBWC 2A3QA 1DK1A 3JSLA 4KXRA 4EFBA 1BSMA 4RWUA 2XAHA 2HFEC 4X64B 2IJJA 4F4LA 3UM7A 3CC4V 3P32A 1NZ6A 1DLBA 2X7RB 3G67A 2PYLA 4CH4A 4JYYA 2F93B 1V54C 5CBFA 3U11A 2JJ2G 3OEEG 1BQZA 3D8CA 1W2BU 5KLVH 1S5LZ 3ZMUA 3QG5A 4MTOA 4NTXA 4JI4B 4MVZA 2BE3A 1SQBH 5ITZA 3E83A 4CS4A 4J11A 2DWEC 4GX2A 3W7XA 2R9IA 2UUCO 1LUWA 5HFLA 3TXQA 1BS3A 3LDEA 2UXBO 3ETEA 4DUZO 3HKEB 1Q82W 1WA8B 3ZN1A 3LDCA 4BW9A 3CSXA 4X65B 1AI7A 1MOFA 1Q6HA 3H1JH 4DV7B 1W0JG 2KB1A 2Y4TA 3AK1A 2OIGA 5JCOC 1N32O 5EZYA 3AG7A 4JZGA 2WAMA 1A32A 3UT5A 4LFCB 2ADQB 3DTUB 3QVNA 3JSNA 1ZWIC 3Q4HB 5FNVA 4J9ZB 3K04A 4X64O 3T4ZA 4DR4B 3KZIZ 4X1KB 3K58A 4B3RB 3B4SA 4I0XB 5FPOA 1K33A 5LP6A 1KYOF 5LA6B 1MG1A 3JCZA 4R6ZA 5CBGA 3AG4B 4JAUA 1F4NA 3CS5A 5GW7A 4GZRB 1OCZC 1HNZB 2M7WA 1NR1A 3SPJA 5CBHA 1Y6XA 3J81N 1BGYH 5IYBO 4BW5A 1BCCH 3LUTB 3WFVA 3ZS8C 3TCUA 5HFMA 3W7SA 4JI4O 5EC2C 1JJ2U 4X1YB 1H2MA 1GM9A 4KP4A 2YEVB 4H13B 1ZSPA 1L0NH 2RDCA 3DC5A 3T4DA 3FB6C 1RM1B 5IJ9A 2MW2B 2CTQA 1Y76A 1XILA 1F51A 1OCZB 1VQOV 4TUYA 3K5OA 2WA4A 3QO5A 1LNQA 2OCCC 1WAZA 4WBNB 2XAGA 4J9YB 2JS5A 3APQA 1E1RG 1H2KA 2LQTA 3ZCCA 2ZR3A 4CH5A 3SPHA 3R66A 4YJ2A 1N0NA 1QQCA 5KA5A 4JV5O 1R3LC 2CGOA 1YJ9V 3CCLV 4JYAB 1Y66A 4HYOA 2ITDC 4DV6B 4FLYA 1XI1A 1NKDA 2OCCB 4DK1A 4FLTA 5L3BA 3G6EV 4DR4O 3A8TA 5EYPA 4B3RO 1FXKA 1KKDA 3OR6C 3L71H 1IZ3A 1TVKB 3CXCU 1KQSU 4I7ZB 4UV8A 3C3TA 3E86A 1S5HC 3QNEA 3RYHB 2KG7B 2VWKA 1HNZO 2WLMA 2XAFA 3UKMA 5CA0B 2PTMA 2HR3A 2DYSB 5LYJA 4EB6B 5D5PA 5BMVB 3B40A 5H5NA 3AG1C 2RCVA 2HJDA 4AHCA 3I56V 4MVQA 3D36C 3SJAC 4X62B 4MSWC 1XMQB 4FM2A 2HG5C 1FYJA 2YIAA 3K0GA 4JI5B 3EFFK 2G38A 4AQYB 1FFTB 1KP2A 1VF6C 1N34B 1XMOB 3RYFB 1WPXA 2E5LB 1X4TA 2Y48A 4DR2B 4BIOA 2QEXV 3L75H 5KAFZ 4XBFA 3VQVA 4P30A 3AG1B 1DF5A 2YIDA 2YI8A 3HKEA 5A9GA 1KB9F 1M57C 4BIUA 1WA8A 3FYEB 1GN3A 2OIEA 3OEHG 4DV1B 3OGIB 1OCRC 4FFKA 4J7KA 4LR3A 4DV6O 1FKAO 4MTGA 1IXMA 2ZE5A 3SJBC 1I08A 3ABLB 1IBMB 4X20B 2A9HA 3N2KB 1P7GA 2WLIB 2PUSA 4JI3O 4HZ3A 2IJIA 1OV9A 1SA0B 1NI8A 4C7UA 4IIJA 2QWRB 4G28B 3Q4HA 5GTIZ 1F23A 1HNWB 1VQNV 3THOA 3MDSA 2WWWA 3ABKC 1AI4A 3K03A 1GN4A 4JASA 4X1KA 4QJFB 2RMKB 2E75B 3E8FA 5CMUA 4GT1A 5JCOA 1PM9A 2YSUB 2YIBA 1K9MW 4O2AB 4JAAA 1TGOA 4OXSA 1D5AA 2XT9A 1I7FA 4ASUG 1OHHG 1PL0A 1MA1A 4X62O 1K4DC 2ETNA 5JH7B 1XMQO 2C2AA 1SQVH 1UPGA 1NJIW 5C93A 3ABKB 1CPYA 4DV3B 4RQFA 1JR9A 2K1EA 3OW2U 1HP8A 4PDLA 3L9DA 3BEHA 4AQYO 3VQXA 3ASNC 2LFRA 1RSOB 3CCJV 5F2VO 1XMOO 1AR4A 2E5LO 3A0HZ 4DR2O 3CMEV 4GUNA 1GTOA 1VQ6V 1QR9A 1PP9H 5H6QA 4I50B 3RFRA 4FIPC 2V1DA 4IYHA 3ETQA 2IM9A 4PA6A 4U7OA 1Q6UA 4WBNA 4ZHQB 3HKDB 4UCTA 1L1FA 4W4KA 1SQPH 1IBMO 2BOCC 3ZRXA 2VS0A 1VP7A 2WLLB 1NT2B 3CMAV 2ZDIC 4IL6Z 1VF7A 4Z1VA 4LNUA 3LDDA 3JD0A 1L0LH 4XDJA 2GBOA 3BA9A 3S3WA 5CA1B 5IDJA 4FK5C 1NTMH 5KHIA 2Q7EA 1SC5B 1S0VA 1TVKA 5LHHA 3N2GB 2UUBO 1AR1B 5JWPA 2WLNA 1K4CC 4MW3A 3FB7C 4B7KA 3CC2V 1K92A 1RP3B 2WLHA 4TWKA 2AW9A 4UCVA 1OZ0A 2QR4A 2QTSA 4WFFA 1W59A 2GHYA 4D7TA 4EB6A 4DV3O 1ZX3A 2EINC 5E1AC 5BMVA 4TV9B 3ZRWB 4DUYB 2Y0PA 2ZE6A 1GAXA 4LF9B 3SPGA 1GN6A 3STLC 4PD4F 3NR7A 3CRCA 4YIPA 4JI8O 4X88A 1US6A 1R73A 2BTQB 1AILA 3ZRVA 3SJQC 3G71V 4MVUA 2A79B 2EINB 2HHHB 4FZ0A 5IYZB 2L35A 3JYCA 3KCXA 1COWG 3FKSG 2FL4A 3D36A 4JI7B 3OAAG 3OMNB 1H2LA 2LGWA 3E35A 2HVKC 1G1XB 4WFGA 1URFA 3WB2A 1YZBA 3FAVB
chains in the Genus database with same CATH topology
4JPRA 2EZPA 1YJWV 2YEVA 4MVZA 1K7DA 2JIZG 5BZBA 3E83A 1SZTA 2DYRB 3E8GA 1YITV 2DWEC 3AEIA 4GX2A 3W7XA 2R9IA 4PDMA 1YI2V 3MHSC 3F7YC 5HFLA 3CCQV 1NQTA 3LDEA 1NVPD 4GCZA 5B3SB 5IY5C 3ETEA 1AJQA 1Q82W 3CCMV 3ZN1A 2OTJV 3OUSA 3LDCA 3LSSA 5EK0A 3ZMSA 1AI7A 1Q81W 3E2EA 1MOFA 1W0JG 2KB1A 2BOBC 1H2GA 5IYCO 4YXWG 1R3IC 2V7QG 1AI6A 3K9AA 2JEXA 2WAMA 2QA4V 3DTUB 2WLJA 3W7TA 4L87A 1H38A 1ZWIC 1FS0G 4XDKA 3LSQA 5IY5B 4Q20A 4KFMA 1RPOA 4FMTA 1E1QG 4J9ZB 3K04A 1OCCB 3P30A 1G8MA 2QM7A 5EC1C 3T4ZA 1ROPA 3TK1A 1VQ4V 2IU0A 1G4YB 3E8HA 2OTLV 3OR7C 4JTCB 1K33A 3E8BA 5DN6G 4GX1A 3CPWU 1VQ8V 4JYCA 5L3FA 1MG1A 3JCZA 2IH3C 3NXSA 4R6ZA 4UVBA 4R7CA 5CBGA 3AG4B 4JAUA 3CCSV 1F4NA 5GW7A 3ASOC 2HJFC 1OCZC 3K0DA 1M1KW 2M7WA 1JX9A 1NR1A 5KUMA 3SPJA 5CBHA 3IGAC 3I55V 3ZRSA 3D3IA 1GM7A 2H94A 2XNDG 3VBBA 2ATKC 5IYBO 3LUTB 4BW5A 1YTFD 3ABUA 4MVRA 3WFVA 3TCUA 5HFMA 3W7SA 3OM3B 5EC2C 4RQEA 1JJ2U 4G2KA 1QVGU 5LBQA 4X89A 1GM9A 4KP4A 1EFRG 3M99B 5LHGA 2YEVB 1K73W 3B77A 1DF4A 3T4DA 3TETA 3FB6C 1EZJA 1K5SA 5H9CA 3OMAB 1RM1B 4GX0A 1THZA 4P9PA 3ASOB 1GKFA 1OCOC 3QO8A 1F51A 1OCZB 3MD0A 2DWDC 2UXXA 1VQOV 2Y69C 2QM8A 4I9WA 2HVJC 4GX5A 3QO5A 5CA3A 5LGNA 1LNQA 2DYRC 2OCCC 3ABTA 4WFHA 3A0RA 4WCEV 3CP1A 4P2ZA 3JD2A 3AG2C 1E79G 2CK3G 2XAGA 1PNLA 1I5YA 1ORQC 1V55B 1QVFU 1M57B 4J9YB 1VQ7V 1NR7A 4QNHB 2P67A 3MHHC 1OCRB 2EIJB 3FB5C 1E1RG 3CCEV 5B3SC 3FB8C 3ZCCA 2ZR3A 1VQLV 5IYDO 4BAYA 2EZOA 3SPHA 1VQKV 1PKXA 2W0FC 3B8NA 5H6RA 1JVMA 1M56B 2ITCC 5KA5A 4WFBV 1XL6A 1NH2B 1BHAA 1KC8W 2EIKB 1R3LC 1PNKA 2ZD9A 3K79A 2ZDIA 2IU3A 1YJ9V 5FL7G 2Y69B 3CCLV 2UXNA 1Y66A 4HYOA 2ITDC 2XAQA 3T1CA 1N8RW 1NKDA 2WLIA 1R6KA 1MABG 2OCCB 4PA3A 1YJNV 1AJNA 1EBOA 3AG2B 3CCUV 3X2QC 5L3BA 4R8CA 3G6EV 5L3EA 3ML0A 1FXKA 1KKDA 3OR6C 5L3GA 2IW5A 2B1GA 5CN0A 3ZRWA 4G27B 3CXCU 1OCCC 4MVMA 1KQSU 1FXVA 4UV8A 2AHZA 1NVPB 3E86A 1S5HC 1QCEA 3QNEA 4EKWA 3QO7A 2XOKG 2EIMB 2WLMA 2XAFA 3UKMA 4H33A 4PA9A 3ZIAG 1SRYA 2P90A 2HR3A 2DW4A 2DYSB 3AG4C 1XL4A 3X2QB 1VQMV 3RVYA 3W7UA 1SETA 3AG1C 3SPCA 1CP9A 3I56V 4MVQA 2WLKA 2ZR2A 1ENVA 3ASNB 4UUJC 4MSWC 2HG5C 4FJCC 4QE7A 2X6CA 3JD3A 1GMGA 5B1AB 3ETGA 3K0GA 4LCUC 1H8HG 4U7NA 3K06A 3ZMTA 3EFFK 1S77D 2P6JA 3GB7C 1FFTB 2JK5C 4MVOA 3ZN0A 1KP2A 1I5XA 4JTAB 2IH1C 4JAVA 1RM1C 1WPXA 2Y48A 5EBLC 1K34A 2IJHA 1YHQV 2QEXV 3SYPA 1AI5A 4N23A 5EBMC 1B6QA 2MK3A 4E2LA 4XBFA 3K3WA 4P30A 4MT8A 1GM8A 3ETDA 3AG1B 4ZKIA 1DF5A 4P9OA 2WSSG 3SPIA 1V55C 2JJ1G 1M57C 5LGUA 4BIUA 3FYEB 1YTFB 3OEHG 1PD3A 1OCRC 2EIJC 3CYOA 3ZJZA 2OT5A 1M90W 1K5QA 4DXWA 3T2MA 4CZZA 2F43G 4MTGA 1IXMA 2Q67A 3E89A 1AROP 2HKOA 3ABLB 3H01A 3LNMB 2A9HA 2PI4A 5B1NA 1M56C 2WLLA 2WLIB 3B8MA 3EHBB 1K97A 2EIKC 2IJIA 4HZ3A 4UVCA 3OE7G 3GWOA 1FXKB 4G28B 4FPPA 4HAMA 1F23A 1FXHA 4PDVA 1VQNV 1QLNA 4H37A 3FYIB 2WWWA 1Y4MA 3K08A 3F7VC 5L3DA 3ABKC 1AI4A 2XASA 4LC1A 3K03A 4RO2A 5LHIA 3SYOA 2ZXWC 1BMFG 1YIJV 4JASA 4QJFB 1Q86W 3IC7A 3E8FA 5CMUA 2Q69A 4GT1A 2YSUB 1JCHA 1K9MW 4QPKA 2EIMC 4OXSA 3PJSK 1QLEC 4CBCA 2AHYA 4MVSA 1OHHG 4ASUG 1PL0A 3HB3B 2ZQMA 3R65A 2DYSC 4BIZA 1K4DC 1NBMG 2C2AA 4UXNA 4LP8A 2LFSA 1NJIW 5C93A 3ABKB 1CPYA 1DTOA 1SESA 4RQFA 1QBZA 2ZXWB 3IFXA 2P7TC 2K1EA 4MTFA 3ABMB 3OW2U 4MTXA 4PDLA 3BEHA 2B5UA 2EILC 1SERA 1VQ9V 3ASNC 2LFRA 3CCVV 3CCJV 2EJRA 1J95A 4RUEA 1UJWB 3CMEV 3STZC 5B1AC 1GTOA 1QR8A 2QTOA 3HPLC 3OGCC 1VQ6V 1QR9A 2IJKA 1V54B 1QLEB 1WLEA 4RAIA 5H6QA 3JD1A 3KG2A 4ZBMA 1JPXA 2V1DA 4FIPC 1H8EG 2LP7A 4WFEA 2JEUA 5B1BC 1PNMA 4PA6A 4U7OA 1W0KG 3OMIB 4PA7A 2HLDG 2FTKA 3W7WA 1P4RA 1L1FA 1M9NA 4N21A 2WPDG 1GO3F 4KUMA 2EILB 4RUFA 3WG7C 5KA6A 1VQ5V 2BOCC 3ZRXA 1TUEB 1R6NA 2WLLB 4MS2A 3CMAV 3SYAA 2ZDIC 1CEZA 3ABLC 2DQ0A 4JGSA 4PELA 1S3JA 4WF9V 3LDDA 2W6JG 3JD0A 5B1BB 1JQ0A 4XDJA 3SYCA 3SYQA 5IDJA 2Z5UA 1F4MA 4FK5C 4UVAA 3CCRV 2D3OW 1P7BA 1FXKC 1YSCA 1JOYA 1S0VA 3AG3C 3ZMVA 2B1IA 3RBZA 5LHHA 2NLJC 3WG7B 1AR1B 2A0LA 2WLNA 1K4CC 4MW3A 2GSMB 3FB7C 1S76D 1K8AW 3CC2V 2H8PC 4DO2A 1K92A 2DQ3A 2WLHA 2X6BA 4XDLA 2EBOA 2X6AA 4TWKA 4X8AA 1OZ0A 1AJPA 4WFFA 5L3CA 2Z3YA 3JD4A 1KP3A 2GHYA 2R9RB 1VQPV 5B1OA 4JYBA 2W6IG 5DM6V 2PI5A 1HWYA 2EINC 2XAJA 5E1AC 4UV9A 2Q68A 4QE9A 2QE7G 2X0LA 3CD6V 2JDIG 1MSWD 3AG3B 4PA4A 3ZRWB 2QKSA 1KD1W 4PDRA 1BL8A 1KECA 4JF3A 2NNUA 4QPJA 5EBWC 1RPRA 3SPGA 3STLC 3G4SV 2XAHA 2HFEC 3ABMC 3F5WC 4I5SA 2IJJA 4LBEC 4R50A 1BHBA 5KUKA 4JTDB 4F4LA 3UM7A 3CC4V 4TSFG 3P32A 1DLBA 2X7RB 4X88A 3RW0A 1R73A 3VOUA 5LGTA 4MW8A 1S72V 3ZRVA 3SJQC 3G71V 1K3EA 3OFNG 4MVUA 1V54C 1GK9A 2A79B 1R3KC 2EINB 4QIWF 4WFAV 4Z1MG 5CBFA 3OUFA 3JYCA 1COWG 3FKSG 2JJ2G 3ZMZA 3OEEG 3CC7V 3D36A 1W2BU 5J9PC 1NH2D 2Q6AA 3OAAG 3OMNB 1R3JC 3E35A 2HVKC 3BY6A 3RVZA 3DGEA 1Q7YW 4TT3G 3ZMUA 4WFGA 1OCOB 4MTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVJ C;  4GX5 A;  4RUF A;  4P9O A;  2YEV A;  4MVZ A;  3WG7 C;  1LNQ A;  2DYR C;  2OCC C;  4WFH A;  5BZB A;  3SPI A;  1V55 C;  2BOC C;  3E83 A;  3AG2 C;  4P2Z A;  3E8G A;  1M57 C;  2WLL B;  2DWE C;  1ORQ C;  4GX2 A;  4MS2 A;  4PDM A;  4J9Y B;  1OCR C;  2EIJ C;  3SYA A;  3ZJZ A;  3F7Y C;  4QNH B;  4DXW A;  3T2M A;  3FB5 C;  3ABL C;  5B3S C;  4MTG A;  3FB8 C;  2Q67 A;  3E89 A;  3LDE A;  5IY5 C;  3LNM B;  2A9H A;  3LDD A;  3SPH A;  1M56 C;  4XDJ A;  2WLL A;  2W0F C;  2WLI B;  3SYC A;  1JVM A;  3SYQ A;  2EIK C;  4HZ3 A;  2ITC C;  1XL6 A;  3OUS A;  3LDC A;  5EK0 A;  1R3L C;  1P7B A;  2ZD9 A;  3AG3 C;  4G28 B;  4HYO A;  2ITD C;  3T1C A;  2KB1 A;  3RBZ A;  2BOB C;  2NLJ C;  2WLI A;  4PDV A;  4PA3 A;  1R3I C;  4H37 A;  2A0L A;  2WLN A;  1K4C C;  4MW3 A;  3FB7 C;  3K08 A;  3F7V C;  3X2Q C;  3ABK C;  4RO2 A;  4R8C A;  3K03 A;  2H8P C;  3SYO A;  2ZXW C;  2WLH A;  2X6B A;  4XDL A;  1KKD A;  2X6A A;  3OR6 C;  4TWK A;  2WLJ A;  4X8A A;  1ZWI C;  4G27 B;  3E8F A;  4XDK A;  2Q69 A;  1OCC C;  4MVM A;  4WFF A;  4KFM A;  4J9Z B;  2AHZ A;  2R9R B;  3K04 A;  3E86 A;  1S5H C;  5EC1 C;  4EKW A;  3T4Z A;  2EIN C;  2EIM C;  4OXS A;  5E1A C;  3PJS K;  1QLE C;  2Q68 A;  4QE9 A;  4CBC A;  2AHY A;  4MVS A;  1G4Y B;  2WLM A;  3UKM A;  3E8H A;  3R65 A;  4PA4 A;  2QKS A;  4H33 A;  3OR7 C;  4JTC B;  4PA9 A;  2DYS C;  4PDR A;  1K4D C;  3E8B A;  1BL8 A;  5EBW C;  4GX1 A;  3AG4 C;  4R6Z A;  4LP8 A;  2IH3 C;  3SPG A;  3STL C;  1XL4 A;  4R7C A;  5CBG A;  2HFE C;  3ABM C;  3F5W C;  4LBE C;  3ASO C;  4R50 A;  2HJF C;  5KUK A;  1OCZ C;  2P7T C;  2K1E A;  3IFX A;  3K0D A;  4JTD B;  4MTF A;  3RVY A;  3UM7 A;  4F4L A;  4PDL A;  3BEH A;  3AG1 C;  2EIL C;  5KUM A;  3SPJ A;  4X88 A;  3SPC A;  5CBH A;  3ASN C;  3IGA C;  3RW0 A;  4MVQ A;  3VOU A;  2WLK A;  3ZRS A;  4MW8 A;  3SJQ C;  1J95 A;  4RUE A;  4UUJ C;  4MSW C;  2ATK C;  3STZ C;  3LUT B;  4BW5 A;  5B1A C;  4MVU A;  2HG5 C;  4QE7 A;  4MVR A;  1V54 C;  2X6C A;  2A79 B;  1R3K C;  2QTO A;  3OGC C;  3HPL C;  3TCU A;  3K0G A;  4LCU C;  5CBF A;  3OUF A;  5EC2 C;  4RAI A;  3K06 A;  3EFF K;  3JYC A;  3KG2 A;  4ZBM A;  4WFE A;  3GB7 C;  4X89 A;  5B1B C;  2JK5 C;  4MVO A;  4PA6 A;  4JTA B;  5J9P C;  2IH1 C;  2Q6A A;  4PA7 A;  3T4D A;  5EBL C;  3TET A;  3FB6 C;  1R3J C;  4GX0 A;  2HVK C;  4P9P A;  3SYP A;  5EBM C;  1OCO C;  3RVZ A;  2DWD C;  4WFG A;  2Y69 C;  4P30 A;  4MTO A;  4I9W A; 
#chains in the Genus database with same CATH topology
 1YJW V;  4X20 A;  3N2K A;  1VF6 A;  2DYR B;  3AEI A;  1SA0 A;  1YI2 V;  4LH6 A;  4B3T B;  2F4V B;  1MSD A;  4U3J B;  1NQT A;  4GCZ A;  5B3S B;  5IY5 C;  1SQX H;  2L6L A;  3H1L H;  1AJQ A;  5LMN O;  4H44 B;  3OUS A;  3EXA A;  3ZHR A;  2OWO A;  3ZMS A;  1Q81 W;  5IYC O;  4DV5 B;  1R3I C;  2JVD A;  4DW0 A;  2JEX A;  4DR7 O;  4YY3 B;  1NTZ H;  1Y67 A;  2XUM A;  3EVK A;  1H38 A;  4XDK A;  4LF9 O;  5GON A;  5IY5 B;  4Q20 A;  4ZI7 A;  1OCC B;  5IE9 A;  5EC1 C;  2E74 B;  1ROP A;  3SDL A;  2UUC B;  1VQ4 V;  4AI8 A;  2YI9 A;  3OD4 A;  1G4Y B;  2BSK B;  3AK3 A;  3E8H A;  1EZV H;  3OR7 C;  4B3S B;  2UXB B;  1VQ8 V;  4UFZ A;  4DUZ B;  2IH3 C;  4UVB A;  4LF4 B;  3CCS V;  4O2B B;  1FAF A;  1M1K W;  5JQG B;  4I50 A;  5KUM A;  3CRR A;  1VF5 B;  3ZRS A;  1XBL A;  4ZIB A;  3D3I A;  5GTH Z;  1X59 A;  4ZHQ A;  1N32 B;  2H94 A;  3HKD A;  1I0H A;  3WU2 Z;  3J80 N;  3ABU A;  3OM3 B;  2WA3 A;  5LBQ A;  2Q8V A;  4OGQ B;  5H9C A;  3CWB H;  3OMA B;  4B3T O;  2ODM A;  2F4V O;  3MD0 A;  2DWD C;  2Y69 C;  3CXH F;  2Z0A A;  4I9W A;  5CA3 A;  1NTK H;  4WFH A;  2RJZ A;  1E79 G;  5CA1 A;  1V55 B;  1QVF U;  1IX9 A;  1VQ7 V;  4X66 B;  3CCE V;  2EIJ B;  2EJ7 A;  4K0K B;  4DV5 O;  1VQL V;  2EZO A;  1VQK V;  5KHG A;  3B8N A;  4K3A A;  4CH3 A;  1M56 B;  4YY3 O;  1NH2 B;  5LMU B;  1YCI A;  1PNK A;  2ZDI A;  2IU3 A;  2EUL A;  1M4U A;  2UXC O;  5FL7 G;  2Y69 B;  1NS1 A;  4CC6 A;  3ZED A;  1N8R W;  1R6K A;  1MAB G;  3AK2 A;  5B5E Z;  3CCU V;  2CH7 B;  2M6Y A;  4FVM A;  1N36 B;  2AGA A;  4B3S O;  1MZE A;  2B1G A;  5CN0 A;  3ZRW A;  2ZM6 B;  5H2F Z;  4NYK A;  2AHZ A;  1NVP B;  4LF4 O;  3CRM A;  2Q5Z A;  3QO7 A;  4BWA A;  4EEQ A;  3RYC A;  5C8Y B;  4H33 A;  4PA9 A;  3ZIA G;  3ZHU A;  2BTQ A;  2DW4 A;  3AG4 C;  1XL4 A;  4JV5 B;  3L73 H;  5IYZ A;  3ZHV A;  3K57 A;  3HKC A;  1S5J A;  4D6T H;  3SPC A;  5IT9 N;  2HEP A;  4X9Q A;  4FJC C;  4QE7 A;  2X6C A;  3JD3 A;  1GMG A;  5B1A B;  3ETG A;  4D7S A;  1MZF A;  3K06 A;  3FAV A;  1S77 D;  2P6J A;  1O9H A;  4MVO A;  3ZHT A;  1I5X A;  2DOS A;  4JAV A;  1RM1 C;  4TQF A;  5EBL C;  1K34 A;  4X66 O;  4N23 A;  2F66 C;  5EBM C;  2MK3 A;  2Q7G A;  4K0K O;  1XHZ A;  5KX5 A;  1XDC A;  1GM8 A;  4U3J A;  2CAZ C;  1JFF B;  1KKC A;  3SPI A;  5LMU O;  5LGU A;  4W4L A;  1YTF B;  1PD3 A;  4LF5 B;  3CYO A;  3FD9 A;  3ZJZ A;  2OT5 A;  4DXW A;  2PZS A;  3J7A U;  3QTC A;  3C90 A;  3D3Q A;  2YXY A;  1N36 O;  3BVO A;  4NTY A;  3ZHQ A;  2ZE7 A;  3GWO A;  1KBH A;  4I55 B;  2ZM6 O;  2XHB A;  4ZOL A;  4K8Z A;  4FPP A;  4NKG B;  1FXH A;  3T1H B;  1VAR A;  3FYI B;  4FLX A;  1Y4M A;  4RO2 A;  4IHJ B;  3SYO A;  2ZXW C;  5BY1 A;  1Q86 W;  3P3P A;  3HKB A;  4CS2 A;  4F6E A;  2F23 A;  1XHX A;  4O2B A;  5IWA B;  1BZK A;  5KAI Z;  1QLE C;  4MVS A;  2R9A A;  3HB3 B;  2ZQM A;  2LW1 A;  2VRZ A;  2DYS C;  4QGP A;  1NBM G;  1M93 A;  4UXN A;  2LFS A;  4JI3 B;  3TJT A;  1DTO A;  2ZXW B;  2GUZ A;  4MTF A;  3ABM B;  1Q3E A;  4MTX A;  2OCH A;  1J95 A;  1UJW B;  4LH7 A;  1U97 A;  3OGC C;  3HPL C;  1QLE B;  1WLE A;  4RAI A;  3RN4 A;  3UO3 A;  4PJ0 Z;  4WFE A;  2LP7 A;  4LF5 O;  4YJ3 B;  4N21 A;  3OT7 A;  5IJ0 B;  1TAE A;  2PF4 E;  4JI2 B;  2UXD B;  4RUF A;  4O4H B;  4X1I B;  3LSU A;  2YS8 A;  3BRC A;  1Q8I A;  4Z2W A;  3ABL C;  3T1H O;  4PEL A;  4WF9 V;  1JQ0 A;  1KU9 A;  3SYC A;  2AZ0 A;  2FYU H;  2CH7 A;  1F4M A;  3CCR V;  4JI1 B;  2BTO A;  2D3O W;  4UCS A;  1SKV A;  1SQF A;  4EFE A;  2NLJ C;  5IWA O;  1K8A W;  4B7E A;  3JAW B;  2DQ3 A;  2X6B A;  4KHP B;  2X6A A;  3WB0 A;  4JI6 B;  2E76 B;  5J2U B;  5KMG B;  2RQ6 A;  3SR2 C;  5DEC A;  5L3C A;  3JD4 A;  1EM1 A;  1KP3 A;  3IC9 A;  2R9R B;  3U10 A;  1VQP V;  1WB7 A;  1Q6I A;  5A2Q N;  3RGB A;  2DN9 A;  2XAJ A;  1DGS A;  3H1K H;  4UV9 A;  1WJZ A;  2Q68 A;  4QE9 A;  3ZBH A;  2UUA B;  2LO1 A;  2X0L A;  3JAK B;  2HP8 A;  1BL8 A;  1KEC A;  2NNU A;  4QPJ A;  1RPR A;  5KUK A;  4I0X A;  4JTD B;  2UU9 B;  3RW0 A;  5LA6 A;  4MW8 A;  1S72 V;  2UUB B;  1TA8 A;  1N33 B;  4PHZ A;  3OUF A;  4JI2 O;  2UXD O;  3A2F A;  1NH2 D;  2Q6A A;  1SQG A;  4YHH O;  3DGE A;  4X1Y A;  1JMK C;  4HBN A;  2LW7 A;  4J7Z A;  1OCO B;  3H1H H;  2YEV A;  4O4J B;  1K7D A;  5JJN B;  5BZB A;  4DRX B;  1SF9 A;  4JI1 O;  3ZX6 A;  1WNS A;  1CXZ B;  1EN5 A;  4PDM A;  4LF8 O;  4I55 A;  3F7Y C;  4JI8 B;  2RNB A;  3CCQ V;  2XTA A;  1NVP D;  3L70 H;  2QKC A;  3DXR B;  4KHP O;  4JI6 O;  4IGG A;  3BHP A;  3E2E A;  2QSA A;  1AP6 A;  2BOB C;  2V7Q G;  1AI6 A;  3K9A A;  4GKK B;  2UUA O;  2QA4 V;  3BPZ A;  1YDX A;  3W7T A;  3U0Z A;  1FS0 G;  1KUQ A;  1RPO A;  1G8M A;  2QM7 A;  3K5M A;  5EIB D;  2YC0 A;  3CB2 A;  3TK1 A;  2UU9 O;  5D5Q A;  4JTC B;  5DN6 G;  3K5L A;  4GX1 A;  3CPW U;  2QWO B;  5L3F A;  3IJ4 A;  2CTW A;  3RYH A;  2KG7 A;  3NXS A;  4DV2 B;  5LMN B;  1N33 O;  3HR0 A;  5CA0 A;  4CC5 A;  1XUQ A;  1JX9 A;  1GM7 A;  3VBB A;  1YTF D;  3C3S A;  3OTO B;  4DR7 B;  4TQD A;  2GV9 A;  2N05 A;  5LHG A;  1K73 W;  2KQX A;  1F7Y A;  1BQ0 A;  1K5S A;  4GYC B;  2FML A;  4GX0 A;  1THZ A;  4P9P A;  1GKF A;  3QO8 A;  2Q0A A;  1TUB B;  2CTR A;  3P3N A;  2OYQ A;  1FJG O;  2DYR C;  3RYF A;  4U3F H;  3A0R A;  4WCE V;  3CP1 A;  4P2Z A;  3JD2 A;  3AG2 C;  1XNQ B;  1ORQ C;  2P4K A;  1P49 A;  2P4V A;  4IT5 A;  5CB4 B;  2P67 A;  3MHH C;  3FB5 C;  5B3S C;  2ZT9 B;  2A7W A;  4BAY A;  3E22 B;  4GKK O;  2W0F C;  2ITC C;  4WFB V;  1BHA A;  3JAW A;  1KC8 W;  2EIK B;  3CEI A;  2ZD9 A;  3K79 A;  4FLV A;  3UT5 B;  2R70 A;  2UXN A;  2QWP B;  5KMG A;  2ZCE A;  2R72 A;  2WLI A;  2NR5 A;  3K5N A;  4PA3 A;  1EBO A;  3AG2 B;  3X2Q C;  2ZE8 A;  4DR5 B;  4FM0 A;  3ML0 A;  1XNR O;  3CRA A;  3JAK A;  1FPO A;  4G27 B;  2H3O A;  1OCC C;  1FXV A;  1HNX B;  4DV2 O;  2F1M A;  4DR6 O;  5LP6 B;  1QCE A;  1Z5V A;  5FLX N;  1Q5O A;  3VQY A;  2EIM B;  2QWN B;  3CJH B;  1IBL O;  2P90 A;  2QWQ B;  1MMM A;  1J5E B;  4O2A A;  3OTO O;  2Q7H A;  3X2Q B;  4B08 A;  1IUR A;  2UXC B;  1UFI A;  5JH7 A;  1JJO A;  3JCU Z;  2WLK A;  3H9V A;  4DW1 A;  2B9Z A;  4UUJ C;  4F6R B;  2P06 A;  4U7N A;  2VWJ A;  2A06 H;  3ZMT A;  1RSO A;  3GB7 C;  4O4J A;  4TUY B;  2JK5 C;  3ZN0 A;  4K8X A;  1WP8 A;  1XNQ O;  2E3C A;  2ZNI A;  1RFY A;  1YHQ V;  1AI5 A;  1B6Q A;  1IVS A;  3K3W A;  4MT8 A;  3ETD A;  4LFA O;  2GDS A;  1V55 C;  3B09 A;  2RN9 A;  1HW7 A;  2EIJ C;  5DED A;  1FFX B;  3T2M A;  2F43 G;  1ARO P;  3BAA A;  4J80 A;  3H01 A;  2YXL A;  5B1N A;  2YUA A;  3N27 A;  1M56 C;  4OPA A;  4IYI A;  2WLL A;  4Q6G A;  3B8M A;  2ILM A;  4DR5 O;  1ZAU A;  2Y0I A;  3FFQ A;  3OE7 G;  2QJ1 A;  3I5D A;  4NXM B;  4O4I B;  5EYP B;  1FXK B;  4I4T B;  4AIL C;  1HNX O;  1QLN A;  4H37 A;  5L3D A;  1AVM A;  2XAS A;  4LC1 A;  2VQE B;  1B06 A;  2JGU A;  1YIJ V;  3N2G A;  3IC7 A;  1H2N A;  2Q69 A;  1J5E O;  4ABM A;  3CRQ A;  3BAB A;  2N04 A;  1XQ8 A;  5LYJ B;  4J10 A;  3PJS K;  1SZX A;  2AHY A;  2YDE A;  1AR5 A;  3JAL B;  1IBK B;  4DR1 B;  4LP8 A;  2K9P A;  3F5T A;  1SES A;  1D2D A;  1QBZ A;  3IFX A;  4TV9 A;  3FX7 A;  2EIL C;  1ZL8 B;  3G6B A;  4FZ1 A;  3CCV V;  2EJR A;  1Z5W A;  4RUE A;  1VEW A;  3STZ C;  3TGU H;  5EIB C;  5B1A C;  4FLU A;  5JVD B;  4I9Q A;  1QR8 A;  2QTO A;  1V54 B;  4CS3 A;  3JD1 A;  3KG2 A;  1JPX A;  1H8E G;  1TUB A;  2GTS A;  2JEU A;  1PNM A;  4PA7 A;  2HLD G;  2Q9L A;  3W7W A;  5BXZ A;  1P4R A;  5K1X A;  5CB4 A;  1M9N A;  2WPD G;  2EIL B;  3WG7 C;  3BFR A;  3E22 A;  1WP7 A;  4LF7 B;  1R6N A;  3KKY A;  4MS2 A;  4NXM O;  3UQ8 A;  3SYA A;  2IBZ H;  2F95 B;  1CEZ A;  4IIJ B;  2DQ0 A;  4JGS A;  2PYJ A;  2W6J G;  4YIO A;  2VQE O;  4UVA A;  4J7J A;  1P7B A;  4NR1 A;  5J2T B;  3AG3 C;  1JOY A;  4PV1 B;  4UCR A;  3RBZ A;  3WG7 B;  5KHH A;  4FFB B;  1R1B A;  2GSM B;  3RYI B;  2JS3 A;  2O57 A;  2H8P C;  3GWK C;  4XDL A;  4X8A A;  1IBK O;  3CJH A;  1VIB A;  1AJP A;  4DR1 O;  4J42 A;  5KHK A;  2PGG A;  2Z3Y A;  3CE2 A;  5B1O A;  4JYB A;  2W6I G;  5DM6 V;  2CGN A;  1AP5 A;  2PI5 A;  1T5E A;  4LFB B;  4DK0 A;  3TXS A;  2QE7 G;  2JDI G;  3AG3 B;  1KD1 W;  3O9O A;  4PDR A;  4F6R A;  1GH6 A;  3G4S V;  3ABM C;  3F5W C;  1QU7 A;  4I5S A;  4LBE C;  4R50 A;  1ZTE A;  1BHB A;  2BSK A;  1XRE A;  1WPB A;  1XOU A;  4TSF G;  2BCC H;  2QGN A;  2QM4 A;  3VOU A;  2P5O A;  5LGT A;  2EX3 A;  1WN7 A;  5BR8 B;  1K3E A;  3OFN G;  1GK9 A;  4QIW F;  1R3K C;  4WFA V;  5JQG A;  3LNN A;  4Z1M G;  4X65 O;  4UB8 Z;  2Q4P A;  3JAT B;  4DV7 O;  3ZMZ A;  3CC7 V;  1YF2 A;  3JAR B;  4LF7 O;  3QF7 A;  4OX9 B;  5J9P C;  1R3J C;  3BY6 A;  4LFC O;  3RVZ A;  1FFX A;  4KL1 A;  4TT3 G;  1Q7Y W;  4J41 A;  4JPR A;  2EZP A;  2LGQ A;  4JI0 B;  1BE3 H;  2JIZ G;  4LNU B;  1SZT A;  3E8G A;  1YIT V;  3H1I H;  2V4D A;  3PN1 A;  3MHS C;  3MAQ A;  4O4I A;  4PI0 A;  4I4T A;  1QNM A;  1P84 F;  1L8D A;  5AG2 A;  3L74 H;  4O4L B;  3ICX A;  3CCM V;  2OTJ V;  3LSS A;  5EK0 A;  3JAM N;  4LF6 B;  1H2G A;  4YXW G;  4LWS B;  4DV0 B;  4LFB O;  3BA8 A;  4PI2 A;  4YHH B;  1Q43 A;  2WLJ A;  4L87 A;  3VQW A;  3RWR D;  1I94 B;  3JAL A;  3LSQ A;  1BT8 A;  4KFM A;  4FMT A;  1E1Q G;  4NB5 A;  3P30 A;  2CE4 A;  2DMX A;  2KSD A;  2ZIM A;  5LOV B;  4LF8 B;  1HR0 B;  4B3M B;  2IU0 A;  2OTL V;  1R6T A;  1ZL8 A;  3E8B A;  4CH6 A;  1EN4 A;  5BR8 O;  4DV4 B;  4JYC A;  5LL6 Y;  4R7C A;  1LUV A;  5JVD A;  1EN6 A;  3ASO C;  2HJF C;  3K0D A;  5C8Y A;  3IGA C;  3I55 V;  4OX9 O;  2XND G;  2ATK C;  4DR3 B;  4MVR A;  4RQE A;  4JYA O;  4JI0 O;  4G2K A;  2DE0 X;  1QVG U;  4X89 A;  2GTA A;  1EFR G;  3M99 B;  3UCS C;  3B77 A;  1N4C A;  1DF4 A;  3TET A;  1EZJ A;  1M5I A;  3ASO B;  1OCO C;  1XEQ A;  3O65 A;  2AZ2 A;  3SJC C;  2UXX A;  2QM8 A;  2HVJ C;  4GX5 A;  5LGN A;  4DYL A;  3ABT A;  2YIC A;  2YXH A;  1JA8 A;  3JAS B;  1B04 A;  2CK3 G;  1PNL A;  2QDO A;  1I5Y A;  2QKA A;  3CX5 F;  1M57 B;  1NR7 A;  4QNH B;  5E79 Z;  1OCR B;  5J2T A;  4LF6 O;  2ZNJ A;  1JFF A;  3FB8 C;  5FPR A;  5IYD O;  4FFB A;  1PKX A;  4DV0 O;  5H6R A;  1JVM A;  3RYI A;  1XL6 A;  2PY5 A;  5K1P A;  1NU1 H;  2CTP A;  1I94 O;  1U96 A;  5LXT B;  1GRJ A;  2XAQ A;  3T1C A;  4UCO A;  1V9P A;  5KHJ A;  4OPH A;  1YJN V;  4HNA B;  2CDY A;  5GON B;  4TV8 B;  1AJN A;  4ZI7 B;  1HDJ A;  3S3X A;  1YVW A;  4R8C A;  1HR0 O;  4UCU A;  4B3M O;  5L3E A;  4JI5 O;  5L3G A;  2IW5 A;  2ARH A;  4DV4 O;  1AB3 A;  3GVM A;  1KMI Z;  4MVM A;  2JGD B;  1FJG B;  1N34 O;  4IHJ A;  5TIS Z;  2Y4U A;  4EKW A;  4H0L B;  4NVP A;  2XOK G;  1OJH A;  2AXT Z;  3DSQ A;  1B3Q A;  1SRY A;  1Q90 D;  4DR3 O;  3SGI A;  2ZKO A;  2FB5 A;  3M8A A;  1Y74 B;  4DV1 O;  1VQM V;  3RVY A;  3W7U A;  1SET A;  3JAT A;  4L8J A;  1ZLZ A;  1VMG A;  3DC6 A;  1CP9 A;  3JAR A;  2ZR2 A;  4K35 A;  1ENV A;  4BR6 A;  3ASN B;  1QHT A;  2JRI A;  4LCU C;  1H8H G;  3B2E E;  1XNR B;  2FKX A;  5JJE B;  1HNW O;  4JTA B;  4DR6 B;  2IH1 C;  4NXN B;  1WB8 A;  1FD9 A;  2IJH A;  1LR1 A;  3SYP A;  1N0J A;  2P22 C;  4E2L A;  2KKW A;  2VQF B;  4ZKI A;  4NTW A;  3ZHS A;  4P9O A;  1YEW A;  1IBL B;  1YXB A;  2WSS G;  2ZIO A;  2YIB D;  4O4L A;  2JJ1 G;  4ICG A;  4YJ3 A;  3BCC H;  5IJ0 A;  1M90 W;  1K5Q A;  4CZZ A;  2LJ2 A;  4GLX A;  4O4H A;  2Q67 A;  4X1I A;  3E89 A;  2HKO A;  4GKJ B;  3LNM B;  2PI4 A;  5ITZ B;  4LWS A;  3EHB B;  1K97 A;  4UVC A;  2CUG A;  2EIK C;  4HAM A;  2ZIN A;  4PDV A;  3T1Y B;  4FM1 A;  3K08 A;  3F7V C;  5LHI A;  5LOV A;  2D2C B;  3KCY A;  1BMF G;  1GN2 A;  3RYC B;  4LFA B;  3L72 H;  3OTF A;  5LP6 C;  1PPJ H;  5JJJ B;  4FLW A;  3M7M X;  5B66 Z;  1JCH A;  5EZY B;  4QPK A;  2EIM C;  4CBC A;  5J2U A;  1D5N A;  3R65 A;  5FNV B;  4BIZ A;  3HKC B;  2ADP A;  1O9G A;  1Z2G A;  3UO2 A;  2P7T C;  4JZ2 A;  2B5U A;  1SER A;  1VQ9 V;  4NXN O;  4E4E A;  2NN4 A;  2IJK A;  2VQF O;  1G6U A;  3G80 A;  4ZBM A;  5KX5 B;  1PL4 A;  5B1B C;  1W0K G;  3OMI B;  3K59 A;  3JAS A;  1SQQ H;  2FTK A;  1SS3 A;  3WB1 A;  4GKJ O;  1GO3 F;  4KUM A;  4A5U B;  3IAY A;  5KA6 A;  1VQ5 V;  1TUE B;  5IJ9 B;  1Y76 B;  2N74 A;  2W0X A;  4DUY O;  5LXT A;  4ZOL B;  1S3J A;  4DRX A;  3T1Y O;  5B1B B;  1PV0 A;  4HNA A;  4TV8 A;  4TOI A;  3SYQ A;  3APO A;  2Z5U A;  1YSC A;  1FXK C;  1ZUQ A;  2Q0O C;  3ZMV A;  2B1I A;  2JGD A;  2A0L A;  4YJ2 B;  3RT3 C;  1H2S B;  3DXR A;  1S76 D;  3HKB B;  4UB6 Z;  2HHH O;  4DO2 A;  2Q73 A;  2EBO A;  4FLZ A;  3A0B Z;  1MNG A;  4JI7 O;  1HWY A;  1Y74 A;  2DJV A;  1IXB A;  3K9S A;  3CD6 V;  1MSW D;  2GUZ B;  1IDS A;  3CHX A;  4PA4 A;  2QKS A;  4JF3 A;  5EBW C;  2A3Q A;  1DK1 A;  3JSL A;  4KXR A;  4EFB A;  1BSM A;  4RWU A;  2XAH A;  2HFE C;  4X64 B;  2IJJ A;  4F4L A;  3UM7 A;  3CC4 V;  3P32 A;  1NZ6 A;  1DLB A;  2X7R B;  3G67 A;  2PYL A;  4CH4 A;  4JYY A;  2F93 B;  1V54 C;  5CBF A;  3U11 A;  2JJ2 G;  3OEE G;  1BQZ A;  3D8C A;  1W2B U;  5KLV H;  1S5L Z;  3ZMU A;  3QG5 A;  4MTO A;  4NTX A;  4JI4 B;  4MVZ A;  2BE3 A;  1SQB H;  5ITZ A;  3E83 A;  4CS4 A;  4J11 A;  2DWE C;  4GX2 A;  3W7X A;  2R9I A;  2UUC O;  1LUW A;  5HFL A;  3TXQ A;  1BS3 A;  3LDE A;  2UXB O;  3ETE A;  4DUZ O;  3HKE B;  1Q82 W;  1WA8 B;  3ZN1 A;  3LDC A;  4BW9 A;  3CSX A;  4X65 B;  1AI7 A;  1MOF A;  1Q6H A;  3H1J H;  4DV7 B;  1W0J G;  2KB1 A;  2Y4T A;  3AK1 A;  2OIG A;  5JCO C;  1N32 O;  5EZY A;  3AG7 A;  4JZG A;  2WAM A;  1A32 A;  3UT5 A;  4LFC B;  2ADQ B;  3DTU B;  3QVN A;  3JSN A;  1ZWI C;  3Q4H B;  5FNV A;  4J9Z B;  3K04 A;  4X64 O;  3T4Z A;  4DR4 B;  3KZI Z;  4X1K B;  3K58 A;  4B3R B;  3B4S A;  4I0X B;  5FPO A;  1K33 A;  5LP6 A;  1KYO F;  5LA6 B;  1MG1 A;  3JCZ A;  4R6Z A;  5CBG A;  3AG4 B;  4JAU A;  1F4N A;  3CS5 A;  5GW7 A;  4GZR B;  1OCZ C;  1HNZ B;  2M7W A;  1NR1 A;  3SPJ A;  5CBH A;  1Y6X A;  3J81 N;  1BGY H;  5IYB O;  4BW5 A;  1BCC H;  3LUT B;  3WFV A;  3ZS8 C;  3TCU A;  5HFM A;  3W7S A;  4JI4 O;  5EC2 C;  1JJ2 U;  4X1Y B;  1H2M A;  1GM9 A;  4KP4 A;  2YEV B;  4H13 B;  1ZSP A;  1L0N H;  2RDC A;  3DC5 A;  3T4D A;  3FB6 C;  1RM1 B;  5IJ9 A;  2MW2 B;  2CTQ A;  1Y76 A;  1XIL A;  1F51 A;  1OCZ B;  1VQO V;  4TUY A;  3K5O A;  2WA4 A;  3QO5 A;  1LNQ A;  2OCC C;  1WAZ A;  4WBN B;  2XAG A;  4J9Y B;  2JS5 A;  3APQ A;  1E1R G;  1H2K A;  2LQT A;  3ZCC A;  2ZR3 A;  4CH5 A;  3SPH A;  3R66 A;  4YJ2 A;  1N0N A;  1QQC A;  5KA5 A;  4JV5 O;  1R3L C;  2CGO A;  1YJ9 V;  3CCL V;  4JYA B;  1Y66 A;  4HYO A;  2ITD C;  4DV6 B;  4FLY A;  1XI1 A;  1NKD A;  2OCC B;  4DK1 A;  4FLT A;  5L3B A;  3G6E V;  4DR4 O;  3A8T A;  5EYP A;  4B3R O;  1FXK A;  1KKD A;  3OR6 C;  3L71 H;  1IZ3 A;  1TVK B;  3CXC U;  1KQS U;  4I7Z B;  4UV8 A;  3C3T A;  3E86 A;  1S5H C;  3QNE A;  3RYH B;  2KG7 B;  2VWK A;  1HNZ O;  2WLM A;  2XAF A;  3UKM A;  5CA0 B;  2PTM A;  2HR3 A;  2DYS B;  5LYJ A;  4EB6 B;  5D5P A;  5BMV B;  3B40 A;  5H5N A;  3AG1 C;  2RCV A;  2HJD A;  4AHC A;  3I56 V;  4MVQ A;  3D36 C;  3SJA C;  4X62 B;  4MSW C;  1XMQ B;  4FM2 A;  2HG5 C;  1FYJ A;  2YIA A;  3K0G A;  4JI5 B;  3EFF K;  2G38 A;  4AQY B;  1FFT B;  1KP2 A;  1VF6 C;  1N34 B;  1XMO B;  3RYF B;  1WPX A;  2E5L B;  1X4T A;  2Y48 A;  4DR2 B;  4BIO A;  2QEX V;  3L75 H;  5KAF Z;  4XBF A;  3VQV A;  4P30 A;  3AG1 B;  1DF5 A;  2YID A;  2YI8 A;  3HKE A;  5A9G A;  1KB9 F;  1M57 C;  4BIU A;  1WA8 A;  3FYE B;  1GN3 A;  2OIE A;  3OEH G;  4DV1 B;  3OGI B;  1OCR C;  4FFK A;  4J7K A;  4LR3 A;  4DV6 O;  1FKA O;  4MTG A;  1IXM A;  2ZE5 A;  3SJB C;  1I08 A;  3ABL B;  1IBM B;  4X20 B;  2A9H A;  3N2K B;  1P7G A;  2WLI B;  2PUS A;  4JI3 O;  4HZ3 A;  2IJI A;  1OV9 A;  1SA0 B;  1NI8 A;  4C7U A;  4IIJ A;  2QWR B;  4G28 B;  3Q4H A;  5GTI Z;  1F23 A;  1HNW B;  1VQN V;  3THO A;  3MDS A;  2WWW A;  3ABK C;  1AI4 A;  3K03 A;  1GN4 A;  4JAS A;  4X1K A;  4QJF B;  2RMK B;  2E75 B;  3E8F A;  5CMU A;  4GT1 A;  5JCO A;  1PM9 A;  2YSU B;  2YIB A;  1K9M W;  4O2A B;  4JAA A;  1TGO A;  4OXS A;  1D5A A;  2XT9 A;  1I7F A;  4ASU G;  1OHH G;  1PL0 A;  1MA1 A;  4X62 O;  1K4D C;  2ETN A;  5JH7 B;  1XMQ O;  2C2A A;  1SQV H;  1UPG A;  1NJI W;  5C93 A;  3ABK B;  1CPY A;  4DV3 B;  4RQF A;  1JR9 A;  2K1E A;  3OW2 U;  1HP8 A;  4PDL A;  3L9D A;  3BEH A;  4AQY O;  3VQX A;  3ASN C;  2LFR A;  1RSO B;  3CCJ V;  5F2V O;  1XMO O;  1AR4 A;  2E5L O;  3A0H Z;  4DR2 O;  3CME V;  4GUN A;  1GTO A;  1VQ6 V;  1QR9 A;  1PP9 H;  5H6Q A;  4I50 B;  3RFR A;  4FIP C;  2V1D A;  4IYH A;  3ETQ A;  2IM9 A;  4PA6 A;  4U7O A;  1Q6U A;  4WBN A;  4ZHQ B;  3HKD B;  4UCT A;  1L1F A;  4W4K A;  1SQP H;  1IBM O;  2BOC C;  3ZRX A;  2VS0 A;  1VP7 A;  2WLL B;  1NT2 B;  3CMA V;  2ZDI C;  4IL6 Z;  1VF7 A;  4Z1V A;  4LNU A;  3LDD A;  3JD0 A;  1L0L H;  4XDJ A;  2GBO A;  3BA9 A;  3S3W A;  5CA1 B;  5IDJ A;  4FK5 C;  1NTM H;  5KHI A;  2Q7E A;  1SC5 B;  1S0V A;  1TVK A;  5LHH A;  3N2G B;  2UUB O;  1AR1 B;  5JWP A;  2WLN A;  1K4C C;  4MW3 A;  3FB7 C;  4B7K A;  3CC2 V;  1K92 A;  1RP3 B;  2WLH A;  4TWK A;  2AW9 A;  4UCV A;  1OZ0 A;  2QR4 A;  2QTS A;  4WFF A;  1W59 A;  2GHY A;  4D7T A;  4EB6 A;  4DV3 O;  1ZX3 A;  2EIN C;  5E1A C;  5BMV A;  4TV9 B;  3ZRW B;  4DUY B;  2Y0P A;  2ZE6 A;  1GAX A;  4LF9 B;  3SPG A;  1GN6 A;  3STL C;  4PD4 F;  3NR7 A;  3CRC A;  4YIP A;  4JI8 O;  4X88 A;  1US6 A;  1R73 A;  2BTQ B;  1AIL A;  3ZRV A;  3SJQ C;  3G71 V;  4MVU A;  2A79 B;  2EIN B;  2HHH B;  4FZ0 A;  5IYZ B;  2L35 A;  3JYC A;  3KCX A;  1COW G;  3FKS G;  2FL4 A;  3D36 A;  4JI7 B;  3OAA G;  3OMN B;  1H2L A;  2LGW A;  3E35 A;  2HVK C;  1G1X B;  4WFG A;  1URF A;  3WB2 A;  1YZB A;  3FAV B; 
#chains in the Genus database with same CATH homology
 4JPR A;  2EZP A;  1YJW V;  2YEV A;  4MVZ A;  1K7D A;  2JIZ G;  5BZB A;  3E83 A;  1SZT A;  2DYR B;  3E8G A;  1YIT V;  2DWE C;  3AEI A;  4GX2 A;  3W7X A;  2R9I A;  4PDM A;  1YI2 V;  3MHS C;  3F7Y C;  5HFL A;  3CCQ V;  1NQT A;  3LDE A;  1NVP D;  4GCZ A;  5B3S B;  5IY5 C;  3ETE A;  1AJQ A;  1Q82 W;  3CCM V;  3ZN1 A;  2OTJ V;  3OUS A;  3LDC A;  3LSS A;  5EK0 A;  3ZMS A;  1AI7 A;  1Q81 W;  3E2E A;  1MOF A;  1W0J G;  2KB1 A;  2BOB C;  1H2G A;  5IYC O;  4YXW G;  1R3I C;  2V7Q G;  1AI6 A;  3K9A A;  2JEX A;  2WAM A;  2QA4 V;  3DTU B;  2WLJ A;  3W7T A;  4L87 A;  1H38 A;  1ZWI C;  1FS0 G;  4XDK A;  3LSQ A;  5IY5 B;  4Q20 A;  4KFM A;  1RPO A;  4FMT A;  1E1Q G;  4J9Z B;  3K04 A;  1OCC B;  3P30 A;  1G8M A;  2QM7 A;  5EC1 C;  3T4Z A;  1ROP A;  3TK1 A;  1VQ4 V;  2IU0 A;  1G4Y B;  3E8H A;  2OTL V;  3OR7 C;  4JTC B;  1K33 A;  3E8B A;  5DN6 G;  4GX1 A;  3CPW U;  1VQ8 V;  4JYC A;  5L3F A;  1MG1 A;  3JCZ A;  2IH3 C;  3NXS A;  4R6Z A;  4UVB A;  4R7C A;  5CBG A;  3AG4 B;  4JAU A;  3CCS V;  1F4N A;  5GW7 A;  3ASO C;  2HJF C;  1OCZ C;  3K0D A;  1M1K W;  2M7W A;  1JX9 A;  1NR1 A;  5KUM A;  3SPJ A;  5CBH A;  3IGA C;  3I55 V;  3ZRS A;  3D3I A;  1GM7 A;  2H94 A;  2XND G;  3VBB A;  2ATK C;  5IYB O;  3LUT B;  4BW5 A;  1YTF D;  3ABU A;  4MVR A;  3WFV A;  3TCU A;  5HFM A;  3W7S A;  3OM3 B;  5EC2 C;  4RQE A;  1JJ2 U;  4G2K A;  1QVG U;  5LBQ A;  4X89 A;  1GM9 A;  4KP4 A;  1EFR G;  3M99 B;  5LHG A;  2YEV B;  1K73 W;  3B77 A;  1DF4 A;  3T4D A;  3TET A;  3FB6 C;  1EZJ A;  1K5S A;  5H9C A;  3OMA B;  1RM1 B;  4GX0 A;  1THZ A;  4P9P A;  3ASO B;  1GKF A;  1OCO C;  3QO8 A;  1F51 A;  1OCZ B;  3MD0 A;  2DWD C;  2UXX A;  1VQO V;  2Y69 C;  2QM8 A;  4I9W A;  2HVJ C;  4GX5 A;  3QO5 A;  5CA3 A;  5LGN A;  1LNQ A;  2DYR C;  2OCC C;  3ABT A;  4WFH A;  3A0R A;  4WCE V;  3CP1 A;  4P2Z A;  3JD2 A;  3AG2 C;  1E79 G;  2CK3 G;  2XAG A;  1PNL A;  1I5Y A;  1ORQ C;  1V55 B;  1QVF U;  1M57 B;  4J9Y B;  1VQ7 V;  1NR7 A;  4QNH B;  2P67 A;  3MHH C;  1OCR B;  2EIJ B;  3FB5 C;  1E1R G;  3CCE V;  5B3S C;  3FB8 C;  3ZCC A;  2ZR3 A;  1VQL V;  5IYD O;  4BAY A;  2EZO A;  3SPH A;  1VQK V;  1PKX A;  2W0F C;  3B8N A;  5H6R A;  1JVM A;  1M56 B;  2ITC C;  5KA5 A;  4WFB V;  1XL6 A;  1NH2 B;  1BHA A;  1KC8 W;  2EIK B;  1R3L C;  1PNK A;  2ZD9 A;  3K79 A;  2ZDI A;  2IU3 A;  1YJ9 V;  5FL7 G;  2Y69 B;  3CCL V;  2UXN A;  1Y66 A;  4HYO A;  2ITD C;  2XAQ A;  3T1C A;  1N8R W;  1NKD A;  2WLI A;  1R6K A;  1MAB G;  2OCC B;  4PA3 A;  1YJN V;  1AJN A;  1EBO A;  3AG2 B;  3CCU V;  3X2Q C;  5L3B A;  4R8C A;  3G6E V;  5L3E A;  3ML0 A;  1FXK A;  1KKD A;  3OR6 C;  5L3G A;  2IW5 A;  2B1G A;  5CN0 A;  3ZRW A;  4G27 B;  3CXC U;  1OCC C;  4MVM A;  1KQS U;  1FXV A;  4UV8 A;  2AHZ A;  1NVP B;  3E86 A;  1S5H C;  1QCE A;  3QNE A;  4EKW A;  3QO7 A;  2XOK G;  2EIM B;  2WLM A;  2XAF A;  3UKM A;  4H33 A;  4PA9 A;  3ZIA G;  1SRY A;  2P90 A;  2HR3 A;  2DW4 A;  2DYS B;  3AG4 C;  1XL4 A;  3X2Q B;  1VQM V;  3RVY A;  3W7U A;  1SET A;  3AG1 C;  3SPC A;  1CP9 A;  3I56 V;  4MVQ A;  2WLK A;  2ZR2 A;  1ENV A;  3ASN B;  4UUJ C;  4MSW C;  2HG5 C;  4FJC C;  4QE7 A;  2X6C A;  3JD3 A;  1GMG A;  5B1A B;  3ETG A;  3K0G A;  4LCU C;  1H8H G;  4U7N A;  3K06 A;  3ZMT A;  3EFF K;  1S77 D;  2P6J A;  3GB7 C;  1FFT B;  2JK5 C;  4MVO A;  3ZN0 A;  1KP2 A;  1I5X A;  4JTA B;  2IH1 C;  4JAV A;  1RM1 C;  1WPX A;  2Y48 A;  5EBL C;  1K34 A;  2IJH A;  1YHQ V;  2QEX V;  3SYP A;  1AI5 A;  4N23 A;  5EBM C;  1B6Q A;  2MK3 A;  4E2L A;  4XBF A;  3K3W A;  4P30 A;  4MT8 A;  1GM8 A;  3ETD A;  3AG1 B;  4ZKI A;  1DF5 A;  4P9O A;  2WSS G;  3SPI A;  1V55 C;  2JJ1 G;  1M57 C;  5LGU A;  4BIU A;  3FYE B;  1YTF B;  3OEH G;  1PD3 A;  1OCR C;  2EIJ C;  3CYO A;  3ZJZ A;  2OT5 A;  1M90 W;  1K5Q A;  4DXW A;  3T2M A;  4CZZ A;  2F43 G;  4MTG A;  1IXM A;  2Q67 A;  3E89 A;  1ARO P;  2HKO A;  3ABL B;  3H01 A;  3LNM B;  2A9H A;  2PI4 A;  5B1N A;  1M56 C;  2WLL A;  2WLI B;  3B8M A;  3EHB B;  1K97 A;  2EIK C;  2IJI A;  4HZ3 A;  4UVC A;  3OE7 G;  3GWO A;  1FXK B;  4G28 B;  4FPP A;  4HAM A;  1F23 A;  1FXH A;  4PDV A;  1VQN V;  1QLN A;  4H37 A;  3FYI B;  2WWW A;  1Y4M A;  3K08 A;  3F7V C;  5L3D A;  3ABK C;  1AI4 A;  2XAS A;  4LC1 A;  3K03 A;  4RO2 A;  5LHI A;  3SYO A;  2ZXW C;  1BMF G;  1YIJ V;  4JAS A;  4QJF B;  1Q86 W;  3IC7 A;  3E8F A;  5CMU A;  2Q69 A;  4GT1 A;  2YSU B;  1JCH A;  1K9M W;  4QPK A;  2EIM C;  4OXS A;  3PJS K;  1QLE C;  4CBC A;  2AHY A;  4MVS A;  1OHH G;  4ASU G;  1PL0 A;  3HB3 B;  2ZQM A;  3R65 A;  2DYS C;  4BIZ A;  1K4D C;  1NBM G;  2C2A A;  4UXN A;  4LP8 A;  2LFS A;  1NJI W;  5C93 A;  3ABK B;  1CPY A;  1DTO A;  1SES A;  4RQF A;  1QBZ A;  2ZXW B;  3IFX A;  2P7T C;  2K1E A;  4MTF A;  3ABM B;  3OW2 U;  4MTX A;  4PDL A;  3BEH A;  2B5U A;  2EIL C;  1SER A;  1VQ9 V;  3ASN C;  2LFR A;  3CCV V;  3CCJ V;  2EJR A;  1J95 A;  4RUE A;  1UJW B;  3CME V;  3STZ C;  5B1A C;  1GTO A;  1QR8 A;  2QTO A;  3HPL C;  3OGC C;  1VQ6 V;  1QR9 A;  2IJK A;  1V54 B;  1QLE B;  1WLE A;  4RAI A;  5H6Q A;  3JD1 A;  3KG2 A;  4ZBM A;  1JPX A;  2V1D A;  4FIP C;  1H8E G;  2LP7 A;  4WFE A;  2JEU A;  5B1B C;  1PNM A;  4PA6 A;  4U7O A;  1W0K G;  3OMI B;  4PA7 A;  2HLD G;  2FTK A;  3W7W A;  1P4R A;  1L1F A;  1M9N A;  4N21 A;  2WPD G;  1GO3 F;  4KUM A;  2EIL B;  4RUF A;  3WG7 C;  5KA6 A;  1VQ5 V;  2BOC C;  3ZRX A;  1TUE B;  1R6N A;  2WLL B;  4MS2 A;  3CMA V;  3SYA A;  2ZDI C;  1CEZ A;  3ABL C;  2DQ0 A;  4JGS A;  4PEL A;  1S3J A;  4WF9 V;  3LDD A;  2W6J G;  3JD0 A;  5B1B B;  1JQ0 A;  4XDJ A;  3SYC A;  3SYQ A;  5IDJ A;  2Z5U A;  1F4M A;  4FK5 C;  4UVA A;  3CCR V;  2D3O W;  1P7B A;  1FXK C;  1YSC A;  1JOY A;  1S0V A;  3AG3 C;  3ZMV A;  2B1I A;  3RBZ A;  5LHH A;  2NLJ C;  3WG7 B;  1AR1 B;  2A0L A;  2WLN A;  1K4C C;  4MW3 A;  2GSM B;  3FB7 C;  1S76 D;  1K8A W;  3CC2 V;  2H8P C;  4DO2 A;  1K92 A;  2DQ3 A;  2WLH A;  2X6B A;  4XDL A;  2EBO A;  2X6A A;  4TWK A;  4X8A A;  1OZ0 A;  1AJP A;  4WFF A;  5L3C A;  2Z3Y A;  3JD4 A;  1KP3 A;  2GHY A;  2R9R B;  1VQP V;  5B1O A;  4JYB A;  2W6I G;  5DM6 V;  2PI5 A;  1HWY A;  2EIN C;  2XAJ A;  5E1A C;  4UV9 A;  2Q68 A;  4QE9 A;  2QE7 G;  2X0L A;  3CD6 V;  2JDI G;  1MSW D;  3AG3 B;  4PA4 A;  3ZRW B;  2QKS A;  1KD1 W;  4PDR A;  1BL8 A;  1KEC A;  4JF3 A;  2NNU A;  4QPJ A;  5EBW C;  1RPR A;  3SPG A;  3STL C;  3G4S V;  2XAH A;  2HFE C;  3ABM C;  3F5W C;  4I5S A;  2IJJ A;  4LBE C;  4R50 A;  1BHB A;  5KUK A;  4JTD B;  4F4L A;  3UM7 A;  3CC4 V;  4TSF G;  3P32 A;  1DLB A;  2X7R B;  4X88 A;  3RW0 A;  1R73 A;  3VOU A;  5LGT A;  4MW8 A;  1S72 V;  3ZRV A;  3SJQ C;  3G71 V;  1K3E A;  3OFN G;  4MVU A;  1V54 C;  1GK9 A;  2A79 B;  1R3K C;  2EIN B;  4QIW F;  4WFA V;  4Z1M G;  5CBF A;  3OUF A;  3JYC A;  1COW G;  3FKS G;  2JJ2 G;  3ZMZ A;  3OEE G;  3CC7 V;  3D36 A;  1W2B U;  5J9P C;  1NH2 D;  2Q6A A;  3OAA G;  3OMN B;  1R3J C;  3E35 A;  2HVK C;  3BY6 A;  3RVZ A;  3DGE A;  1Q7Y W;  4TT3 G;  3ZMU A;  4WFG A;  1OCO B;  4MTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...