2A9HA

Nmr structural studies of a potassium channel / charybdotoxin complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel
molecule tags Metal transport, membrane protein
source organism Streptomyces lividans
publication title Nuclear magnetic resonance structural studies of a potassium channel-charybdotoxin complex.
pubmed doi rcsb
total genus 32
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2a9hA00
2Q68A 4PA3A 2R9RB 3SPCA 3GB7C 1JVMA 3KG2A 3ABMC 3T4DA 1XL6A 4GX0A 3SYOA 4CBCA 3IFXA 3OUFA 4XDLA 3IGAC 4F4LA 5CBGA 2HVKC 3SPGA 2A0LA 3PJSK 4MSWC 2AHZA 4OXSA 4X8AA 2EILC 2DYSC 1M56C 3E8HA 1LNQA 3F7VC 2WLMA 5J9PC 5KUKA 2DWEC 2EINC 4X89A 2A79B 5B1BC 2WLJA 3SPJA 2WLIA 2X6BA 4QNHB 3LDDA 4PDLA 3F5WC 5EC1C 4J9ZB 1KKDA 1R3LC 4RUFA 2ITDC 2EIKC 3E83A 4MTFA 1BL8A 4X88A 4ZBMA 2A9HA 4LCUC 5KUMA 4GX1A 2NLJC 3K0GA 2X6AA 3UKMA 2WLHA 4PDVA 4KFMA 1K4CC 3ASOC 2WLIB 3SYCA 3SYAA 3K03A 2IH1C 4R50A 3FB7C 1QLEC 4P9PA 4LBEC 4TWKA 3X2QC 3ABKC 1V55C 4RUEA 3JYCA 3FB5C 5EK0A 4H33A 4GX5A 4JTAB 4PA9A 3RVZA 4RO2A 4PDRA 5CBHA 4P30A 3SPHA 4J9YB 3WG7C 2K1EA 3LNMB 3T2MA 2EIMC 5BZBA 3BEHA 4P9OA 2WLNA 3TCUA 1OCZC 5EBMC 4H37A 5E1AC 3K0DA 4WFFA 3LDCA 5EBWC 4R7CA 2KB1A 3K06A 4MVOA 3AG1C 1R3KC 1S5HC 3HPLC 2Q69A 3R65A 3RW0A 3OUSA 2P7TC 2WLKA 4PDMA 3LUTB 3E86A 1XL4A 2BOBC 3ASNC 3RBZA 1R3JC 4MTOA 1V54C 1R3IC 4R8CA 3E8FA 2Y69C 3E8GA 4G28B 3LDEA 3RVYA 3T4ZA 5IY5C 3EFFK 1G4YB 3SPIA 3AG3C 3SYPA 5CBFA 1P7BA 4MS2A 2Q67A 4BW5A 2WLLA 3K08A 1OCOC 4XDKA 2HG5C 4JTCB 3F7YC 4WFGA 2JK5C 4PA6A 4JTDB 3SJQC 4EKWA 4MVMA 4HYOA 5B1AC 2W0FC 1OCCC 4MVRA 3FB8C 2Q6AA 2BOCC 4HZ3A 4MW8A 4P2ZA 1J95A 2ZXWC 4LP8A 4MVZA 4MTGA 5EC2C 2AHYA 4QE9A 5EBLC 3SYQA 3E8BA 4GX2A 4I9WA 2HJFC 2DWDC 3AG4C 3VOUA 4PA4A 3T1CA 3E89A 3TETA 4MVSA 3K04A 3ZRSA 2QTOA 4G27B 2H8PC 4WFEA 2YEVA 2IH3C 4MW3A 3ZJZA 4XDJA 3UM7A 2DYRC 3FB6C 4PA7A 5B3SC 2WLLB 1M57C 1ZWIC 3AG2C 4R6ZA 4WFHA 3STLC 2HVJC 3OR6C 2ITCC 4QE7A 2OCCC 2ATKC 1K4DC 1OCRC 1ORQC 4MVQA 2HFEC 3OGCC 2X6CA 3OR7C 4UUJC 2ZD9A 4RAIA 2EIJC 2QKSA 4MVUA 3ABLC 4DXWA 3STZC
chains in the Genus database with same CATH superfamily
1GTOA 3SPCA 5JQGB 3GB7C 1JVMA 3VQWA 1VF6A 1YEWA 5KX5B 3ZHUA 3OMAB 4F4LA 1WJZA 2MW2B 5BR8O 3K5MA 1M56C 2CGOA 2GTAA 2Q73A 1WNSA 1KP3A 4K35A 3ASOB 3OTFA 2AZ0A 2V1DA 4DR2O 1R6TA 1Y76B 4O4JB 4J9ZB 4BAYA 1SZXA 3E83A 4MTFA 2R9AA 3BVOA 4UVAA 1FFTB 2KG7A 4I4TB 4JI0O 1WP8A 2IW5A 3ZMSA 4X64B 3SJCC 1N34O 4JI4B 2ZNJA 5H5NA 2ZE6A 3KZIZ 4F6RA 4B3SO 1Y74B 4ZKIA 3FX7A 4DV2O 2D3OW 1QBZA 1FXKC 4CH4A 5CA1A 2JRIA 4DV1O 1AI5A 1SS3A 1R3IC 5K1XA 4AHCA 1Z2GA 3JATA 4FLYA 4CS3A 2EULA 3CWBH 1FD9A 1O9HA 2F1MA 5JVDB 2B1GA 4O4JA 4X9QA 4WFAV 4FIPC 1NBMG 2PZSA 1BGYH 1MOFA 4MVZA 3OMIB 2IM9A 1KYOF 3QF7A 3RFRA 1KP2A 4MVSA 3K04A 1I94B 4EFBA 2C2AA 1MABG 1WPBA 1VF7A 3ETGA 4UVCA 4JAVA 1F4NA 1JFFB 4W4KA 2EJRA 2WPDG 5KAFZ 3U0ZA 4J7JA 1VEWA 5B1NA 1RFYA 4FMTA 2YIAA 4PA3A 4FLZA 4IYIA 2W0XA 2LGWA 1EBOA 4J7KA 1YTFD 1QU7A 1PL0A 2HHHO 2EILC 3CCJV 4YY3O 1PP9H 1RSOB 4B3RO 2WLMA 1QVFU 1SA0A 4K3AA 4B08A 4JI3B 5L3FA 4JAUA 1M5IA 4CS4A 2OIGA 4LCUC 2ZT9B 4O2BB 4K0KB 3THOA 2O57A 3WB1A 3HR0A 3FB7C 3S3WA 4HBNA 3OTOO 4PD4F 2LGQA 3JYCA 4O4HB 4FLTA 5EIBD 3EXAA 4RO2A 2M7WA 3U10A 5CA0B 3FKSG 4D7TA 1YZBA 4UCRA 1CP9A 4LFCB 4LWSA 2QWRB 3HPLC 2BE3A 4FFBA 2LP7A 4DV6O 2RCVA 1K9MW 2A06H 3JASB 4I55A 2Y0IA 3D36C 4MT8A 2Q8VA 3BA9A 4O2AA 4ZOLB 1BQ0A 3CCVV 1Q3EA 2ZE8A 3KCYA 2W0FC 5IYZA 1MZEA 4YJ2A 3ZIAG 3CS5A 3CXCU 3N27A 2HJFC 4X62O 4CH3A 3N2GB 2Q7HA 1YHQV 3ZJZA 3K58A 3DGEA 5LMNO 2WLLB 4Q20A 1YJNV 2FKXA 2ITCC 4L87A 4B7KA 2CTRA 4UV9A 5IJ0B 2ODMA 2X6CA 2WSSG 1EM1A 1IDSA 2Q68A 1W0JG 3F5TA 3H01A 2UXXA 2YI9A 2X7RB 5KX5A 1NJIW 2YXHA 2V4DA 1MSWD 2CH7B 2EX3A 3RYFB 5B1BC 2ZE7A 3SPJA 2X6BA 5LHGA 4QNHB 3HKEA 1QVGU 5IDJA 2UUCO 5DEDA 3D8CA 1KQSU 4JF3A 1IURA 3P3NA 5KMGA 2OTJV 1N4CA 1SQPH 3E2EA 5L3DA 3SYAA 1G1XB 5CB4A 4GUNA 2DYRB 3K57A 2ILMA 1Q8IA 4LF4B 1ZLZA 4LFBB 2Q7EA 1S0VA 4P30A 1MMMA 2K1EA 4NXMO 5B1AB 3AG7A 5IJ0A 3T1HB 2UUBO 3T1YO 3ZHTA 2PYJA 1V54B 5EBMC 3K0DA 1WP7A 2VQFB 4UCTA 1GN6A 3FYEB 2UXCO 2P90A 1MSDA 5L3BA 3IC7A 1K7DA 1XI1A 3BY6A 3ZHSA 3WG7B 5LMUO 4KHPB 3DC5A 2EBOA 5L3EA 3OE7G 1YXBA 3DC6A 3HKDB 2GTSA 1RM1C 1ZTEA 4GCZA 3IC9A 4FK5C 1TUBA 1U96A 1IBLO 1I0HA 2DWDC 3SJBC 4K0KO 5KHGA 1IBMB 5LXTB 4YJ3B 1N0NA 2H8PC 3IJ4A 1FXKB 4MW3A 3IAYA 3EHBB 2IJIA 3CX5F 2ZR2A 4X65B 5H9CA 2LFRA 1VQNV 3CCQV 3H1LH 2QWNB 2HFEC 4YHHO 2E76B 3G6BA 3DSQA 2R70A 1S76D 4JI1B 3CE2A 4JI6B 1M93A 1VF5B 2P06A 1N33B 3E8HA 1LNQA 3OEHG 1V55B 4FVMA 1EFRG 4WCEV 5B1BB 4JI8B 2ZR3A 4UCVA 3CPWU 3F5WC 1K3EA 1L8DA 4FPPA 2NR5A 2JVDA 4PDVA 1K4CC 5JH7A 2WLIB 4X1KA 3CCUV 4PELA 1Q86W 1TVKA 4LBEC 3JD0A 1HNZO 1Z5WA 2BTOA 4U3JA 5CN0A 1BQZA 3SPHA 2CGNA 2H3OA 3LNMB 2BSKB 1NTKH 4LF9O 1FFXB 1DGSA 1H2LA 4CZZA 1HW7A 2DN9A 4NB5A 2XUMA 1HNWO 2HP8A 3LNNA 4DV1B 1AJQA 2IU3A 1XL4A 4TV9B 4LF7B 4ZHQA 1GAXA 3LDEA 5IJ9B 2OTLV 4DR7B 4FZ0A 2F93B 4UCSA 1YF2A 4EKWA 1T5EA 1I94O 2Y69B 2RNBA 1COWG 5LYJB 2AW9A 1RM1B 1XMOO 4ZI7B 1JX9A 5J2UB 3E35A 1ZAUA 1PV0A 1EN6A 4O2BA 4X20B 4JI8O 3B77A 3ZHVA 4QPKA 2R72A 1XUQA 2DQ3A 1H2MA 1N33O 4DRXA 1HNWB 4NTYA 5IT9N 3TGUH 1B6QA 1S5JA 2E74B 4MSWC 3ETDA 3K5LA 2PI4A 2ADPA 5J9PC 3ZHRA 2IU0A 1WB8A 1ZUQA 4I50A 1QCEA 2P22C 5IYCO 5HFMA 2DMXA 4LC1A 4BR6A 4Z1VA 1TUEB 2QA4V 4RQFA 2BCCH 2UU9O 4YIPA 4U7OA 2JS3A 3C90A 2UXBO 2FMLA 4DV4B 2X0LA 3JARB 4P9OA 3TCUA 3ZRVA 3CRMA 1GN3A 1HR0B 1ZSPA 3CCMV 3RW0A 3AEIA 4MTOA 3E22B 3OMNB 3SJAC 5D5PA 3E8GA 5IWAB 3UO2A 1JA8A 3SYPA 2QR4A 4WFGA 4DUZO 4PA6A 4DV3O 2GUZA 4DR6O 1YJ9V 4HYOA 1VIBA 5BMVA 2QKCA 1OCCC 3KKYA 3HKDA 3BA8A 4U3JB 1L0NH 4GZRB 3G6EV 4I4TA 2DQ0A 2CTWA 3E89A 3BHPA 5LBQA 1YSCA 4DR3O 1JQ0A 2DYRC 1B04A 4QE7A 5JCOA 1PD3A 4GKJB 1VQ4V 3M8AA 2IBZH 1KD1W 3GWKC 3STZC 1P4RA 4K8ZA 2R9RB 5BR8B 3B40A 2VQFO 5LA6B 4JI6O 4JI1O 4OX9B 1K5SA 2XNDG 2DYSC 2F23A 1Y67A 2ADQB 3ABTA 4FJCC 2F4VB 3FFQA 1KMIZ 5B3SB 3LDDA 5LMNB 1R3LC 5B1OA 2ZCEA 4DR3B 3ETEA 2IJKA 1N32O 1Q43A 2BTQB 3L75H 3TJTA 1W59A 4BW9A 4GX5A 2DW4A 3EVKA 4JV5O 1WA8A 3T2MA 5LXTA 4BIUA 5F2VO 2VQEO 2F66C 2YDEA 3RYCB 5E1AC 4B3MB 1HWYA 3K06A 3R65A 3MHHC 1URFA 3E86A 2UXCB 2Q0AA 3BCCH 4DUYO 1P49A 5ITZA 3APOA 2Q67A 3CHXA 5KA5A 1GMGA 1DLBA 4H44B 4DUYB 1P7GA 1LUVA 5LYJA 4IIJA 4DV5O 2JEXA 1I08A 4DR1O 1VMGA 3QVNA 4I9WA 3C3TA 3AG4C 3U11A 1YITV 1Q6HA 2L6LA 1FJGO 3JD2A 2PYLA 4E4EA 3J80N 1VQOV 1OCRC 2XASA 4DK1A 4GLXA 3DXRB 1ENVA 2HHHB 1FXHA 5KHKA 3OM3B 3Q4HA 2PI5A 5JJEB 2R9IA 1YTFB 2A0LA 4Z2WA 2G38A 3H9VA 2EINC 2YUAA 5FL7G 1YVWA 2RJZA 3CCSV 2XAGA 1BL8A 3WB2A 1XNRO 5KUMA 4FZ1A 2OWOA 1XNQO 4EFEA 5CA3A 3K03A 5DM6V 2LO1A 2EIMB 1SRYA 4TWKA 5EYPB 3X2QC 3B4SA 3RVZA 3JARA 3VQYA 1PL4A 3UO3A 2VWKA 1PM9A 1SQQH 3BPZA 4IHJB 1XDCA 4MVOA 3AG1C 1MNGA 1AP6A 4HNAB 2GHYA 4JI2O 2HR3A 1PNKA 4NXNO 4DRXB 1R3JC 2YI8A 1UPGA 1G4YB 3JD4A 4O4LB 4BW5A 2HEPA 1J5EB 4FLXA 4ICGA 2QKAA 1DK1A 3FB8C 4MW8A 4P2ZA 2Z3YA 3ZCCA 1S77D 2AHYA 1XBLA 3RGBA 3UCSC 4FLVA 5JH7B 3SDLA 4ZIBA 4X1KB 2LW1A 1QHTA 4G27B 3JALA 4JYCA 2YEVA 3K3WA 4D6TH 4JYYA 3FB6C 4UCOA 4PA7A 3QTCA 4WFHA 3R66A 2Q5ZA 2UXBB 5JQGA 1OCCB 4EB6B 4JI3O 3JD1A 3P30A 3VQVA 3DTUB 2WLLA 1N0JA 1UJWB 3KCXA 4CH6A 5LHHA 2Y4UA 5EZYB 3SPGA 1KKCA 1SA0B 3GVMA 4I0XA 2ZXWB 1GRJA 1B06A 5FLXN 4X64O 4RUFA 1I7FA 4WBNB 3HKCB 1MA1A 4KUMA 4KXRA 3ZHQA 1AI6A 3W7XA 1IBKO 1JCHA 1UFIA 1XMQO 3ABKB 1AI7A 2UXDO 1HNXO 4GYCB 3M7MX 2FL4A 4CC5A 3BEHA 4GKKO 1BMFG 5DECA 3JATB 1S5HC 1Q5OA 4U7NA 4DV5B 1SQBH 2F43G 3NR7A 4LF8O 1R1BA 1XHXA 5LL6Y 2Y69C 4X1YB 3RVYA 3AG3C 1VF6C 3ZMUA 4XDKA 1A32A 1BHBA 3H1JH 4LF4O 1GO3F 2IJJA 2JGUA 1S72V 4B3SB 4O4LA 1WPXA 5A9GA 5EC2C 3ZRWA 5EBLC 1JFFA 3LSQA 1H8HG 2YIBD 4JI0B 1GK9A 1TVKB 2QTOA 3TXQA 4WFEA 4JV5B 1Y6XA 3RYHB 5KHHA 1GM7A 1D2DA 4J10A 3UQ8A 1ZWIC 4R6ZA 5IE9A 1Y74A 3J81N 1BS3A 4HNAA 1GM9A 3D3IA 1HNZB 3J7AU 4TUYA 2QJ1A 2DYSB 2Q4PA 3C3SA 1X59A 3AK3A 3D36A 4JGSA 5IYBO 3ZN1A 3SYOA 4XDLA 1G6UA 4AI8A 2XAFA 3E22A 3ABUA 4LFAO 2QM8A 1NTZH 3ZRXA 2CAZC 4KP4A 2RQ6A 5JJJB 2EZPA 2FYUH 4J11A 4PDLA 3ICXA 3TK1A 1CPYA 5H6RA 2NLJC 2K9PA 3JAWB 4OPHA 1GN4A 2WLHA 3RWRD 2IH1C 1OHHG 4IT5A 5TISZ 1QLEC 1WA8B 1M56B 2JDIG 4PJ0Z 4RUEA 2YICA 1DTOA 4B3MO 1VQ7V 2VQEB 1D5AA 2OT5A 2EIMC 5BZBA 3LDCA 4R7CA 4LNUA 4DV6B 2PF4E 5AG2A 2XAJA 2WWWA 1SQVH 4JI7B 4DUZB 5FNVA 3ZX6A 1SETA 4JYBA 3T4ZA 3SPIA 1BE3H 3CXHF 4E2LA 3BFRA 3CSXA 4JTDB 2E3CA 3WB0A 1AI4A 2BOCC 2Q6AA 4U3FH 3RT3C 4LFAB 1M57B 1HDJA 4JAAA 4DR4B 2Q9LA 2YEVB 2XHBA 1FXKA 3L73H 5L3CA 2IH3C 1M90W 1E1RG 3HKBB 3STLC 1HNXB 4LF5O 2GDSA 1AROP 3O65A 1ROPA 1K4DC 1K92A 4BIOA 3BRCA 1SQFA 1US6A 1Q7YW 2RDCA 2AZ2A 2ZIMA 3ML0A 1WB7A 4JI5O 3G67A 3W7TA 3K59A 1KBHA 4GX0A 1F23A 4KL1A 3SR2C 1K8AW 3JASA 4I55B 4B7EA 2DWEC 3RYIB 4AILC 4PV1B 4UB8Z 2ZNIA 2CDYA 4MTXA 2QSAA 4TOIA 3FD9A 4X88A 2ITDC 5A2QN 1QR9A 1YI2V 4GX1A 3K0GA 2OIEA 2ZINA 5IWAO 4FM1A 3W7SA 4AQYO 1Y76A 1R73A 1K5QA 1NVPD 4TUYB 3B2EE 4D7SA 1W2BU 3AG1B 1HR0O 1XEQA 5H6QA 3FAVA 3JALB 3L71H 3OFNG 4BIZA 2QWOB 4N21A 2M6YA 1K34A 1V9PA 2Q7GA 1OCRB 4TV9A 3VQXA 2P6JA 2L35A 1V54C 2ARHA 2NN4A 3E8FA 4LNUB 1ZX3A 3ABLB 4QPJA 5IJ9A 4DR7O 5C8YB 2LQTA 4X1IA 4JTCB 3ASNB 4NXNB 1PPJH 1N34B 4JI4O 4Z1MG 3BAAA 4I0XB 4MVRA 2NNUA 2EINB 4LP8A 4MTGA 1FKAO 4QE9A 2D2CB 5J2UA 2GUZB 3G4SV 5GW7A 3OD4A 4WBNA 4IYHA 5GTIZ 1H2SB 2OYQA 3CC4V 3UM7A 4JZ2A 4QGPA 3I55V 4DV4O 3OR6C 5KHJA 4JYAB 4PI2A 1JMKC 3NXSA 1NR1A 1Q90D 1FPOA 3WFVA 3X2QB 3ZBHA 5EZYA 2YIDA 1FYJA 4H13B 3TETA 4DV0O 1NZ6A 1XNRB 3CRAA 5LP6C 3ETQA 3IGAC 5CBGA 1E1QG 3CYOA 1H2GA 1R6KA 2Y48A 5FPRA 4JYAO 1N36B 2EZOA 1SQGA 3HKCA 4X89A 1YIJV 4WF9V 1XHZA 1VP7A 4I50B 2H94A 4G2KA 4ZBMA 1TGOA 2DE0X 2P67A 4NR1A 1EZJA 4LF6B 4B3TO 3H1KH 3B8NA 1ZL8B 3CP1A 1DF4A 1HP8A 2OCHA 3CRRA 4F6RB 4UCUA 5EK0A 4ZI7A 2WA4A 3CD6V 5CBHA 2FB5A 3WG7C 5LP6A 3G80A 3JCUZ 1PNLA 1OCZC 4X20A 3DXRA 2GV9A 1NH2B 1SC5B 2KB1A 4X1YA 3AG3B 1R3KC 2UXNA 2Q69A 2E5LB 4TQDA 2P7TC 3HB3B 2VS0A 2PGGA 2XAHA 2QDOA 1OJHA 3JSNA 1OCOC 2HG5C 3OT7A 5K1PA 3MDSA 2XAQA 4LF7O 5C8YA 2XOKG 2Q0OC 2P4KA 3CMAV 4NTWA 1H8EG 3A8TA 3VOUA 4FM0A 1QLEB 3CB2A 2ZM6O 4NXMB 1K97A 1PNMA 4LF9B 1M57C 3AG2C 1PKXA 2HVJC 2ATKC 2BSKA 4QJFB 2YS8A 1N36O 4DR5B 2ZD9A 3JSLA 2QKSA 3CCRV 3A0BZ 3B09A 3PJSK 1E79G 3I5DA 2CUGA 1Q6UA 4UB6Z 3ZN0A 4CC6A 4TV8A 1SZTA 3N2KA 1SKVA 2ZDIC 4K8XA 1GKFA 1AVMA 2WA3A 2EIKC 1VQ8V 4RWUA 4IL6Z 1YCIA 5LOVA 5JCOC 1VQMV 1DF5A 1V55C 3QG5A 2AXTZ 4H33A 3L70H 5BY1A 3T1HO 2JIZG 3CCLV 3K9SA 1FJGB 4LFBO 2AGAA 1CXZB 5EBWC 4JPRA 1GH6A 2JGDB 2UUAB 1IBMO 1K73W 1P84F 2CH7A 2WLKA 4LH7A 1FS0G 1L0LH 3AK2A 2ZIOA 4G28B 3A2FA 3H1HH 4LF5B 3AG2B 3ZMVA 1FAFA 1SESA 1XILA 1QNMA 1L1FA 4I9QA 5GONA 3P32A 3ZMTA 1KUQA 2JK5C 3SJQC 3I56V 4F6EA 4JASA 4MVMA 5B1AC 4DR4O 4IIJB 5B5EZ 1NH2D 4OX9O 4PA4A 4OGQB 4O4IB 5IYDO 4DV7O 3LSSA 3A0HZ 1Q6IA 2YSUB 1TA8A 3OEEG 4XDJA 5LGTA 1WN7A 4C7UA 2UUBB 5B3SC 4NKGB 3K5NA 3QNEA 2N74A 3D3QA 5JJNB 1Q81W 4JI7O 3OGCC 1XOUA 1MG1A 4Q6GA 2EIJC 2HLDG 5IY5B 4N23A 2OCCB 2PY5A 3KG2A 3ABMC 4CBCA 3Q4HB 2QE7G 2AHZA 4LWSB 4TSFG 4X8AA 3CC7V 3W7WA 3CJHA 3QO7A 2QM4A 5CMUA 3RYFA 5LGUA 1H38A 3CEIA 3HKEB 2F4VO 2ZM6B 2DJVA 3K79A 1KKDA 4UVBA 1JOYA 5KMGB 1AR4A 1BCCH 4KFMA 1I5XA 3ASOC 4RQEA 1YJWV 1XQ8A 1O9GA 4DV7B 4JZGA 5CA0A 4J7ZA 5J2TB 5EYPA 1NU1H 2GSMB 3HKBA 4NVPA 4PA9A 5LOVB 4GKJO 4PDRA 3ZMZA 4J9YB 4L8JA 1TAEA 2WLNA 4FFBB 5LP6B 5LGNA 1AR5A 3CCEV 4H37A 4WFFA 4X62B 1F51A 3MHSC 4DR5O 4PDMA 3JAMN 4XBFA 1VQLV 4LH6A 2ZE5A 4UXNA 2JJ2G 3ZS8C 2UUAO 1RSOA 1P7BA 4DR6B 2MK3A 4TQFA 4DV3B 1NR7A 2CK3G 1OCZB 4ZHQB 2UXDB 2YC0A 2E75B 3H1IH 1IBKB 5EIBC 2ZXWC 4DK0A 1BZKA 2PTMA 3E8BA 2QGNA 1MZFA 3VBBA 3W7UA 3AG4B 2B5UA 4HAMA 1OV9A 1W0KG 3P3PA 2V7QG 4LFCO 1EN5A 3CMEV 4PHZA 3L72H 1RPOA 1JJOA 1ZL8A 2YIBA 4EB6A 1XREA 1ORQC 1EZVH 1NS1A 2A3QA 4MVUA 3B8MA 2UU9B 4DV0B 4X66O 1Q82W 2RN9A 1XL6A 4GKKB 4X66B 1NKDA 3MD0A 4OXSA 4DR2B 5FNVB 2B9ZA 1RP3B 3F7VC 4TV8B 5KUKA 1KECA 5KAIZ 1SERA 2A79B 3ZRWB 4YY3B 1YDXA 3QO5A 2B1IA 1D5NA 3CRCA 1VARA 4LF6O 1G8MA 2JJ1G 2QWPB 3SYCA 4R50A 2JS5A 4DO2A 1VQ9V 1Y4MA 2VRZA 4A5UB 1KC8W 2YXLA 4IHJA 2KG7B 1H2KA 4DYLA 5BXZA 2P5OA 4YJ3A 1QLNA 1FFXA 1IZ3A 1IBLB 4FLWA 4LF8B 3LUTB 2BOBC 3ASNC 1XMOB 2E5LO 5FPOA 1CEZA 3CC2V 2HJDA 5C93A 2XTAA 1U97A 4OPAA 3G71V 1FXVA 1Z5VA 5E79Z 2EIKB 1IX9A 2FTKA 3N2KB 2P4VA 3SYQA 5JVDA 1XMQB 1GN2A 4IGGA 2EJ7A 5CB4B 5D5QA 3K9AA 4AQYB 4B3TB 2QTSA 1J5EO 1F4MA 1QR8A 3RYHA 2VWJA 2QM7A 5CA1B 4FLUA 3APQA 4YHHB 2QEXV 4FFKA 1BSMA 2HKOA 4DV2B 3MAQA 5KHIA 3FYIB 3AK1A 4X65O 4I7ZB 4BWAA 3OR7C 3ABLC 4DXWA 4LR3A 3T4DA 4ABMA 3OUFA 1AB3A 2QWQB 4J80A 5KA6A 1KU9A 3L74H 3CJHB 4X1IB 2F95B 2WLIA 1NT2B 1VQ5V 2A7WA 4CS2A 4J42A 5LMUB 4GT1A 3JAWA 1XNQB 4WFBV 1BT8A 4ASUG 3M99B 1JR9A 5GONB 2CE4A 2LJ2A 5J2TA 1IVSA 3OGIB 3BABA 3ABKC 1KB9F 1IXBA 4JTAB 3JCZA 5LHIA 3T1YB 2Y0PA 1AILA 3S3XA 5LA6A 4H0LB 1NQTA 4QIWF 1I5YA 1M9NA 3A0RA 1QQCA 4JI5B 2EIJB 1IXMA 1M1KW 3JAKB 1AR1B 3OUSA 3RYIA 1JPXA 4JI2B 2EILB 2KQXA 3EFFK 5HFLA 5CBFA 3UT5A 4MS2A 1SF9A 3F7YC 2UUCB 2WAMA 3OW2U 1VQ6V 5DN6G 4KHPO 4J41A 5ITZB 4YIOA 2JEUA 3O9OA 4DR1B 3PN1A 4O2AB 2ZDIA 4CH5A 3GWOA 4ZOLA 5GTHZ 1NVPB 1AJNA 3ZRSA 3RN4A 3WU2Z 4UV8A 3RYCA 2ZQMA 3L9DA 2W6JG 1R6NA 5KLVH 2Y4TA 4FM2A 4W4LA 4MVQA 4UUJC 1EN4A 4RAIA 2DOSA 2JGDA 3CRQA 1OCOB 3IFXA 2HVKC 3JD3A 2Z5UA 2GBOA 5B66Z 1K33A 1Y66A 2CTPA 4B3RB 2WLJA 4YJ2B 5EC1C 1JJ2U 3TXSA 2W6IG 2YXYA 2PUSA 1N32B 3ZEDA 2A9HA 3OAAG 2X6AA 3UKMA 4DW1A 1AJPA 1X4TA 1TUBB 1WAZA 2BTQA 4P9PA 4O4IA 1NTMH 1RPRA 3FB5C 2N05A 1VQPV 4NTXA 1AP5A 4YXWG 2KKWA 2CTQA 3FAVB 2LW7A 1BHAA 1WLEA 4EEQA 1S3JA 5L3GA 4UFZA 1OZ0A 3RBZA 5H2FZ 4R8CA 2N04A 5IY5C 5BMVB 3K5OA 3ABMB 3K08A 3QO8A 1M4UA 1LR1A 1B3QA 1GM8A 2ETNA 5IYZB 3UT5B 1LUWA 4HZ3A 1VQKV 4NYKA 1J95A 2XT9A 2RMKB 4PI0A 3LSUA 4GX2A 1H2NA 1S5LZ 1NI8A 1SQXH 3N2GA 3T1CA 1THZA 2IJHA 1N8RW 2LFSA 4I5SA 2KSDA 2ZKOA 3SGIA 3JAKA 2OCCC 5JWPA 1F7YA 4TT3G 4DW0A 4O4HA 3OTOB 2Z0AA
chains in the Genus database with same CATH topology
3D36A 5IY5B 1GTOA 4JGSA 3SPCA 5IYBO 3GB7C 2OCCB 4N23A 1JVMA 3ZN1A 3KG2A 3ABMC 3SYOA 4CBCA 3OMAB 4F4LA 1B6QA 4XDLA 2QE7G 4MSWC 2AHZA 3ETDA 4TSFG 4X8AA 2XAFA 3ABUA 1M56C 2PI4A 3CC7V 3W7WA 2QM8A 5J9PC 3QO7A 5CMUA 1KP3A 3ZRXA 3ASOB 4KP4A 5LGUA 1H38A 2V1DA 2IU0A 2EZPA 4PDLA 1QCEA 3TK1A 4J9ZB 3K79A 1KKDA 4BAYA 4UVBA 1CPYA 3E83A 4MTFA 5H6RA 5IYCO 5HFMA 1JOYA 4UVAA 2NLJC 2WLHA 1FFTB 4KFMA 4LC1A 1I5XA 3ASOC 4RQEA 1YJWV 2IH1C 1OHHG 1TUEB 2IW5A 2QA4V 4RQFA 1QLEC 3ZMSA 1M56B 2JDIG 4RUEA 4U7OA 1DTOA 2GSMB 4PA9A 1VQ7V 4ZKIA 2X0LA 4PDRA 3ZMZA 4J9YB 2OT5A 2EIMC 5BZBA 4P9OA 3TCUA 2WLNA 1QBZA 3ZRVA 2D3OW 1FXKC 5LGNA 3CCEV 4H37A 4WFFA 3LDCA 4R7CA 3CCMV 1F51A 3MHSC 3RW0A 4PDMA 1AI5A 4XBFA 1VQLV 2XAJA 3AEIA 2WWWA 4UXNA 2JJ2G 4MTOA 1R3IC 3OMNB 3E8GA 1SETA 4JYBA 3T4ZA 3SPIA 3SYPA 1P7BA 4E2LA 2MK3A 1NR7A 4WFGA 2CK3G 1OCZB 4PA6A 4JTDB 2B1GA 1YJ9V 4HYOA 4WFAV 4FIPC 1NBMG 1OCCC 1AI4A 2BOCC 2Q6AA 2ZXWC 1MOFA 4MVZA 3OMIB 3G6EV 3E8BA 1M57B 2DQ0A 1KP2A 3VBBA 3AG4B 3E89A 2B5UA 3W7UA 4HAMA 3K04A 4MVSA 5LBQA 1YSCA 1JQ0A 2C2AA 2YEVB 1MABG 1FXKA 1W0KG 5L3CA 2IH3C 1M90W 3ETGA 1E1RG 2V7QG 2DYRC 4UVCA 4JAVA 1F4NA 3CMEV 3STLC 1RPOA 4QE7A 1PD3A 1VQ4V 1AROP 1ROPA 1K4DC 1ORQC 2EJRA 2WPDG 1K92A 1KD1W 1Q7YW 5B1NA 4MVUA 3B8MA 3STZC 1P4RA 4FMTA 4PA3A 2R9RB 3ML0A 1Q82W 3W7TA 1XL6A 1EBOA 4GX0A 1F23A 1YTFD 1NKDA 1PL0A 3MD0A 4OXSA 1K5SA 2EILC 2DYSC 2XNDG 3CCJV 3ABTA 1K8AW 3F7VC 2WLMA 4FJCC 1QVFU 5KUKA 2DWEC 1KECA 1SERA 2A79B 5L3FA 3ZRWB 4JAUA 5B3SB 4MTXA 3LDDA 3QO5A 2B1IA 1R3LC 4X88A 2ITDC 1QR9A 5B1OA 4LCUC 1YI2V 4GX1A 3K0GA 3W7SA 1G8MA 2JJ1G 3ETEA 3SYCA 2IJKA 4R50A 3FB7C 1R73A 4DO2A 1K5QA 1NVPD 1VQ9V 1Y4MA 3JYCA 1KC8W 1W2BU 3AG1B 4GX5A 2DW4A 4RO2A 2M7WA 5H6QA 3T2MA 3FKSG 4BIUA 1QLNA 3OFNG 1CP9A 4BIZA 5E1AC 1HWYA 3K06A 4N21A 3HPLC 3R65A 3MHHC 1K34A 3LUTB 3E86A 1OCRB 3ASNC 2BOBC 2LP7A 2P6JA 1V54C 1K9MW 3E8FA 1CEZA 3ABLB 4QPJA 4MT8A 3CC2V 2Q67A 5C93A 5KA5A 1GMGA 1DLBA 4JTCB 3ASNB 3CCVV 3G71V 1FXVA 2W0FC 4Z1MG 2EIKB 4MVRA 2FTKA 2JEXA 2NNUA 2EINB 4LP8A 4MTGA 3SYQA 4QE9A 3ZIAG 3CXCU 4I9WA 2HJFC 3G4SV 5GW7A 3AG4C 3K9AA 1YITV 1F4MA 1QR8A 2QM7A 1YHQV 3ZJZA 3CC4V 3DGEA 3UM7A 2QEXV 3I55V 2WLLB 4Q20A 1YJNV 3OR6C 2ITCC 3JD2A 4L87A 2HKOA 1VQOV 3FYIB 4UV9A 3NXSA 1NR1A 1OCRC 2XASA 3WFVA 3X2QB 2X6CA 3OR7C 2WSSG 1ENVA 3ABLC 1FXHA 4DXWA 3TETA 2Q68A 3OM3B 1W0JG 3T4DA 3H01A 2UXXA 2PI5A 2X7RB 3OUFA 3IGAC 2R9IA 5CBGA 1YTFB 1E1QG 2A0LA 3CYOA 1NJIW 1H2GA 1R6KA 2Y48A 5KA6A 1MSWD 2EZOA 2EINC 5FL7G 4X89A 1YIJV 4WF9V 5B1BC 3SPJA 2WLIA 2X6BA 5LHGA 4QNHB 2H94A 5IDJA 1QVGU 1VQ5V 4G2KA 1KQSU 3CCSV 2XAGA 4JF3A 4ZBMA 1BL8A 2P67A 4GT1A 5KUMA 2OTJV 4WFBV 1EZJA 4ASUG 3E2EA 3M99B 5L3DA 5CA3A 3SYAA 3K03A 3B8NA 5DM6V 3CP1A 2EIMB 1DF4A 1SRYA 4TWKA 3X2QC 3ABKC 2DYRB 5EK0A 4JTAB 3JCZA 3CD6V 3RVZA 5LHIA 1S0VA 5CBHA 4P30A 3WG7C 2K1EA 5B1AB 1PNLA 1OCZC 1NQTA 1V54B 1I5YA 1M9NA 4QIWF 5EBMC 3K0DA 1NH2B 3A0RA 2KB1A 4MVOA 2EIJB 3AG1C 3AG3B 1R3KC 2UXNA 1IXMA 2Q69A 1M1KW 3FYEB 2GHYA 1AR1B 3OUSA 2HR3A 1JPXA 2P7TC 3HB3B 2P90A 1PNKA 5L3BA 3IC7A 1K7DA 1R3JC 2EILB 2XAHA 3BY6A 3EFFK 1G4YB 3JD4A 5HFLA 5CBFA 3WG7B 4MS2A 4BW5A 2EBOA 1OCOC 2HG5C 3F7YC 2WAMA 5L3EA 3OW2U 1VQ6V 3OE7G 5DN6G 2XAQA 3FB8C 2XOKG 4MW8A 4P2ZA 1RM1C 2Z3YA 3ZCCA 4GCZA 2JEUA 1S77D 2AHYA 3CMAV 4FK5C 2ZDIA 3GWOA 1H8EG 2DWDC 3VOUA 1NVPB 1AJNA 1QLEB 3ZRSA 4G27B 2H8PC 4JYCA 2YEVA 1FXKB 4UV8A 4MW3A 3K3WA 2ZQMA 1K97A 1PNMA 3EHBB 2IJIA 3FB6C 4PA7A 2W6JG 2ZR2A 1M57C 1R6NA 3AG2C 4WFHA 1PKXA 2HVJC 5H9CA 2LFRA 1VQNV 2ATKC 3CCQV 4QJFB 1OCCB 4MVQA 2HFEC 3JD1A 3P30A 3DTUB 4UUJC 2ZD9A 4RAIA 2WLLA 2QKSA 1UJWB 3CCRV 1S76D 1OCOB 5LHHA 3IFXA 2HVKC 3JD3A 3SPGA 3PJSK 1E79G 2Z5UA 3E8HA 1LNQA 3OEHG 3ZN0A 1SZTA 1K33A 2ZXWB 1V55B 1Y66A 1EFRG 4WCEV 2WLJA 5B1BB 2ZDIC 1GKFA 2ZR3A 5EC1C 3F5WC 3CPWU 1JJ2U 2W6IG 1K3EA 4RUFA 2EIKC 2A9HA 4FPPA 3OAAG 4KUMA 1VQ8V 2X6AA 3UKMA 4PDVA 1K4CC 1AJPA 2WLIB 3CCUV 4PELA 1AI6A 3W7XA 1VQMV 1Q86W 1JCHA 4P9PA 1DF5A 3ABKB 1AI7A 4LBEC 1V55C 3JD0A 1RPRA 3FB5C 4H33A 5CN0A 1VQPV 4YXWG 3SPHA 2JIZG 3LNMB 3CCLV 3BEHA 1BMFG 4CZZA 5EBWC 4JPRA 1BHAA 1WLEA 1S5HC 1S3JA 1K73W 4U7NA 2WLKA 5L3GA 1AJQA 2IU3A 1FS0G 1XL4A 2F43G 1OZ0A 3RBZA 4R8CA 4G28B 2Y69C 3LDEA 3RVYA 3AG2B 3ZMVA 5IY5C 1SESA 3AG3C 2OTLV 3ABMB 1L1FA 3K08A 3ZMUA 4XDKA 3P32A 3QO8A 3ZMTA 1BHBA 2JK5C 3SJQC 3I56V 4EKWA 4JASA 1GO3F 1GM8A 2Y69B 4MVMA 2IJJA 5B1AC 1S72V 1COWG 1WPXA 4HZ3A 1VQKV 1J95A 5EC2C 1RM1B 3ZRWA 1NH2D 5EBLC 1JX9A 4GX2A 3E35A 3LSQA 1H8HG 4PA4A 3T1CA 1GK9A 5IYDO 2QTOA 3LSSA 4WFEA 2YSUB 1THZA 2IJHA 3OEEG 1N8RW 2LFSA 4XDJA 1GM7A 5LGTA 3B77A 4I5SA 5B3SC 1ZWIC 4R6ZA 3QNEA 4QPKA 2OCCC 1GM9A 1Q81W 3D3IA 2DQ3A 4TT3G 3OGCC 2DYSB 1MG1A 2EIJC 2HLDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q68 A;  4PA3 A;  2R9R B;  3SPC A;  3GB7 C;  1JVM A;  3KG2 A;  3ABM C;  3T4D A;  1XL6 A;  4GX0 A;  3SYO A;  4CBC A;  3IFX A;  3OUF A;  4XDL A;  3IGA C;  4F4L A;  5CBG A;  2HVK C;  3SPG A;  2A0L A;  3PJS K;  4MSW C;  2AHZ A;  4OXS A;  4X8A A;  2EIL C;  2DYS C;  1M56 C;  3E8H A;  1LNQ A;  3F7V C;  2WLM A;  5J9P C;  5KUK A;  2DWE C;  2EIN C;  4X89 A;  2A79 B;  5B1B C;  2WLJ A;  3SPJ A;  2WLI A;  2X6B A;  4QNH B;  3LDD A;  4PDL A;  3F5W C;  5EC1 C;  4J9Z B;  1KKD A;  1R3L C;  4RUF A;  2ITD C;  2EIK C;  3E83 A;  4MTF A;  1BL8 A;  4X88 A;  4ZBM A;  2A9H A;  4LCU C;  5KUM A;  4GX1 A;  2NLJ C;  3K0G A;  2X6A A;  3UKM A;  2WLH A;  4PDV A;  4KFM A;  1K4C C;  3ASO C;  2WLI B;  3SYC A;  3SYA A;  3K03 A;  2IH1 C;  4R50 A;  3FB7 C;  1QLE C;  4P9P A;  4LBE C;  4TWK A;  3X2Q C;  3ABK C;  1V55 C;  4RUE A;  3JYC A;  3FB5 C;  5EK0 A;  4H33 A;  4GX5 A;  4JTA B;  4PA9 A;  3RVZ A;  4RO2 A;  4PDR A;  5CBH A;  4P30 A;  3SPH A;  4J9Y B;  3WG7 C;  2K1E A;  3LNM B;  3T2M A;  2EIM C;  5BZB A;  3BEH A;  4P9O A;  2WLN A;  3TCU A;  1OCZ C;  5EBM C;  4H37 A;  5E1A C;  3K0D A;  4WFF A;  3LDC A;  5EBW C;  4R7C A;  2KB1 A;  3K06 A;  4MVO A;  3AG1 C;  1R3K C;  1S5H C;  3HPL C;  2Q69 A;  3R65 A;  3RW0 A;  3OUS A;  2P7T C;  2WLK A;  4PDM A;  3LUT B;  3E86 A;  1XL4 A;  2BOB C;  3ASN C;  3RBZ A;  1R3J C;  4MTO A;  1V54 C;  1R3I C;  4R8C A;  3E8F A;  2Y69 C;  3E8G A;  4G28 B;  3LDE A;  3RVY A;  3T4Z A;  5IY5 C;  3EFF K;  1G4Y B;  3SPI A;  3AG3 C;  3SYP A;  5CBF A;  1P7B A;  4MS2 A;  2Q67 A;  4BW5 A;  2WLL A;  3K08 A;  1OCO C;  4XDK A;  2HG5 C;  4JTC B;  3F7Y C;  4WFG A;  2JK5 C;  4PA6 A;  4JTD B;  3SJQ C;  4EKW A;  4MVM A;  4HYO A;  5B1A C;  2W0F C;  1OCC C;  4MVR A;  3FB8 C;  2Q6A A;  2BOC C;  4HZ3 A;  4MW8 A;  4P2Z A;  1J95 A;  2ZXW C;  4LP8 A;  4MVZ A;  4MTG A;  5EC2 C;  2AHY A;  4QE9 A;  5EBL C;  3SYQ A;  3E8B A;  4GX2 A;  4I9W A;  2HJF C;  2DWD C;  3AG4 C;  3VOU A;  4PA4 A;  3T1C A;  3E89 A;  3TET A;  4MVS A;  3K04 A;  3ZRS A;  2QTO A;  4G27 B;  2H8P C;  4WFE A;  2YEV A;  2IH3 C;  4MW3 A;  3ZJZ A;  4XDJ A;  3UM7 A;  2DYR C;  3FB6 C;  4PA7 A;  5B3S C;  2WLL B;  1M57 C;  1ZWI C;  3AG2 C;  4R6Z A;  4WFH A;  3STL C;  2HVJ C;  3OR6 C;  2ITC C;  4QE7 A;  2OCC C;  2ATK C;  1K4D C;  1OCR C;  1ORQ C;  4MVQ A;  2HFE C;  3OGC C;  2X6C A;  3OR7 C;  4UUJ C;  2ZD9 A;  4RAI A;  2EIJ C;  2QKS A;  4MVU A;  3ABL C;  4DXW A;  3STZ C; 
#chains in the Genus database with same CATH topology
 1GTO A;  3SPC A;  5JQG B;  3GB7 C;  1JVM A;  3VQW A;  1VF6 A;  1YEW A;  5KX5 B;  3ZHU A;  3OMA B;  4F4L A;  1WJZ A;  2MW2 B;  5BR8 O;  3K5M A;  1M56 C;  2CGO A;  2GTA A;  2Q73 A;  1WNS A;  1KP3 A;  4K35 A;  3ASO B;  3OTF A;  2AZ0 A;  2V1D A;  4DR2 O;  1R6T A;  1Y76 B;  4O4J B;  4J9Z B;  4BAY A;  1SZX A;  3E83 A;  4MTF A;  2R9A A;  3BVO A;  4UVA A;  1FFT B;  2KG7 A;  4I4T B;  4JI0 O;  1WP8 A;  2IW5 A;  3ZMS A;  4X64 B;  3SJC C;  1N34 O;  4JI4 B;  2ZNJ A;  5H5N A;  2ZE6 A;  3KZI Z;  4F6R A;  4B3S O;  1Y74 B;  4ZKI A;  3FX7 A;  4DV2 O;  2D3O W;  1QBZ A;  1FXK C;  4CH4 A;  5CA1 A;  2JRI A;  4DV1 O;  1AI5 A;  1SS3 A;  1R3I C;  5K1X A;  4AHC A;  1Z2G A;  3JAT A;  4FLY A;  4CS3 A;  2EUL A;  3CWB H;  1FD9 A;  1O9H A;  2F1M A;  5JVD B;  2B1G A;  4O4J A;  4X9Q A;  4WFA V;  4FIP C;  1NBM G;  2PZS A;  1BGY H;  1MOF A;  4MVZ A;  3OMI B;  2IM9 A;  1KYO F;  3QF7 A;  3RFR A;  1KP2 A;  4MVS A;  3K04 A;  1I94 B;  4EFB A;  2C2A A;  1MAB G;  1WPB A;  1VF7 A;  3ETG A;  4UVC A;  4JAV A;  1F4N A;  1JFF B;  4W4K A;  2EJR A;  2WPD G;  5KAF Z;  3U0Z A;  4J7J A;  1VEW A;  5B1N A;  1RFY A;  4FMT A;  2YIA A;  4PA3 A;  4FLZ A;  4IYI A;  2W0X A;  2LGW A;  1EBO A;  4J7K A;  1YTF D;  1QU7 A;  1PL0 A;  2HHH O;  2EIL C;  3CCJ V;  4YY3 O;  1PP9 H;  1RSO B;  4B3R O;  2WLM A;  1QVF U;  1SA0 A;  4K3A A;  4B08 A;  4JI3 B;  5L3F A;  4JAU A;  1M5I A;  4CS4 A;  2OIG A;  4LCU C;  2ZT9 B;  4O2B B;  4K0K B;  3THO A;  2O57 A;  3WB1 A;  3HR0 A;  3FB7 C;  3S3W A;  4HBN A;  3OTO O;  4PD4 F;  2LGQ A;  3JYC A;  4O4H B;  4FLT A;  5EIB D;  3EXA A;  4RO2 A;  2M7W A;  3U10 A;  5CA0 B;  3FKS G;  4D7T A;  1YZB A;  4UCR A;  1CP9 A;  4LFC B;  4LWS A;  2QWR B;  3HPL C;  2BE3 A;  4FFB A;  2LP7 A;  4DV6 O;  2RCV A;  1K9M W;  2A06 H;  3JAS B;  4I55 A;  2Y0I A;  3D36 C;  4MT8 A;  2Q8V A;  3BA9 A;  4O2A A;  4ZOL B;  1BQ0 A;  3CCV V;  1Q3E A;  2ZE8 A;  3KCY A;  2W0F C;  5IYZ A;  1MZE A;  4YJ2 A;  3ZIA G;  3CS5 A;  3CXC U;  3N27 A;  2HJF C;  4X62 O;  4CH3 A;  3N2G B;  2Q7H A;  1YHQ V;  3ZJZ A;  3K58 A;  3DGE A;  5LMN O;  2WLL B;  4Q20 A;  1YJN V;  2FKX A;  2ITC C;  4L87 A;  4B7K A;  2CTR A;  4UV9 A;  5IJ0 B;  2ODM A;  2X6C A;  2WSS G;  1EM1 A;  1IDS A;  2Q68 A;  1W0J G;  3F5T A;  3H01 A;  2UXX A;  2YI9 A;  2X7R B;  5KX5 A;  1NJI W;  2YXH A;  2V4D A;  1MSW D;  2CH7 B;  2EX3 A;  3RYF B;  5B1B C;  2ZE7 A;  3SPJ A;  2X6B A;  5LHG A;  4QNH B;  3HKE A;  1QVG U;  5IDJ A;  2UUC O;  5DED A;  3D8C A;  1KQS U;  4JF3 A;  1IUR A;  3P3N A;  5KMG A;  2OTJ V;  1N4C A;  1SQP H;  3E2E A;  5L3D A;  3SYA A;  1G1X B;  5CB4 A;  4GUN A;  2DYR B;  3K57 A;  2ILM A;  1Q8I A;  4LF4 B;  1ZLZ A;  4LFB B;  2Q7E A;  1S0V A;  4P30 A;  1MMM A;  2K1E A;  4NXM O;  5B1A B;  3AG7 A;  5IJ0 A;  3T1H B;  2UUB O;  3T1Y O;  3ZHT A;  2PYJ A;  1V54 B;  5EBM C;  3K0D A;  1WP7 A;  2VQF B;  4UCT A;  1GN6 A;  3FYE B;  2UXC O;  2P90 A;  1MSD A;  5L3B A;  3IC7 A;  1K7D A;  1XI1 A;  3BY6 A;  3ZHS A;  3WG7 B;  5LMU O;  4KHP B;  3DC5 A;  2EBO A;  5L3E A;  3OE7 G;  1YXB A;  3DC6 A;  3HKD B;  2GTS A;  1RM1 C;  1ZTE A;  4GCZ A;  3IC9 A;  4FK5 C;  1TUB A;  1U96 A;  1IBL O;  1I0H A;  2DWD C;  3SJB C;  4K0K O;  5KHG A;  1IBM B;  5LXT B;  4YJ3 B;  1N0N A;  2H8P C;  3IJ4 A;  1FXK B;  4MW3 A;  3IAY A;  3EHB B;  2IJI A;  3CX5 F;  2ZR2 A;  4X65 B;  5H9C A;  2LFR A;  1VQN V;  3CCQ V;  3H1L H;  2QWN B;  2HFE C;  4YHH O;  2E76 B;  3G6B A;  3DSQ A;  2R70 A;  1S76 D;  4JI1 B;  3CE2 A;  4JI6 B;  1M93 A;  1VF5 B;  2P06 A;  1N33 B;  3E8H A;  1LNQ A;  3OEH G;  1V55 B;  4FVM A;  1EFR G;  4WCE V;  5B1B B;  4JI8 B;  2ZR3 A;  4UCV A;  3CPW U;  3F5W C;  1K3E A;  1L8D A;  4FPP A;  2NR5 A;  2JVD A;  4PDV A;  1K4C C;  5JH7 A;  2WLI B;  4X1K A;  3CCU V;  4PEL A;  1Q86 W;  1TVK A;  4LBE C;  3JD0 A;  1HNZ O;  1Z5W A;  2BTO A;  4U3J A;  5CN0 A;  1BQZ A;  3SPH A;  2CGN A;  2H3O A;  3LNM B;  2BSK B;  1NTK H;  4LF9 O;  1FFX B;  1DGS A;  1H2L A;  4CZZ A;  1HW7 A;  2DN9 A;  4NB5 A;  2XUM A;  1HNW O;  2HP8 A;  3LNN A;  4DV1 B;  1AJQ A;  2IU3 A;  1XL4 A;  4TV9 B;  4LF7 B;  4ZHQ A;  1GAX A;  3LDE A;  5IJ9 B;  2OTL V;  4DR7 B;  4FZ0 A;  2F93 B;  4UCS A;  1YF2 A;  4EKW A;  1T5E A;  1I94 O;  2Y69 B;  2RNB A;  1COW G;  5LYJ B;  2AW9 A;  1RM1 B;  1XMO O;  4ZI7 B;  1JX9 A;  5J2U B;  3E35 A;  1ZAU A;  1PV0 A;  1EN6 A;  4O2B A;  4X20 B;  4JI8 O;  3B77 A;  3ZHV A;  4QPK A;  2R72 A;  1XUQ A;  2DQ3 A;  1H2M A;  1N33 O;  4DRX A;  1HNW B;  4NTY A;  5IT9 N;  3TGU H;  1B6Q A;  1S5J A;  2E74 B;  4MSW C;  3ETD A;  3K5L A;  2PI4 A;  2ADP A;  5J9P C;  3ZHR A;  2IU0 A;  1WB8 A;  1ZUQ A;  4I50 A;  1QCE A;  2P22 C;  5IYC O;  5HFM A;  2DMX A;  4LC1 A;  4BR6 A;  4Z1V A;  1TUE B;  2QA4 V;  4RQF A;  2BCC H;  2UU9 O;  4YIP A;  4U7O A;  2JS3 A;  3C90 A;  2UXB O;  2FML A;  4DV4 B;  2X0L A;  3JAR B;  4P9O A;  3TCU A;  3ZRV A;  3CRM A;  1GN3 A;  1HR0 B;  1ZSP A;  3CCM V;  3RW0 A;  3AEI A;  4MTO A;  3E22 B;  3OMN B;  3SJA C;  5D5P A;  3E8G A;  5IWA B;  3UO2 A;  1JA8 A;  3SYP A;  2QR4 A;  4WFG A;  4DUZ O;  4PA6 A;  4DV3 O;  2GUZ A;  4DR6 O;  1YJ9 V;  4HYO A;  1VIB A;  5BMV A;  2QKC A;  1OCC C;  3KKY A;  3HKD A;  3BA8 A;  4U3J B;  1L0N H;  4GZR B;  3G6E V;  4I4T A;  2DQ0 A;  2CTW A;  3E89 A;  3BHP A;  5LBQ A;  1YSC A;  4DR3 O;  1JQ0 A;  2DYR C;  1B04 A;  4QE7 A;  5JCO A;  1PD3 A;  4GKJ B;  1VQ4 V;  3M8A A;  2IBZ H;  1KD1 W;  3GWK C;  3STZ C;  1P4R A;  4K8Z A;  2R9R B;  5BR8 B;  3B40 A;  2VQF O;  5LA6 B;  4JI6 O;  4JI1 O;  4OX9 B;  1K5S A;  2XND G;  2DYS C;  2F23 A;  1Y67 A;  2ADQ B;  3ABT A;  4FJC C;  2F4V B;  3FFQ A;  1KMI Z;  5B3S B;  3LDD A;  5LMN B;  1R3L C;  5B1O A;  2ZCE A;  4DR3 B;  3ETE A;  2IJK A;  1N32 O;  1Q43 A;  2BTQ B;  3L75 H;  3TJT A;  1W59 A;  4BW9 A;  4GX5 A;  2DW4 A;  3EVK A;  4JV5 O;  1WA8 A;  3T2M A;  5LXT A;  4BIU A;  5F2V O;  2VQE O;  2F66 C;  2YDE A;  3RYC B;  5E1A C;  4B3M B;  1HWY A;  3K06 A;  3R65 A;  3MHH C;  1URF A;  3E86 A;  2UXC B;  2Q0A A;  3BCC H;  4DUY O;  1P49 A;  5ITZ A;  3APO A;  2Q67 A;  3CHX A;  5KA5 A;  1GMG A;  1DLB A;  4H44 B;  4DUY B;  1P7G A;  1LUV A;  5LYJ A;  4IIJ A;  4DV5 O;  2JEX A;  1I08 A;  4DR1 O;  1VMG A;  3QVN A;  4I9W A;  3C3T A;  3AG4 C;  3U11 A;  1YIT V;  1Q6H A;  2L6L A;  1FJG O;  3JD2 A;  2PYL A;  4E4E A;  3J80 N;  1VQO V;  1OCR C;  2XAS A;  4DK1 A;  4GLX A;  3DXR B;  1ENV A;  2HHH B;  1FXH A;  5KHK A;  3OM3 B;  3Q4H A;  2PI5 A;  5JJE B;  2R9I A;  1YTF B;  2A0L A;  4Z2W A;  2G38 A;  3H9V A;  2EIN C;  2YUA A;  5FL7 G;  1YVW A;  2RJZ A;  3CCS V;  2XAG A;  1BL8 A;  3WB2 A;  1XNR O;  5KUM A;  4FZ1 A;  2OWO A;  1XNQ O;  4EFE A;  5CA3 A;  3K03 A;  5DM6 V;  2LO1 A;  2EIM B;  1SRY A;  4TWK A;  5EYP B;  3X2Q C;  3B4S A;  3RVZ A;  3JAR A;  3VQY A;  1PL4 A;  3UO3 A;  2VWK A;  1PM9 A;  1SQQ H;  3BPZ A;  4IHJ B;  1XDC A;  4MVO A;  3AG1 C;  1MNG A;  1AP6 A;  4HNA B;  2GHY A;  4JI2 O;  2HR3 A;  1PNK A;  4NXN O;  4DRX B;  1R3J C;  2YI8 A;  1UPG A;  1G4Y B;  3JD4 A;  4O4L B;  4BW5 A;  2HEP A;  1J5E B;  4FLX A;  4ICG A;  2QKA A;  1DK1 A;  3FB8 C;  4MW8 A;  4P2Z A;  2Z3Y A;  3ZCC A;  1S77 D;  2AHY A;  1XBL A;  3RGB A;  3UCS C;  4FLV A;  5JH7 B;  3SDL A;  4ZIB A;  4X1K B;  2LW1 A;  1QHT A;  4G27 B;  3JAL A;  4JYC A;  2YEV A;  3K3W A;  4D6T H;  4JYY A;  3FB6 C;  4UCO A;  4PA7 A;  3QTC A;  4WFH A;  3R66 A;  2Q5Z A;  2UXB B;  5JQG A;  1OCC B;  4EB6 B;  4JI3 O;  3JD1 A;  3P30 A;  3VQV A;  3DTU B;  2WLL A;  1N0J A;  1UJW B;  3KCX A;  4CH6 A;  5LHH A;  2Y4U A;  5EZY B;  3SPG A;  1KKC A;  1SA0 B;  3GVM A;  4I0X A;  2ZXW B;  1GRJ A;  1B06 A;  5FLX N;  4X64 O;  4RUF A;  1I7F A;  4WBN B;  3HKC B;  1MA1 A;  4KUM A;  4KXR A;  3ZHQ A;  1AI6 A;  3W7X A;  1IBK O;  1JCH A;  1UFI A;  1XMQ O;  3ABK B;  1AI7 A;  2UXD O;  1HNX O;  4GYC B;  3M7M X;  2FL4 A;  4CC5 A;  3BEH A;  4GKK O;  1BMF G;  5DEC A;  3JAT B;  1S5H C;  1Q5O A;  4U7N A;  4DV5 B;  1SQB H;  2F43 G;  3NR7 A;  4LF8 O;  1R1B A;  1XHX A;  5LL6 Y;  2Y69 C;  4X1Y B;  3RVY A;  3AG3 C;  1VF6 C;  3ZMU A;  4XDK A;  1A32 A;  1BHB A;  3H1J H;  4LF4 O;  1GO3 F;  2IJJ A;  2JGU A;  1S72 V;  4B3S B;  4O4L A;  1WPX A;  5A9G A;  5EC2 C;  3ZRW A;  5EBL C;  1JFF A;  3LSQ A;  1H8H G;  2YIB D;  4JI0 B;  1GK9 A;  1TVK B;  2QTO A;  3TXQ A;  4WFE A;  4JV5 B;  1Y6X A;  3RYH B;  5KHH A;  1GM7 A;  1D2D A;  4J10 A;  3UQ8 A;  1ZWI C;  4R6Z A;  5IE9 A;  1Y74 A;  3J81 N;  1BS3 A;  4HNA A;  1GM9 A;  3D3I A;  1HNZ B;  3J7A U;  4TUY A;  2QJ1 A;  2DYS B;  2Q4P A;  3C3S A;  1X59 A;  3AK3 A;  3D36 A;  4JGS A;  5IYB O;  3ZN1 A;  3SYO A;  4XDL A;  1G6U A;  4AI8 A;  2XAF A;  3E22 A;  3ABU A;  4LFA O;  2QM8 A;  1NTZ H;  3ZRX A;  2CAZ C;  4KP4 A;  2RQ6 A;  5JJJ B;  2EZP A;  2FYU H;  4J11 A;  4PDL A;  3ICX A;  3TK1 A;  1CPY A;  5H6R A;  2NLJ C;  2K9P A;  3JAW B;  4OPH A;  1GN4 A;  2WLH A;  3RWR D;  2IH1 C;  1OHH G;  4IT5 A;  5TIS Z;  1QLE C;  1WA8 B;  1M56 B;  2JDI G;  4PJ0 Z;  4RUE A;  2YIC A;  1DTO A;  4B3M O;  1VQ7 V;  2VQE B;  1D5A A;  2OT5 A;  2EIM C;  5BZB A;  3LDC A;  4R7C A;  4LNU A;  4DV6 B;  2PF4 E;  5AG2 A;  2XAJ A;  2WWW A;  1SQV H;  4JI7 B;  4DUZ B;  5FNV A;  3ZX6 A;  1SET A;  4JYB A;  3T4Z A;  3SPI A;  1BE3 H;  3CXH F;  4E2L A;  3BFR A;  3CSX A;  4JTD B;  2E3C A;  3WB0 A;  1AI4 A;  2BOC C;  2Q6A A;  4U3F H;  3RT3 C;  4LFA B;  1M57 B;  1HDJ A;  4JAA A;  4DR4 B;  2Q9L A;  2YEV B;  2XHB A;  1FXK A;  3L73 H;  5L3C A;  2IH3 C;  1M90 W;  1E1R G;  3HKB B;  3STL C;  1HNX B;  4LF5 O;  2GDS A;  1ARO P;  3O65 A;  1ROP A;  1K4D C;  1K92 A;  4BIO A;  3BRC A;  1SQF A;  1US6 A;  1Q7Y W;  2RDC A;  2AZ2 A;  2ZIM A;  3ML0 A;  1WB7 A;  4JI5 O;  3G67 A;  3W7T A;  3K59 A;  1KBH A;  4GX0 A;  1F23 A;  4KL1 A;  3SR2 C;  1K8A W;  3JAS A;  4I55 B;  4B7E A;  2DWE C;  3RYI B;  4AIL C;  4PV1 B;  4UB8 Z;  2ZNI A;  2CDY A;  4MTX A;  2QSA A;  4TOI A;  3FD9 A;  4X88 A;  2ITD C;  5A2Q N;  1QR9 A;  1YI2 V;  4GX1 A;  3K0G A;  2OIE A;  2ZIN A;  5IWA O;  4FM1 A;  3W7S A;  4AQY O;  1Y76 A;  1R73 A;  1K5Q A;  1NVP D;  4TUY B;  3B2E E;  4D7S A;  1W2B U;  3AG1 B;  1HR0 O;  1XEQ A;  5H6Q A;  3FAV A;  3JAL B;  3L71 H;  3OFN G;  4BIZ A;  2QWO B;  4N21 A;  2M6Y A;  1K34 A;  1V9P A;  2Q7G A;  1OCR B;  4TV9 A;  3VQX A;  2P6J A;  2L35 A;  1V54 C;  2ARH A;  2NN4 A;  3E8F A;  4LNU B;  1ZX3 A;  3ABL B;  4QPJ A;  5IJ9 A;  4DR7 O;  5C8Y B;  2LQT A;  4X1I A;  4JTC B;  3ASN B;  4NXN B;  1PPJ H;  1N34 B;  4JI4 O;  4Z1M G;  3BAA A;  4I0X B;  4MVR A;  2NNU A;  2EIN B;  4LP8 A;  4MTG A;  1FKA O;  4QE9 A;  2D2C B;  5J2U A;  2GUZ B;  3G4S V;  5GW7 A;  3OD4 A;  4WBN A;  4IYH A;  5GTI Z;  1H2S B;  2OYQ A;  3CC4 V;  3UM7 A;  4JZ2 A;  4QGP A;  3I55 V;  4DV4 O;  3OR6 C;  5KHJ A;  4JYA B;  4PI2 A;  1JMK C;  3NXS A;  1NR1 A;  1Q90 D;  1FPO A;  3WFV A;  3X2Q B;  3ZBH A;  5EZY A;  2YID A;  1FYJ A;  4H13 B;  3TET A;  4DV0 O;  1NZ6 A;  1XNR B;  3CRA A;  5LP6 C;  3ETQ A;  3IGA C;  5CBG A;  1E1Q G;  3CYO A;  1H2G A;  1R6K A;  2Y48 A;  5FPR A;  4JYA O;  1N36 B;  2EZO A;  1SQG A;  3HKC A;  4X89 A;  1YIJ V;  4WF9 V;  1XHZ A;  1VP7 A;  4I50 B;  2H94 A;  4G2K A;  4ZBM A;  1TGO A;  2DE0 X;  2P67 A;  4NR1 A;  1EZJ A;  4LF6 B;  4B3T O;  3H1K H;  3B8N A;  1ZL8 B;  3CP1 A;  1DF4 A;  1HP8 A;  2OCH A;  3CRR A;  4F6R B;  4UCU A;  5EK0 A;  4ZI7 A;  2WA4 A;  3CD6 V;  5CBH A;  2FB5 A;  3WG7 C;  5LP6 A;  3G80 A;  3JCU Z;  1PNL A;  1OCZ C;  4X20 A;  3DXR A;  2GV9 A;  1NH2 B;  1SC5 B;  2KB1 A;  4X1Y A;  3AG3 B;  1R3K C;  2UXN A;  2Q69 A;  2E5L B;  4TQD A;  2P7T C;  3HB3 B;  2VS0 A;  2PGG A;  2XAH A;  2QDO A;  1OJH A;  3JSN A;  1OCO C;  2HG5 C;  3OT7 A;  5K1P A;  3MDS A;  2XAQ A;  4LF7 O;  5C8Y A;  2XOK G;  2Q0O C;  2P4K A;  3CMA V;  4NTW A;  1H8E G;  3A8T A;  3VOU A;  4FM0 A;  1QLE B;  3CB2 A;  2ZM6 O;  4NXM B;  1K97 A;  1PNM A;  4LF9 B;  1M57 C;  3AG2 C;  1PKX A;  2HVJ C;  2ATK C;  2BSK A;  4QJF B;  2YS8 A;  1N36 O;  4DR5 B;  2ZD9 A;  3JSL A;  2QKS A;  3CCR V;  3A0B Z;  3B09 A;  3PJS K;  1E79 G;  3I5D A;  2CUG A;  1Q6U A;  4UB6 Z;  3ZN0 A;  4CC6 A;  4TV8 A;  1SZT A;  3N2K A;  1SKV A;  2ZDI C;  4K8X A;  1GKF A;  1AVM A;  2WA3 A;  2EIK C;  1VQ8 V;  4RWU A;  4IL6 Z;  1YCI A;  5LOV A;  5JCO C;  1VQM V;  1DF5 A;  1V55 C;  3QG5 A;  2AXT Z;  4H33 A;  3L70 H;  5BY1 A;  3T1H O;  2JIZ G;  3CCL V;  3K9S A;  1FJG B;  4LFB O;  2AGA A;  1CXZ B;  5EBW C;  4JPR A;  1GH6 A;  2JGD B;  2UUA B;  1IBM O;  1K73 W;  1P84 F;  2CH7 A;  2WLK A;  4LH7 A;  1FS0 G;  1L0L H;  3AK2 A;  2ZIO A;  4G28 B;  3A2F A;  3H1H H;  4LF5 B;  3AG2 B;  3ZMV A;  1FAF A;  1SES A;  1XIL A;  1QNM A;  1L1F A;  4I9Q A;  5GON A;  3P32 A;  3ZMT A;  1KUQ A;  2JK5 C;  3SJQ C;  3I56 V;  4F6E A;  4JAS A;  4MVM A;  5B1A C;  4DR4 O;  4IIJ B;  5B5E Z;  1NH2 D;  4OX9 O;  4PA4 A;  4OGQ B;  4O4I B;  5IYD O;  4DV7 O;  3LSS A;  3A0H Z;  1Q6I A;  2YSU B;  1TA8 A;  3OEE G;  4XDJ A;  5LGT A;  1WN7 A;  4C7U A;  2UUB B;  5B3S C;  4NKG B;  3K5N A;  3QNE A;  2N74 A;  3D3Q A;  5JJN B;  1Q81 W;  4JI7 O;  3OGC C;  1XOU A;  1MG1 A;  4Q6G A;  2EIJ C;  2HLD G;  5IY5 B;  4N23 A;  2OCC B;  2PY5 A;  3KG2 A;  3ABM C;  4CBC A;  3Q4H B;  2QE7 G;  2AHZ A;  4LWS B;  4TSF G;  4X8A A;  3CC7 V;  3W7W A;  3CJH A;  3QO7 A;  2QM4 A;  5CMU A;  3RYF A;  5LGU A;  1H38 A;  3CEI A;  3HKE B;  2F4V O;  2ZM6 B;  2DJV A;  3K79 A;  1KKD A;  4UVB A;  1JOY A;  5KMG B;  1AR4 A;  1BCC H;  4KFM A;  1I5X A;  3ASO C;  4RQE A;  1YJW V;  1XQ8 A;  1O9G A;  4DV7 B;  4JZG A;  5CA0 A;  4J7Z A;  5J2T B;  5EYP A;  1NU1 H;  2GSM B;  3HKB A;  4NVP A;  4PA9 A;  5LOV B;  4GKJ O;  4PDR A;  3ZMZ A;  4J9Y B;  4L8J A;  1TAE A;  2WLN A;  4FFB B;  5LP6 B;  5LGN A;  1AR5 A;  3CCE V;  4H37 A;  4WFF A;  4X62 B;  1F51 A;  3MHS C;  4DR5 O;  4PDM A;  3JAM N;  4XBF A;  1VQL V;  4LH6 A;  2ZE5 A;  4UXN A;  2JJ2 G;  3ZS8 C;  2UUA O;  1RSO A;  1P7B A;  4DR6 B;  2MK3 A;  4TQF A;  4DV3 B;  1NR7 A;  2CK3 G;  1OCZ B;  4ZHQ B;  2UXD B;  2YC0 A;  2E75 B;  3H1I H;  1IBK B;  5EIB C;  2ZXW C;  4DK0 A;  1BZK A;  2PTM A;  3E8B A;  2QGN A;  1MZF A;  3VBB A;  3W7U A;  3AG4 B;  2B5U A;  4HAM A;  1OV9 A;  1W0K G;  3P3P A;  2V7Q G;  4LFC O;  1EN5 A;  3CME V;  4PHZ A;  3L72 H;  1RPO A;  1JJO A;  1ZL8 A;  2YIB A;  4EB6 A;  1XRE A;  1ORQ C;  1EZV H;  1NS1 A;  2A3Q A;  4MVU A;  3B8M A;  2UU9 B;  4DV0 B;  4X66 O;  1Q82 W;  2RN9 A;  1XL6 A;  4GKK B;  4X66 B;  1NKD A;  3MD0 A;  4OXS A;  4DR2 B;  5FNV B;  2B9Z A;  1RP3 B;  3F7V C;  4TV8 B;  5KUK A;  1KEC A;  5KAI Z;  1SER A;  2A79 B;  3ZRW B;  4YY3 B;  1YDX A;  3QO5 A;  2B1I A;  1D5N A;  3CRC A;  1VAR A;  4LF6 O;  1G8M A;  2JJ1 G;  2QWP B;  3SYC A;  4R50 A;  2JS5 A;  4DO2 A;  1VQ9 V;  1Y4M A;  2VRZ A;  4A5U B;  1KC8 W;  2YXL A;  4IHJ A;  2KG7 B;  1H2K A;  4DYL A;  5BXZ A;  2P5O A;  4YJ3 A;  1QLN A;  1FFX A;  1IZ3 A;  1IBL B;  4FLW A;  4LF8 B;  3LUT B;  2BOB C;  3ASN C;  1XMO B;  2E5L O;  5FPO A;  1CEZ A;  3CC2 V;  2HJD A;  5C93 A;  2XTA A;  1U97 A;  4OPA A;  3G71 V;  1FXV A;  1Z5V A;  5E79 Z;  2EIK B;  1IX9 A;  2FTK A;  3N2K B;  2P4V A;  3SYQ A;  5JVD A;  1XMQ B;  1GN2 A;  4IGG A;  2EJ7 A;  5CB4 B;  5D5Q A;  3K9A A;  4AQY B;  4B3T B;  2QTS A;  1J5E O;  1F4M A;  1QR8 A;  3RYH A;  2VWJ A;  2QM7 A;  5CA1 B;  4FLU A;  3APQ A;  4YHH B;  2QEX V;  4FFK A;  1BSM A;  2HKO A;  4DV2 B;  3MAQ A;  5KHI A;  3FYI B;  3AK1 A;  4X65 O;  4I7Z B;  4BWA A;  3OR7 C;  3ABL C;  4DXW A;  4LR3 A;  3T4D A;  4ABM A;  3OUF A;  1AB3 A;  2QWQ B;  4J80 A;  5KA6 A;  1KU9 A;  3L74 H;  3CJH B;  4X1I B;  2F95 B;  2WLI A;  1NT2 B;  1VQ5 V;  2A7W A;  4CS2 A;  4J42 A;  5LMU B;  4GT1 A;  3JAW A;  1XNQ B;  4WFB V;  1BT8 A;  4ASU G;  3M99 B;  1JR9 A;  5GON B;  2CE4 A;  2LJ2 A;  5J2T A;  1IVS A;  3OGI B;  3BAB A;  3ABK C;  1KB9 F;  1IXB A;  4JTA B;  3JCZ A;  5LHI A;  3T1Y B;  2Y0P A;  1AIL A;  3S3X A;  5LA6 A;  4H0L B;  1NQT A;  4QIW F;  1I5Y A;  1M9N A;  3A0R A;  1QQC A;  4JI5 B;  2EIJ B;  1IXM A;  1M1K W;  3JAK B;  1AR1 B;  3OUS A;  3RYI A;  1JPX A;  4JI2 B;  2EIL B;  2KQX A;  3EFF K;  5HFL A;  5CBF A;  3UT5 A;  4MS2 A;  1SF9 A;  3F7Y C;  2UUC B;  2WAM A;  3OW2 U;  1VQ6 V;  5DN6 G;  4KHP O;  4J41 A;  5ITZ B;  4YIO A;  2JEU A;  3O9O A;  4DR1 B;  3PN1 A;  4O2A B;  2ZDI A;  4CH5 A;  3GWO A;  4ZOL A;  5GTH Z;  1NVP B;  1AJN A;  3ZRS A;  3RN4 A;  3WU2 Z;  4UV8 A;  3RYC A;  2ZQM A;  3L9D A;  2W6J G;  1R6N A;  5KLV H;  2Y4T A;  4FM2 A;  4W4L A;  4MVQ A;  4UUJ C;  1EN4 A;  4RAI A;  2DOS A;  2JGD A;  3CRQ A;  1OCO B;  3IFX A;  2HVK C;  3JD3 A;  2Z5U A;  2GBO A;  5B66 Z;  1K33 A;  1Y66 A;  2CTP A;  4B3R B;  2WLJ A;  4YJ2 B;  5EC1 C;  1JJ2 U;  3TXS A;  2W6I G;  2YXY A;  2PUS A;  1N32 B;  3ZED A;  2A9H A;  3OAA G;  2X6A A;  3UKM A;  4DW1 A;  1AJP A;  1X4T A;  1TUB B;  1WAZ A;  2BTQ A;  4P9P A;  4O4I A;  1NTM H;  1RPR A;  3FB5 C;  2N05 A;  1VQP V;  4NTX A;  1AP5 A;  4YXW G;  2KKW A;  2CTQ A;  3FAV B;  2LW7 A;  1BHA A;  1WLE A;  4EEQ A;  1S3J A;  5L3G A;  4UFZ A;  1OZ0 A;  3RBZ A;  5H2F Z;  4R8C A;  2N04 A;  5IY5 C;  5BMV B;  3K5O A;  3ABM B;  3K08 A;  3QO8 A;  1M4U A;  1LR1 A;  1B3Q A;  1GM8 A;  2ETN A;  5IYZ B;  3UT5 B;  1LUW A;  4HZ3 A;  1VQK V;  4NYK A;  1J95 A;  2XT9 A;  2RMK B;  4PI0 A;  3LSU A;  4GX2 A;  1H2N A;  1S5L Z;  1NI8 A;  1SQX H;  3N2G A;  3T1C A;  1THZ A;  2IJH A;  1N8R W;  2LFS A;  4I5S A;  2KSD A;  2ZKO A;  3SGI A;  3JAK A;  2OCC C;  5JWP A;  1F7Y A;  4TT3 G;  4DW0 A;  4O4H A;  3OTO B;  2Z0A A; 
#chains in the Genus database with same CATH homology
 3D36 A;  5IY5 B;  1GTO A;  4JGS A;  3SPC A;  5IYB O;  3GB7 C;  2OCC B;  4N23 A;  1JVM A;  3ZN1 A;  3KG2 A;  3ABM C;  3SYO A;  4CBC A;  3OMA B;  4F4L A;  1B6Q A;  4XDL A;  2QE7 G;  4MSW C;  2AHZ A;  3ETD A;  4TSF G;  4X8A A;  2XAF A;  3ABU A;  1M56 C;  2PI4 A;  3CC7 V;  3W7W A;  2QM8 A;  5J9P C;  3QO7 A;  5CMU A;  1KP3 A;  3ZRX A;  3ASO B;  4KP4 A;  5LGU A;  1H38 A;  2V1D A;  2IU0 A;  2EZP A;  4PDL A;  1QCE A;  3TK1 A;  4J9Z B;  3K79 A;  1KKD A;  4BAY A;  4UVB A;  1CPY A;  3E83 A;  4MTF A;  5H6R A;  5IYC O;  5HFM A;  1JOY A;  4UVA A;  2NLJ C;  2WLH A;  1FFT B;  4KFM A;  4LC1 A;  1I5X A;  3ASO C;  4RQE A;  1YJW V;  2IH1 C;  1OHH G;  1TUE B;  2IW5 A;  2QA4 V;  4RQF A;  1QLE C;  3ZMS A;  1M56 B;  2JDI G;  4RUE A;  4U7O A;  1DTO A;  2GSM B;  4PA9 A;  1VQ7 V;  4ZKI A;  2X0L A;  4PDR A;  3ZMZ A;  4J9Y B;  2OT5 A;  2EIM C;  5BZB A;  4P9O A;  3TCU A;  2WLN A;  1QBZ A;  3ZRV A;  2D3O W;  1FXK C;  5LGN A;  3CCE V;  4H37 A;  4WFF A;  3LDC A;  4R7C A;  3CCM V;  1F51 A;  3MHS C;  3RW0 A;  4PDM A;  1AI5 A;  4XBF A;  1VQL V;  2XAJ A;  3AEI A;  2WWW A;  4UXN A;  2JJ2 G;  4MTO A;  1R3I C;  3OMN B;  3E8G A;  1SET A;  4JYB A;  3T4Z A;  3SPI A;  3SYP A;  1P7B A;  4E2L A;  2MK3 A;  1NR7 A;  4WFG A;  2CK3 G;  1OCZ B;  4PA6 A;  4JTD B;  2B1G A;  1YJ9 V;  4HYO A;  4WFA V;  4FIP C;  1NBM G;  1OCC C;  1AI4 A;  2BOC C;  2Q6A A;  2ZXW C;  1MOF A;  4MVZ A;  3OMI B;  3G6E V;  3E8B A;  1M57 B;  2DQ0 A;  1KP2 A;  3VBB A;  3AG4 B;  3E89 A;  2B5U A;  3W7U A;  4HAM A;  3K04 A;  4MVS A;  5LBQ A;  1YSC A;  1JQ0 A;  2C2A A;  2YEV B;  1MAB G;  1FXK A;  1W0K G;  5L3C A;  2IH3 C;  1M90 W;  3ETG A;  1E1R G;  2V7Q G;  2DYR C;  4UVC A;  4JAV A;  1F4N A;  3CME V;  3STL C;  1RPO A;  4QE7 A;  1PD3 A;  1VQ4 V;  1ARO P;  1ROP A;  1K4D C;  1ORQ C;  2EJR A;  2WPD G;  1K92 A;  1KD1 W;  1Q7Y W;  5B1N A;  4MVU A;  3B8M A;  3STZ C;  1P4R A;  4FMT A;  4PA3 A;  2R9R B;  3ML0 A;  1Q82 W;  3W7T A;  1XL6 A;  1EBO A;  4GX0 A;  1F23 A;  1YTF D;  1NKD A;  1PL0 A;  3MD0 A;  4OXS A;  1K5S A;  2EIL C;  2DYS C;  2XND G;  3CCJ V;  3ABT A;  1K8A W;  3F7V C;  2WLM A;  4FJC C;  1QVF U;  5KUK A;  2DWE C;  1KEC A;  1SER A;  2A79 B;  5L3F A;  3ZRW B;  4JAU A;  5B3S B;  4MTX A;  3LDD A;  3QO5 A;  2B1I A;  1R3L C;  4X88 A;  2ITD C;  1QR9 A;  5B1O A;  4LCU C;  1YI2 V;  4GX1 A;  3K0G A;  3W7S A;  1G8M A;  2JJ1 G;  3ETE A;  3SYC A;  2IJK A;  4R50 A;  3FB7 C;  1R73 A;  4DO2 A;  1K5Q A;  1NVP D;  1VQ9 V;  1Y4M A;  3JYC A;  1KC8 W;  1W2B U;  3AG1 B;  4GX5 A;  2DW4 A;  4RO2 A;  2M7W A;  5H6Q A;  3T2M A;  3FKS G;  4BIU A;  1QLN A;  3OFN G;  1CP9 A;  4BIZ A;  5E1A C;  1HWY A;  3K06 A;  4N21 A;  3HPL C;  3R65 A;  3MHH C;  1K34 A;  3LUT B;  3E86 A;  1OCR B;  3ASN C;  2BOB C;  2LP7 A;  2P6J A;  1V54 C;  1K9M W;  3E8F A;  1CEZ A;  3ABL B;  4QPJ A;  4MT8 A;  3CC2 V;  2Q67 A;  5C93 A;  5KA5 A;  1GMG A;  1DLB A;  4JTC B;  3ASN B;  3CCV V;  3G71 V;  1FXV A;  2W0F C;  4Z1M G;  2EIK B;  4MVR A;  2FTK A;  2JEX A;  2NNU A;  2EIN B;  4LP8 A;  4MTG A;  3SYQ A;  4QE9 A;  3ZIA G;  3CXC U;  4I9W A;  2HJF C;  3G4S V;  5GW7 A;  3AG4 C;  3K9A A;  1YIT V;  1F4M A;  1QR8 A;  2QM7 A;  1YHQ V;  3ZJZ A;  3CC4 V;  3DGE A;  3UM7 A;  2QEX V;  3I55 V;  2WLL B;  4Q20 A;  1YJN V;  3OR6 C;  2ITC C;  3JD2 A;  4L87 A;  2HKO A;  1VQO V;  3FYI B;  4UV9 A;  3NXS A;  1NR1 A;  1OCR C;  2XAS A;  3WFV A;  3X2Q B;  2X6C A;  3OR7 C;  2WSS G;  1ENV A;  3ABL C;  1FXH A;  4DXW A;  3TET A;  2Q68 A;  3OM3 B;  1W0J G;  3T4D A;  3H01 A;  2UXX A;  2PI5 A;  2X7R B;  3OUF A;  3IGA C;  2R9I A;  5CBG A;  1YTF B;  1E1Q G;  2A0L A;  3CYO A;  1NJI W;  1H2G A;  1R6K A;  2Y48 A;  5KA6 A;  1MSW D;  2EZO A;  2EIN C;  5FL7 G;  4X89 A;  1YIJ V;  4WF9 V;  5B1B C;  3SPJ A;  2WLI A;  2X6B A;  5LHG A;  4QNH B;  2H94 A;  5IDJ A;  1QVG U;  1VQ5 V;  4G2K A;  1KQS U;  3CCS V;  2XAG A;  4JF3 A;  4ZBM A;  1BL8 A;  2P67 A;  4GT1 A;  5KUM A;  2OTJ V;  4WFB V;  1EZJ A;  4ASU G;  3E2E A;  3M99 B;  5L3D A;  5CA3 A;  3SYA A;  3K03 A;  3B8N A;  5DM6 V;  3CP1 A;  2EIM B;  1DF4 A;  1SRY A;  4TWK A;  3X2Q C;  3ABK C;  2DYR B;  5EK0 A;  4JTA B;  3JCZ A;  3CD6 V;  3RVZ A;  5LHI A;  1S0V A;  5CBH A;  4P30 A;  3WG7 C;  2K1E A;  5B1A B;  1PNL A;  1OCZ C;  1NQT A;  1V54 B;  1I5Y A;  1M9N A;  4QIW F;  5EBM C;  3K0D A;  1NH2 B;  3A0R A;  2KB1 A;  4MVO A;  2EIJ B;  3AG1 C;  3AG3 B;  1R3K C;  2UXN A;  1IXM A;  2Q69 A;  1M1K W;  3FYE B;  2GHY A;  1AR1 B;  3OUS A;  2HR3 A;  1JPX A;  2P7T C;  3HB3 B;  2P90 A;  1PNK A;  5L3B A;  3IC7 A;  1K7D A;  1R3J C;  2EIL B;  2XAH A;  3BY6 A;  3EFF K;  1G4Y B;  3JD4 A;  5HFL A;  5CBF A;  3WG7 B;  4MS2 A;  4BW5 A;  2EBO A;  1OCO C;  2HG5 C;  3F7Y C;  2WAM A;  5L3E A;  3OW2 U;  1VQ6 V;  3OE7 G;  5DN6 G;  2XAQ A;  3FB8 C;  2XOK G;  4MW8 A;  4P2Z A;  1RM1 C;  2Z3Y A;  3ZCC A;  4GCZ A;  2JEU A;  1S77 D;  2AHY A;  3CMA V;  4FK5 C;  2ZDI A;  3GWO A;  1H8E G;  2DWD C;  3VOU A;  1NVP B;  1AJN A;  1QLE B;  3ZRS A;  4G27 B;  2H8P C;  4JYC A;  2YEV A;  1FXK B;  4UV8 A;  4MW3 A;  3K3W A;  2ZQM A;  1K97 A;  1PNM A;  3EHB B;  2IJI A;  3FB6 C;  4PA7 A;  2W6J G;  2ZR2 A;  1M57 C;  1R6N A;  3AG2 C;  4WFH A;  1PKX A;  2HVJ C;  5H9C A;  2LFR A;  1VQN V;  2ATK C;  3CCQ V;  4QJF B;  1OCC B;  4MVQ A;  2HFE C;  3JD1 A;  3P30 A;  3DTU B;  4UUJ C;  2ZD9 A;  4RAI A;  2WLL A;  2QKS A;  1UJW B;  3CCR V;  1S76 D;  1OCO B;  5LHH A;  3IFX A;  2HVK C;  3JD3 A;  3SPG A;  3PJS K;  1E79 G;  2Z5U A;  3E8H A;  1LNQ A;  3OEH G;  3ZN0 A;  1SZT A;  1K33 A;  2ZXW B;  1V55 B;  1Y66 A;  1EFR G;  4WCE V;  2WLJ A;  5B1B B;  2ZDI C;  1GKF A;  2ZR3 A;  5EC1 C;  3F5W C;  3CPW U;  1JJ2 U;  2W6I G;  1K3E A;  4RUF A;  2EIK C;  2A9H A;  4FPP A;  3OAA G;  4KUM A;  1VQ8 V;  2X6A A;  3UKM A;  4PDV A;  1K4C C;  1AJP A;  2WLI B;  3CCU V;  4PEL A;  1AI6 A;  3W7X A;  1VQM V;  1Q86 W;  1JCH A;  4P9P A;  1DF5 A;  3ABK B;  1AI7 A;  4LBE C;  1V55 C;  3JD0 A;  1RPR A;  3FB5 C;  4H33 A;  5CN0 A;  1VQP V;  4YXW G;  3SPH A;  2JIZ G;  3LNM B;  3CCL V;  3BEH A;  1BMF G;  4CZZ A;  5EBW C;  4JPR A;  1BHA A;  1WLE A;  1S5H C;  1S3J A;  1K73 W;  4U7N A;  2WLK A;  5L3G A;  1AJQ A;  2IU3 A;  1FS0 G;  1XL4 A;  2F43 G;  1OZ0 A;  3RBZ A;  4R8C A;  4G28 B;  2Y69 C;  3LDE A;  3RVY A;  3AG2 B;  3ZMV A;  5IY5 C;  1SES A;  3AG3 C;  2OTL V;  3ABM B;  1L1F A;  3K08 A;  3ZMU A;  4XDK A;  3P32 A;  3QO8 A;  3ZMT A;  1BHB A;  2JK5 C;  3SJQ C;  3I56 V;  4EKW A;  4JAS A;  1GO3 F;  1GM8 A;  2Y69 B;  4MVM A;  2IJJ A;  5B1A C;  1S72 V;  1COW G;  1WPX A;  4HZ3 A;  1VQK V;  1J95 A;  5EC2 C;  1RM1 B;  3ZRW A;  1NH2 D;  5EBL C;  1JX9 A;  4GX2 A;  3E35 A;  3LSQ A;  1H8H G;  4PA4 A;  3T1C A;  1GK9 A;  5IYD O;  2QTO A;  3LSS A;  4WFE A;  2YSU B;  1THZ A;  2IJH A;  3OEE G;  1N8R W;  2LFS A;  4XDJ A;  1GM7 A;  5LGT A;  3B77 A;  4I5S A;  5B3S C;  1ZWI C;  4R6Z A;  3QNE A;  4QPK A;  2OCC C;  1GM9 A;  1Q81 W;  3D3I A;  2DQ3 A;  4TT3 G;  3OGC C;  2DYS B;  1MG1 A;  2EIJ C;  2HLD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...