2A9KA

Crystal structure of the c3bot-nad-rala complex reveals a novel type of action of a bacterial exoenzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-A
publication title Crystal structure of the C3bot-RalA complex reveals a novel type of action of a bacterial exoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 62
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a9kA00
1DEKA 4QBGB 2QM7A 1CJTC 1D9XA 1G3RA 1G6OA 4MRVA 1S2MA 4ASUA 4QM6A 1QHHB 2QBYB 1KI6B 3EZ2A 1NY5A 2ZVPX 5JFGA 5EUMA 2PJZA 1OXXK 1G1MA 4XVUA 5P21A 3GJ5A 1X8LA 3LAWA 4PPFA 5FUVA 2ZIAA 3K09A 1II0A 1E2EA 1P60A 5SZHB 4DB2A 4US1R 4G5OA 5ANRB 3P20A 4IOMA 5UKDA 4KITB 1DELA 2JJ2D 3HYRA 4R71A 2BIFA 1RVDA 2Z4RA 2ZRKA 3PENA 5DGXA 5CITA 4FMCF 4DEXA 5JJLA 5A5GA 3U60B 1N5LA 3QG5A 1D2MA 4ZCLA 2QAGB 1U8AA 3EARA 2X8AA 1ODFA 4PSAA 4TTQA 4DCTA 1Z83A 4Z51A 2O52A 1Z28A 3FMOB 3OEHA 1KSGA 3PIRA 2YWHA 2ODEA 4LYAA 2VHCA 3TRFA 5DHAA 3QXSA 3ADKA 2OUKA 3WMFA 2J5XA 1NLZA 4W9MC 4AI6A 4MUAA 3GCGA 2GF9A 4EPRA 2Z0MA 1G20E 2LKCA 4GZLA 3WBKA 2GXSA 5CM9C 1S0UA 3BERA 4RD3A 2ZUBA 4XWKA 3FE2A 5KPJA 4L8GA 5JSZB 3SBDA 2VYFA 2C78A 2OV2A 4BLSA 2IX3A 5JWOA 3T1VA 4BZQA 3F3YA 4US0R 2YV5A 4MUBA 1G8HA 5FOTA 1KAGA 1XD2A 2Q9BA 3RS0A 2AFIE 4HLCA 1N6HA 3TK1A 3PEVA 4JBXA 3WHLA 4IDQA 2OXCA 1HH4A 4JLDA 2ODWA 5HE9A 4A2WA 3GLHE 2GEUA 2VTKA 3L43A 4HAWA 3KZ1E 3ASZA 221PA 1U81A 1FQKA 5FPSA 5F9HA 3EZ6A 4HLUA 1OH6A 2OFXA 4DSUA 1EX6A 2P2LA 4B6FA 3IILA 1EFTA 3KTAB 3CBQA 1PV4A 1A2KC 1OH8A 1OV4A 2G88A 3FVQA 1RC8A 4TL9A 5FOUA 1I4LD 1E6CA 4LJ4A 1ZNYA 5TARA 2GAOA 2W0MA 1VYUA 1E32A 3PUYA 1FTNA 3K0EA 5F2EA 2K5UA 1Z07A 1XEWX 4QNMA 3I92A 1UBFA 1IN6A 1CJKC 3KQLA 1II9A 4R7ZA 1DBSA 1OIWA 2F43B 3LLMA 3KXIA 2HUPA 1BKDR 2JDIA 4PZLA 1KJWA 4U00A 1UPTA 1XJQA 2QP3A 4S35A 3FFAA 1NVWQ 4LJ8A 4QGHA 2D4HA 2KBFA 2W2XA 1T91A 4PC2A 2C77A 2GZAA 3CPJB 2ZSEA 1ZU5A 2TMKA 3DEFA 1JEDA 4PSVA 3LVRE 3SOPA 2O8EB 2JIZA 2JLYA 3A6PC 3GFTA 3CONA 4I1UA 5G3ZA 2D62A 3C14C 3VR6A 1Z0DA 2DFKB 2V54A 1JR3E 5EE0A 4EFNA 3D7MA 3AGQA 5L3SA 3DHWC 4ARZA 4RD4A 1UKEA 1W0JD 1X1RA 4RFSA 3OIVA 4Q00A 4O0MA 1F2UA 4A36A 1CF4A 2AKYA 1KSJA 2V8OA 4UNQA 1T4GA 1VG1A 1UEIA 2AK3A 2J46A 3A4LA 3DZDA 3FHCB 4YXWA 2W2TA 3N5CA 3H4MA 4JBWA 3H84A 3A4MA 1W7AA 1I2MA 1J2JA 3GEHA 3AVPA 3U44B 2PH1A 1TPZA 2H1LA 3GEIA 3IIKA 4YONB 1Z47A 4RKFA 1XDBA 1X8JA 2FG5A 1RRPA 1E2JA 1ZU4A 3B13B 3FPAA 2CEAA 2FPLA 2IF2A 3U6BA 1ZNWA 4BQSA 4V03A 4EPVA 3R9IA 2QAGC 3WMEA 121PA 1ZUHA 4KVAA 3A58B 1HT2E 3K9NA 3T1QA 2BEJA 4MGZR 4B2IA 3TIFA 3P32A 1UJ2A 5J47A 4HDOB 1TEVA 1U98A 2R9VA 4PZZA 5LB2A 4ZIRA 2ZUDA 5AK0A 1OE0A 2IYXA 2YYZA 1CLUA 2V6JA 2VF7A 4OQXA 3FHTA 4BRUA 3ZZTA 2IUTA 2B7BA 1T8TA 1SVKA 2OAP1 3QG1A 3K1JA 3CH4B 4M21A 4PXAA 5EJEA 3QJYA 3AGPA 3Q72A 5HKKA 4XIGS 4TL8A 1BMFD 2R8RA 4Q18A 4YMSA 4TLDA 3GLFA 4FMCB 4ON9A 5F98A 2B92A 4EDHA 1PLLA 4I99A 2HYDA 2GJSA 4BECA 3TNFA 3J81k 1NL3A 2XNDD 3SEAA 4BLOA 2NOAA 3UIEA 2NIPA 2AK2A 2VP9A 2WAXA 1X8KA 4P0TA 4NTZA 1M8PA 3HU1A 4LX0A 5EXSA 3RVBA 3BXZA 3MMPA 4NYJQ 3B7GA 4DHEA 4D25A 4ZCMA 2YNMA 3CRRA 3DZ8A 1CU1A 3IBGA 2FA9A 2BMDA 2YINC 1P61B 3ASYA 3U3KA 3OEED 4M53A 3U4QB 2H18A 1YZLA 2PT5A 2WKQA 1X86B 3QKSA 4KSCA 3DM9B 2GTPA 3CRW1 4F4CA 1U8YA 2QRZA 1IXRC 1DVRA 5DI3B 3DOFA 4LV6A 3DKPA 4POAA 4XH9B 4DXAA 2HJGA 3MSXA 1E9DA 1SXJE 3SHWA 1E96A 3P27A 1E98A 1TUIA 2D3WA 3KQKA 1WBBA 3SNHA 4KVGA 2WSMA 1RRGA 4IHQA 4D4LA 2GRJA 2F6RA 3BB1A 1W0KD 2QENA 2ORVA 1IONA 2C96A 3SJBA 3W8NA 2NQ2C 4GL2A 1NKSA 2F1IA 3PUVA 2ZRPA 3EZFA 3U5ZB 1SVLA 4ZI3A 1W36B 1Z0JA 3B60A 1TF7A 1LB1B 1Z22A 3CF2A 3VKWA 2IYRA 2EFGA 3QF4A 4Q66C 5JRJA 1ZM3A 5EP2A 1A1VA 5EE3A 3SJZA 3ZQ6A 3GLHB 1A2BA 1AJEA 4PC7A 2QQ0A 2ZVQX 1XMVA 1DTSA 1F60A 3K0SA 1KMQA 4KJZA 4I81A 3IBYA 4PTLA 1MV5A 3CR7A 3GD7A 4LV8B 5CJ2A 3QKUA 2ZRNA 1XPRA 3LQQA 3O8BA 2ZJZA 2GBLA 4U7DA 1P73A 3WRXC 3KFVA 1D8TA 4DDTA 2C9YA 3O8RA 1VKJA 4ERNA 4OQFA 1J8YF 3GLGB 2MSCB 4DKXA 2OEPA 5AJWA 3W34A 3DOEA 4XWAA 1MR3F 2OFOA 3Q7PA 1CR4A 2QMUA 5LBIA 1RFLA 3FOZA 4BLTA 3W9YA 2XSZD 4MGIR 3KXKA 4C9BA 5D3MA 1BYUA 2WPDD 2ZI7A 1OSNA 3B9QA 1VG9B 2ZRFA 4QXAA 4DJTA 5CB8A 1ZM7A 4ILEA 2A5JA 2FMXA 2G0NA 3EA0A 2J59A 3EWSA 2ZRCA 4A6XA 1FP7A 4XSGA 2LWIA 2NG1A 1XEWY 1W36D 2ERYA 3T34A 1P9WA 1XMJA 2CK3D 3NDBB 4AYWA 4TMKA 2B7CA 1FFHA 1GL6A 1L4UA 2IS1A 3DO6A 1WBDA 2G0TA 3HJNA 3DM5A 1XTKA 4BFVA 1E2HA 1VCOA 2OZEA 4P4SB 2VO1A 4ZDWA 1M74A 2FGJA 3B78A 4C0LA 4TMWA 4CDGA 2KWIA 4ZDIA 2HCJB 3ZD6A 5AJZA 2UZIR 3TSOA 1DO0A 1E9RA 1P2SA 5CDFE 3R9WA 4RZUA 3FMIA 2J3EA 3UATA 1Y3AA 3IQXA 5IF9A 4TYPA 4DT1A 4JLBA 4JLAA 1IHUA 4PPNA 2ZS8A 4YDSA 2UZ3A 4C3ZA 3ZVLA 2ZJ2A 2WJYA 1JQLB 3TH5A 2WAYA 1P9NA 4HAYA 4CT4B 3RS3A 4H9GA 5FPKA 4OKSA 1XMSA 3F5FA 3X1XA 5FI0B 1Z6XA 1GWNA 1NRJB 3EC1A 1MO5A 3VX4A 3ZLJA 3L8ZA 3OAAA 1K8RA 5DYIA 2QTHA 2FSHA 2WV9A 5KNCA 1RRFA 4A0GA 4OHWA 4O3MA 2RGGA 4GP6A 4D4MA 1J7KA 1P7CA 1QVRA 3G5UA 1R8SA 1Z6YA 2MSEB 2XJ4A 3AB3A 2BKEA 4MRSA 3BIFA 2WIBA 1QHIA 1UKVY 3FMFA 3TLXA 2I4IA 5LPNA 3FKQA 1JR3D 1S3SA 1LTQA 1OF1A 3NH9A 3FGNA 5LD2B 2XB4A 2QPAA 4PR0A 5KU1A 3CPHA 4LPKA 4LHWA 3LX8A 3NDPA 2BJVA 4NBSA 3TQCA 1YE8A 2ODBA 4CW7A 4YMWA 4K46A 3A8TA 3X2SA 3SJCA 1E94E 3TR0A 4M9SA 4MYHA 5B30A 3MWYW 4XTCS 5GJWC 1FUUA 1PVOA 2WMOB 1N6KA 3ZIAA 2QGNA 2X2EA 2WWIA 1J8MF 2OBNA 3VMFA 3KQHA 1NF3A 4QBHA 1GG2A 2AN9A 3W8RA 1YR7A 5JJKA 1LW7A 3I32A 4ACBA 4EQ6B 2NO9A 3WYAA 4D0NA 3GJ4A 2AD5A 2P6RA 5EXPA 2GDJA 4K8OA 3C5CA 2D2EA 1IJFA 4ACAA 1R2QA 3CLVA 1Z3IX 4OBEA 1S9DA 3RWMB 2HT1A 4U02A 1LF0A 1VHTA 2VP6A 5L3RA 1SXJB 2BJWA 4Z8YA 3MAAC 1JXMA 5L3QA 3AEZA 2ANBA 2D7DA 1OFUX 1OT3A 4B48A 3U7EB 3IPXA 2ZR7A 4N0EA 4JBYA 2IW3A 4AURA 3B5JA 1Z08A 4WIAA 1KI9A 3P4YA 3KB2A 1RIFA 2CL0X 2E1RA 2WM9B 2BM1A 5K8UA 3QEOA 1T3HA 2GETA 5DHFA 3SFVA 5JHGB 5CLQA 2GZDA 2J0UA 4OI2A 5JEEA 3DKVA 1E79A 5JHHB 1LFDB 1XMIA 4HYYA 4PC6A 2DHRA 3HU3A 4JVLA 4BZXA 2XZLA 2EU8A 4KAXA 4DEYA 2QTVB 1LV7A 4YC7A 1CKEA 3THYA 1JXOA 4TYWA 4WAUA 2ZITA 1Q3TA 5FL7D 2ZI3A 4TT3D 5G53C 4MRNA 5E7MA 4P4TA 4CVNA 2ORIA 4K81B 5EQTA 1G3MA 2WHXA 1C9KA 1F2TB 3CZQA 3GJ8A 4XTRA 5AJYA 5ELXA 1FQJA 4IDHA 4HSEA 2OE2A 2C8VA 4IVQA 1IXZA 1G18A 1JBKA 2HJVA 4DLZA 4DDVA 2ZJBA 2WTUA 1WDTA 2QORA 3LVQE 4Q9KA 1SXJD 1CJMA 4QOSA 3A1UA 3QY0A 2AFHE 1W1WA 3DVLA 3TVDA 3JZAA 2YC4C 2VH5R 1KSFX 3L0IB 1Q1BA 2VL7A 2RB4A 4KBGA 2KBEA 3SYLA 1N6RA 2PT7A 5FBWB 3T1TA 2GK7A 3AUXA 2XOKA 4B43A 4EFLA 2DB3A 1ZM4A 2CNWD 2GXQA 3B1VA 2JGNA 3HR7A 4TLBA 4TTPA 5HCNA 1OJLA 2L0XA 2W6ID 3VTKA 2OCYC 3SYNA 2WOOA 3X1DA 4M1TA 3LWNA 4JT4A 1E1QA 3WP1B 2GNOA 2IA5A 2G6BA 2ZRLA 4CEIA 5KNBA 1R0XA 4B35A 5DI9A 1OHHA 1Q20A 2CL6X 4BPBA 2GCOB 1E2NA 4OL0A 5FOWA 4JLNA 3V4FA 5EP4A 2EYUA 2Y8EA 2OXRA 5LD2C 2YWEA 2IXFA 3K9LA 4PHTA 1XXHA 2CHQA 1DAMA 1NP6A 1GNRA 4L4UA 4TTRA 4WVFA 5EP3A 1WMSA 5DIFA 4CEJA 3QENA 3GPLA 1XCGB 2PBRA 1OKKD 1ZM9A 2D2FA 4L16A 4BFXA 4D2IA 4UXIA 5E7JA 2WWYA 1XD8A 4B34A 3QKRB 4QGFA 4DCVA 4A0FA 5EE1A 5EE5B 2W6JD 1AZTA 4A8JC 2VP4A 1ZYUA 1CIPA 3B85A 4FMDF 4FCTA 4O2RA 1PLKA 3K9HA 2O8FA 4IKEA 3QF7A 1XTJA 4P33A 2BCJQ 2MMCA 4NU0A 1U0JA 1JI0A 1GP2A 2FEOA 1G17A 5CIQA 2W2VA 5AUPB 3UKDA 1U2RA 2CE7A 4BEBA 3AVWA 1R8QA 4TQAA 5BN3A 3AF1A 4P31A 1X1SA 1E2GA 1CTQA 3THWB 1CR0A 4R2IA 4TYQA 2PCLA 1AS3A 3BORA 3VR3A 2VP2A 2FFBA 3QXHA 4RD6A 2RGDA 4R2HA 3KQUA 3TUJC 2EFCB 4JIMA 4BRWA 5L8VA 3RC8A 1XP8A 1YVDA 1XEXB 2QUZA 2DY1A 3PXGA 1NN3A 5HCIA 1EFRA 2GILA 3KDSE 1X3SA 4I1SA 4R9UC 2QSYA 2FV8A 2GEDA 2PZEA 4OQNA 1F5NA 1Q1EA 1E2QA 2BEKA 3TW4A 1N3BA 2IYZA 2P0EA 3I8XA 1N6IA 1XCPA 3EC2A 2ZREA 2XTZA 4ZKDA 3R7WA 1R10A 1AS2A 3CX6A 2JLVA 1XJCA 1EK0A 3EWAA 3BGWA 1E3MA 3G0HA 2YOGA 3GLFE 3C8UA 4DSOA 3H1TA 1EESA 1CULC 2RGBA 4LJYA 4M1WA 3PV0A 4EFMA 4HB4A 1AIPA 3RSOA 1CBUA 4J0QA 421PA 4GOJA 1RJ9A 2AHOA 2H16A 3IO5A 2Q3MA 4LDJA 4ESHA 2XX3A 2C9CA 3D31A 1UDXA 1XCMA 2V4ZA 1H8ED 3BC1A 4A0RA 1JB1A 3SS8A 3ZVMA 1UBCA 5HE8A 1Q44A 1G19A 1NJGA 5IT5A 2JJ8A 4DB4A 2JJ1A 4AIIA 1AKEA 4Z1MA 4B33A 2J7PA 5AR1A 3H0KA 2QMHA 2HT6A 4DC9A 2Z43A 3K8YA 1ZIOA 2BBOA 4LHZA 5EE9A 4B47A 1ESNA 4IFBA 3QIAA 4EAQA 3U3JA 4BFZA 1B0UA 1UM8A 3U3OA 4KLNA 3GEEA 2R6GA 1IXSB 2RGXA 1PJRA 5FPTA 3CW2A 5FTJA 3KJHA 1Q1QA 3NBXX 3NHBA 3UMRA 3ZH9B 1N5KA 3KJIA 4FIDA 4ASUD 2NZ8A 3U61B 2EW1A 4PAMA 4LWZA 4QG7A 2WBLC 2OCBA 3PFIA 3UPUA 1W4CA 2O8CA 4XVRA 1NG9A 1XD2B 2H92A 5J5CA 2A30A 2FNAA 2GZHA 1RW4A 3IO3A 3QNUA 3T5GA 2R62A 5JI3E 4WXPA 1U0HC 3T12A 3CIOA 1FUKA 3LD9A 3RRZA 1OIXA 1YR9A 1G7TA 1DG1G 3CPEA 3K53A 4GT1A 4KFSA 1G7SA 1RRCA 3RYTC 3S1AA 2W83A 4FWTA 2UKDA 3BJIC 2A5DA 2RGCA 1XNJA 4NYIR 1P2VA 3EPJA 2ZRIA 4ZI2A 2WWFA 3TQFA 1VHLA 3OEHD 2H8KA 2NO0A 2V1XA 3VKHA 3TJZA 1MH1A 4EPWA 2JA1A 1FL9A 2ZRDA 2A5YB 4YDHB 4CF7A 4NP6A 2OCPA 1ZC4A 1HYQA 4Q9LA 3ZS8A 4EJSC 4QL3A 1TX4B 1G291 3WNBA 3WHKA 5CB6A 1AS0A 3ZVNA 3ADDA 1C1YA 1KI3A 1G8PA 1KI7A 1J99A 3QUSA 4FMBB 3SDZA 2ATVA 2XXAA 1G9XA 1TQDA 5M04A 4OHXA 3GLIE 3SE0A 3BB4A 1KDRA 1NMXA 4NCHA 4ABYA 4FMDB 1KJYA 5HZHA 3Q85A 3BK7A 1BIFA 3EZ7A 5EZ5A 5L3SB 1JJ7A 3B1ZA 4QBIA 4RFSB 2JLSA 5J4VA 4Q9IA 1HE8B 4LHYA 4KU4A 3W5JA 1NJFA 4DRZA 1EFCA 4JLMA 3NHAA 3A4NA 2WWXA 3IIMA 4DCNA 3GJ7A 4MYCA 1TQ4A 1VCIA 1G3IA 2RHMA 3MGCA 4IOLA 2BBWA 3L0OA 5FR1A 5JWHA 1E2IA 2J1LA 2KJQA 4IDPA 1W4RA 3KQNA 1T5IA 4PHGA 2WICA 1KO7A 1KGDA 3NEYA 2OM2A 1GUAA 2BMFA 2CCKA 2ZE8A 3EAQA 3F8TA 4TZ6A 4URXR 2IK8A 4A92A 1VMAA 3CR8A 1JAIA 1RKBA 3WY9A 2C5LA 1NSFA 4ITRC 1TTTA 3C7KA 3QE0A 4HEJA 4NHOA 1HY3A 3AKYA 2JDID 3PVSA 1ESMA 2OILA 3OF5A 4ZIRB 2EWVA 5J40A 2ZI5A 3T1OA 2NO6A 3FYHA 5GADl 1QHXA 3CRVA 2JIZD 1WRBA 2FE4A 2QGZA 1CR2A 1U9IA 5E3HA 4DUGA 1PUIA 2ZS9A 3B1XA 3N2IA 2C99A 4M22A 4IVRA 1NN1A 1E4VA 2VP0A 1MABA 2F9MA 2V6IA 1WXQA 1IBRA 3BOSA 1M7BA 1Z2CA 2FZ4A 4CT5A 3SQXA 1E1RA 3QPWA 1NNEA 3CKLA 1YR8A 2BHRA 4A0HA 3I61A 2ZYVX 4JSYA 4ZCIA 1SGWA 2DYKA 4TLEA 4C4PA 1GZSA 4YXWD 1R4AA 4TSFA 1GDDA 2ZU6A 3AF0A 4QC2A 2MMGA 3E70C 4URVR 4OHVA 5FUYA 1UBGA 3K9GA 1SVOA 2DFNA 3HU2A 4BFYA 1JNYA 3K0FA 4I1VA 4NE2A 3FKSA 3SR0A 2O8BA 2HF8A 3AM1A 4Y0VA 2EYQA 1S9HA 2DWQA 1W2GA 2ZEJA 3VR4A 8OHMA 2G77B 4HUQA 1DG3A 1KI8A 3SQWA 4QKQA 2BCGY 1Q12A 1WQ1R 1GAJA 3B9PA 2FFAA 1D6JA 4HZUA 4V0OA 4DWJA 4KYUA 4LC0A 4LJ5A 5AWFC 1AGPA 3V00A 4A2PA 1NG1A 3EW9A 3NBYC 2QRNA 1Q1ZA 3U3MA 2XZOA 2R44A 1YZGA 1NLYA 4M4SA 3SBEA 2GWHA 1XJ0A 1EGAA 1MRNA 1UDWA 2HEIA 5EXXA 3IPYA 5TMPA 5H8WA 5HKKD 2HYIC 5F9FA 1L7VC 1SULA 4G5SA 4Q9HA 4D4JA 2AXPA 3BAFA 3RRMA 2YJTD 2ZJ5A 5SZJA 1EWRA 5C4GB 521PA 4NYMQ 1KYIA 2AL7A 3W5IA 1TL7C 3K0AB 5E95A 1DOAA 1P9RA 4G5GA 2DCUA 3I62A 2XZPA 3LY5A 5K8IA 5FPYA 3EPHA 2CHGA 4AWXA 2ZAOA 3D6TB 1RZ3A 2R6AA 3JVUA 3GJXC 4PHHA 2C03A 4W5WA 4Q03A 3REGA 1Z63A 3QPVA 1R5NA 1U99A 1NIPA 2VQSA 2QPOA 3VHLB 1L8QA 1G6HA 2ONJA 1ZC3A 4Q4HA 3U6KA 1S96A 1WCV1 3QEJA 5B2ZA 1ZAKA 4E03A 3KJEA 2QSZA 1VYTA 1G4AE 4MKHA 2DBYA 1ZD9A 5FUXA 4BZPA 2ZJAA 1D9ZA 2IL1A 1TQ2A 1E2MA 2A2ZA 2N1BA 3W90A 3LA6A 3X1ZA 1DAGA 3JZMA 3LQRA 5D3MB 4AK9A 3E5HA 5FBRB 4IXNA 2ANCA 3AVTA 4RZXA 1US8A 1R5OA 2W58A 1W4BA 1HQYE 1R0WA 2F7SA 3NXSA 1VIYA 4RD2A 4Q1AA 4MH0R 3CX7A 1BYIA 3CM0A 2WJVA 1GL9B 5BW8A 3TUZC 4CYMA 1VPLA 2GHIA 3FWYA 621PA 3KB1A 3LW8A 4D4KA 3OIUA 2IYLD 5KDLA 2YOHA 2REOA 1TF2A 1W5SA 4DLYA 2GF0A 3PR1A 3KKQA 3CB4A 4JS0A 4TMTA 2BKUA 4PC1A 1Y63A 4D6PA 1XD9A 1T3LA 1I2DA 2CJWB 2IHYA 3EIHA 3VHXA 1JPNA 4AKIA 1W5TA 1Q22A 3LLUA 4DT1B 1XXHE 1OPXA 3M6AA 2IS2A 1H8HA 1II8A 5BYJA 3A37A 3MWJA 2OSBA 2R6DA 4PSKA 1FMJA 2GAAA 2O0HA 1JPJA 1NN5A 2AR7A 2FFQA 1P2UA 3MJRA 2QG6A 1E2DA 1XFAA 1QHSA 5L3VA 1YZNA 3RS2A 1KIMA 2ZU0C 5GVRA 1TMKA 2RGNA 4KFRA 4JL5A 1LY1A 1OYWA 3NBZC 2JASA 3K0CC 2ZSFA 4C30A 4MDEA 2VEDA 3B1WA 2PLFA 3T61A 1KY3A 3GLIA 4P4UA 1SHZA 1N6NA 4JLVA 1SVWA 3MWLA 2WIAA 4IEIA 5IDVA 3PEWA 4PC3A 3THXA 3PEUA 3CRQA 5BN4A 3AUYA 3A36A 4A1FA 2PEZA 1XU4A 1YR6A 3KXLA 2GEVA 1YJ5A 3CRMA 3TE6A 1E0JA 1NLFA 2NGRA 1UADA 1KI2A 2OCAA 3HPRA 1KK1A 2JEOA 1XBTA 4BEJA 2ZQ5A 5JCZA 2A78A 4UJ3A 2NO7A 1P3JA 1G5PA 1P5ZB 1SKYE 1QHYA 1R0ZA 1FX0A 4BFTA 4C7OA 3TAHA 1M6NA 2FOLA 4FD2A 2FSFA 4TLCA 4UQOA 4AKEA 1JAHA 2FSGA 3GJ0A 2O8DB 4RD0A 5TXGA 4F4JA 2WJJA 4JKYA 1S1MA 4Y0AA 1UBEA 2A7QA 1OXTA 2GVZC 3MG9A 3OAAD 2J9RA 1ZUIA 2PX3A 4PO8A 4YMUA 5J4LA 4LJ6A 4NYJR 5G3YA 1D5CA 1U94A 4TMZA 4E09A 2IEZA 5L3QB 5JMTA 4AC9A 4L9SA 4P32A 5JZVA 2C04A 4HZIA 3RS7A 4EPXA 3AVOA 2BBTA 3GLGA 2NPIA 2VRWA 2F1RA 3I5YA 4V0KA 4GZMA 1J70A 4XSHA 3QOFA 3PUZA 4PAOA 4MGKR 4QHSA 4Z54A 2O0JA 2J0UB 4WZBE 2QAJA 5CK4A 4D82A 3IQWA 1TEXA 4DSNA 3R8CA 3PJRA 1VDZA 3ZVRA 2ZETA 4GMDA 1MRSA 2W0SA 1E0AA 5EUQB 1G16A 4TN1A 2R6CA 2DWOA 3THYB 1HEIA 3I8SA 1W36C 3ZIAD 4C2TA 4NMMA 3GP8A 2KB0A 3PCRB 4LY6A 4MRPA 4KODA 4KFTA 4MRRA 3ZYCA 4FXPA 4RKEA 1KTVA 3WRYC 4AG5A 2DFLA 1ZMXA 1E0KA 5JRZA 1XEFA 2WKPA 3SI7A 3ZQJA 2JLRA 4TL7A 3QBTA 1GRRA 5GJBA 1NVVQ 1N6LA 3LNCA 4QRHA 1OXSC 2IBMA 3BRWD 4IOKA 3OE7A 1SZPA 3TR5A 3HPQA 2QU8A 2GJ8A 1Q57A 3M0EA 2RGEA 2BDTA 3RRYA 4WZAE 2HDNB 4O25A 1ZM2A 3UG6A 2B21A 2QNRA 4GNKA 2GXAA 2FF7A 3TSZA 1G8GA 3E2IA 3RRNA 2HCBA 5JI2E 2BM0A 2FEMA 2OLKA 2VSOA 1Q0UA 4E22A 5CIWA 1P2TA 3REFA 3RC3A 2IHBA 1E79D 2J45A 4JVMA 1Z0IA 3ETLA 1AK2A 5KHOC 1Z0FA 3SFZA 4DZZA 3R20A 2PLRA 2IYQA 1GIAA 3T06B 3UWOA 1ELOA 4MKIA 5DYGA 4WZ6A 1Q3HA 2WJIA 2QE7A 1KNXA 3LW7A 2YWGA 3BWDD 1NMZA 4FCWA 5FTNA 2R65A 4MDFA 1JR6A 2IEYA 4C0HA 3O8CA 1GTVA 2F3TA 4URWR 4HDCA 3CH5A 4F93B 2OBMA 4Q4AB 1XXHB 2B8TA 5TVKA 2XNSA 1IY0A 4FW9A 3K70D 1T8UA 3WNDA 2P6UA 1WE2A 4CEJB 1MKYA 1NN0A 1T6NA 1YZQA 1N0VC 4JVNA 1IQPA 3MFYA 1K6MA 5F3WB 4F38A 3VKGA 5FPHA 2GJKA 5EZ6B 4OYHA 4QHTA 2XJ9A 1ZUNB 2F55A 3VR1A 2WVJA 4X8MA 4PHFA 1K5GA 3A1SA 4M9XA 4A8JA 4DCSA 2O8FB 1F48A 4GOXA 1IM2A 2ZJ8A 2C2HA 2XOKD 3AVUA 2J41A 2KSQA 3UMFA 2RGAA 3VFDA 1EX7A 2PL3A 1COWA 2Z4SA 1W2HA 4BASA 3LO5A 3SN6A 3C4JA 4RVCA 4GSYA 1E1QD 5FL3A 4G1UC 5KNDA 2GCNA 4Q21A 4PX9A 3QPUA 1ZD1A 5FBLB 1OHHD 4B3XA 3AKDA 2CLSA 2ZJYA 4ZDJA 1GFIA 2ZR0A 3BS4A 4PAQA 2ZE5A 4WW0A 1R0YA 1AZSC 3UWKA 3ZD7A 2EFEB 2ZRHA 4IXMA 4A9AA 3R7WB 5KO2A 2V3CC 2QP4A 2OAQ1 2AXNA 5FOXA 1RYHA 1E99A 1Q21A 4XD7A 2P5TB 3U3RA 1HV8A 3E1SA 1G7RA 1P6XA 2BV3A 3MWKA 3QI2A 1ZJ6A 4KHZA 3G82C 2RMKA 4MA4A 2ZXUA 3NEJA 1YQTA 3NG1A 3OHMA 1P75A 4JZKA 2OHFA 2PZFA 4LOAA 1EFHA 5CLLA 2H57A 3LRPA 4LBZA 1G4UR 1KO5A 4GBMA 1GRQA 4WBSA 2V7QA 1J90A 1KHTA 1KDPA 3EIQA 3EXAA 4JVSB 4FCVA 3EZ9A 1IOZA 1RJ9B 1NBMA 2XGJA 1F3OA 1E2LA 2IYWA 2REBA 1XX6A 4NYIQ 1KMHA 3D8BA 4IVPA 1SXJC 1BO6A 5CYOA 1KAOA 3CZPA 2P5SA 3A1WA 3L82B 4TMVA 3CX8A 2CHVA 2WJHA 3KKOA 1GITA 4R98A 1ZIPA 1FPMA 2OLJA 2P67A 4V0NA 2CDNA 3LXXA 3SC3A 1AN0A 2ZE7A 1EWQA 1W4AA 3WP0A 5JJIA 1OFTA 1PZNA 3VU9B 1EFRD 1FW6A 3QVVA 2QMEA 4LK2A 4B32A 3CNLA 5AJVB 2CVHA 3ZJYA 4B3CA 2JLUA 3PUWA 4DBLC 1ZNXA 2ZYWX 5FBQB 4NCJA 4Q01A 2V1UA 5IK2A 4B3DA 5KYKA 3HWSA 3N2EA 2G3YA 4RY2A 2VHJA 1CXZA 2O8CB 3KKNA 4YMTA 4A6PA 4NKRA 1KZ7B 4FN5A 5FR2A 1XPOA 3A1TA 4Q9JA 1IJEA 4G3XA 3AVVA 1JQJC 4MYTA 4TMXA 2IXEA 3VX3A 5A4JA 5BWMA 1KO4A 3GJ6A 3OESA 1XRJA 1MO3A 2O0KA 1DS6A 1IAQA 3BH0A 1U90A 3S1AB 4Q1FA 2JLZA 2Q9AA 5SZIA 3LDAA 2IXGA 1OB5A 2CLCX 1VYVA 4AYTA 1ZD8A 3CF0A 4G01B 4S2EA 3TKLA 3B6EA 2XEXA 4B3GA 1E9SA 5JS7A 5DN6A 2JJ1D 1QZXA 2IWHA 1WP9A 4Z1MD 4D26A 2LCFA 4G5QA 2J7PD 5FOVA 3A1VA 4HLDA 4UNNA 4JJKA 1E9CA 2WSSA 1YU9A 2A9KA 5FTLA 4CEHA 4GI7A 5JBQA 1E0SA 3WYFA 2E9SA 1RE0A 2FX3A 1G3UA 1TUEA 4FWIB 4BUJA 4JLKA 2BMEA 4N0DA 2ZRBA 1L2TA 3UG7A 4PQRA 4G5RA 2Q21A 1AGRA 4UNSA 1ZINA 5AUOB 1FMLA 2AWNA 4EJSA 5B57C 3IKJA 1D2NA 4CZ2A 3I3SR 2SHKA 3BE4A 2XXAB 4WOPA 3L2OB 5BQ5A 1CEEA 3ECCA 3TW8B 4AYXA 5BYKA 2DFTA 2FPKA 3C15C 2GJAA 4N1AA 2HLDA 3W6NA 4JKIA 2AWOA 4Q4JA 4LYJA 4B76A 1CJUC 1Z5ZA 4JMPA 2FH5B 3OFNA 4FI3C 5DE3A 2I3BA 4B75A 1OLOA 1W48A 1KO1A 1KOFA 4Q1BA 4URUR 2X19A 2QPTA 5JWRA 4GP7A 5TB5A 3PG5A 3NTUA 2IT1A 1OFHA 2Z6VA 4II7A 5KSZA 1NIJA 5FI1B 3HDTA 3TVTA 4AY2A 1KDOA 1HTWA 5D3QA 2CCJA 1N6OA 3VAAA 4B73A 1QF9A 4I4LA 3R8FA 1NY6A 3GQBA 2JATA 3DMDA 4KCGA 2JJ2A 4BLPA 2B6HA 3AVYA 5TDHA 2A5FA 2PEYA 4HLQB 1MOZA 5DISB 2EWWA 2QT1A 4JL6A 3QQ5A 1VG0B 4M9QA 4EKDA 2QEQA 4B3BA 1S8FA 2UVQA 1OXVA 4Q7KA 3I4LA 1A5TA 2J0SA 4Q48A 1KI1A 3CNNA 4QGAA 1TAGA 1S1CA 2HXYA 3AF2A 2ZANA 4GFDA 3IHLA 1KK0A 2JLWA 2ZTSA 5J4KA 2GESA 4LJAA 1OH7A 4DLXA 2HV8A 4GPTA 4U5XA 4PANA 1MABB 4HI0E 4C0AC 2QROA 2QI9C 3B8HA 4KFUA 4XOIA 1VECA 2AD1A 4ARZB 2Z5FA 3HP1A 1ZCAA 4W5JA 3U7HB 1F2UB 3I73A 2FU5C 2YWFA 1AKYA 1HT1E 2E87A 3BBPA 1XPUA 1N0UA 2OESA 4Q19A 2XTMA 1QHHA 1XTIA 1KI6A 3BFXA 2QBYA 1DAHA 2Q0HA 3W3ZB 2Q6TA 1GILA 2REXB 3K09C 1SQ5A 3AV0B 1T3SA 3SU8A 3CF6R 3PUXA 3K0FB 3TAUA 3VQTA 4Q7LA 2QN6A 2ORWA 2O8BB 2D7CA 2YZ2A 3FFBA 4OHZA 4HUQB 5FH9A 4UNPA 3EIEA 1XWIA 4NL4H 2AX4A 2IWRA 2VIIA 1YZTA 1Z0KA 2EFDB 2GKSA 2Q3HA 3C5HA 3MRSA 3RABA 4A4DA 4HZUB 5KDDA 1NVUQ 1GNPA 3BD9A 4HDQB 1Z6GA 1KI4A 3LX5A 1NSTA 3UK6A 3FTQA 2QAGA 3VNVA 3EASA 4V0LA 3AF3A 3WXMA 4RCZA 3AKEA 2JLXA 1T5LA 1R6BX 1GKYA 4EPTA 2RH5A 1E69A 4M2LA 4BLQA 3OZXA 1P4SA 4DUGD 3GLGE 4KI0A 1Z2AA 4URYR 1GL7A 4NCKA 4ZPXA 1AQUA 4B71A 1QVAA 4HAXA 3GLFB 2ZSDA 4E5UA 1SVIA 3NKVA 1E1RD 5HTKA 4OI1A 1NI3A 1GRNA 1OXUA 2VF8A 2YVUA 3GFOA 4PZYA 1ZRHA 1ZVQA 4QHYA 3X1WA 1ONBA 3B2EA 2ZSAA 2ASEA 1KZGB 4NONA 4TSFD 2N46A 1Z6AA 3LBNA 5JSZA 1SVSA 5CYPA 2FPMA 5CK5A 5DNYB 4Z8XA 1W49A 1G41A 2KE5A 1N25A 2JAQA 3C16C 4UXJA 3T15A 3DPUA 3MD0A 3FKSD 4Q4HB 5JS8A 1XF9A 2HXSA 2MSDB 4V0MA 4NH0A 3QKSB 2CLDX 2N42A 5H68A 5EXTA 4HLUC 5C2JB 2ZRAA 1DAKA 1VG8A 1T0JB 1SVMA 1W0JA 5KSPA 3RLFA 1ZNZA 4PO9A 4DLVA 1QDEA 4DLTA 2FZLA 4C0QC 2FDCA 1SKQA 3KTAA 2NZJA 1US8B 4URZR 5JCPA 2ZM5A 4OI4A 3PEYA 4QJ4A 1GOTA 2VLIA 1FNMA 2GCPA 4F92B 2X1VA 2GK6A 4TWZA 5J4YA 3H86A 2R2AA 4DIDA 2QZ4A 4L5BA 4PO1A 721PA 4MYUA 5JECA 1UEJA 2H17A 4NDZA 3QF4B 1LNZA 2C9OA 3D3QA 2YC2C 2BBSA 5B58C 4YLGA 1XZQA 2PX0A 4F4IA 2NO1A 1DARA 5K8LA 2VSXA 2F43A 3Q3JB 1WA5A 1E9AA 1U9IC 4HUTA 5FBVB 4KYIB 2IYTA 4DCUA 2VSFA 1EG7A 2G83A 1VTKA 3NWJA 3LXRA 2H5EA 5FTKA 5C18A 4C0JA 4Q4LA 2O8EA 4NCNA 5KDOA 4F91B 2XAUA 4PQFA 4B44A 3PITA 3FMPB 3QXXA 5KPDA 2DR3A 3TSWA 1M7HA 2PJRA 1BS1A 2FN4A 1II8B 1BMFA 3RWOA 3KL4A 1JEEA 5FTMA 2C98A 2R6FA 4JT2A 2P6NA 3VR5A 3Q7QA 4KLZA 3RS4A 4JL8A 2XNDA 3RNLA 4PPGA 1YZUA 2RHDA 1HE1C 4M1YA 4MQBA 2GXUA 4V02A 3AP2A 3NIBA 4EPYA 2WKRA 1EFUA 4OJQA 4LPSA 5HR5A 1CR1A 5TY0A 1Z06A 3RHFA 3IUYA 2ZRJA 3U44A 1M2OB 4BFWA 1NKTA 1G21E 2X77A 4AKHA 1E2KA 2OG2A 1KK2A 1QG2A 2GVDC 1KNQA 1FNNA 1UKZA 2FSIA 3I72A 1A4RA 3OEEA 5IRCD 3GLIB 2G9NA 2PCJA 3AH8A 2IYVA 4JYCA 5E4FA 3KX2A 3K0CA 2ODNA 4LBVA 4Q5IA 3NVAA 2ZPTX 4HAVA 3THXB 3Q5EA 4B2LA 1IY1A 4CIDA 5AUNB 1N6PA 4RZ3A 3AP1A 3NC1C 1DADA 2CE2X 3ZDQA 3OIYA 4NZYA 1N0WA 4DLWA 1G64A 3TBKA 1DE0A 4UXHA 3WBJA 4FINA 4ZV4A 4LRWA 1UF9A 5CM8B 1SHKA 1JJVA 4TZ0A 3ICEA 1W0KA 3QXCA 4KO8A 4O2LA 3M4YA 1CRPA 1FX0B 1H8HD 1Z6TA 4LGMA 4C7OB 2BC9A 3AVXA 2XB2A 1BOFA 4GOKA 1KDTA 4H1UA 3UANA 4B74A 1E2FA 4PFSA 3K0AA 2ATXA 5DLQC 3ZS9A 3SJAA 3ZZUA 4BFSA 3N70A 4D0GA 4M1OA 1TU4A 2OT3B 5FOSA 4QM7A 1LS1A 4I1OA 2ZS7A 2X2FA 1PLJA 3KUCA 3FDIA 1FOEB 3NBFA 5BN5A 1QHGA 1NBME 3HYTA 3CNOA 3MLEA 3P26A 1ZP6A 1NMYA 4M1SA 5BXQC 5GVSA 3RDPA 4TYNA 3RAPR 3U4QA 5A0FA 4C0SA 3MJHA 4HB2A 4ZO4A 4Q47A 1E9EA 1TADA 2ZAMA 5DI3A 6Q21A 2FWRA 4M8NE 2XSZA 2OBLA 2CMKA 3T35A 5IHPA 2V55B 2WPDA 1R7RA 3V9PA 1KSHA 1QBKC 1UAAA 1P62B 4LBYA 2EFHB 2J7KA 4DSTA 4UNRA 4M9ZA 4BWYA 1TNDA 4HAUA 2QTFA 3I1FA 3ND9A 5GJCA 1E4YA 1FP6A 2D06A 2EQBA 2CL7X 1YZKA 2Q3FA 1S4QA 1IN8A 2CK3A 4KSBA 1RYFA 2V9PA 1U8ZA 4NYMR 2BOVA 3SHFA 1ETUA 3KKMA 4TQUS 1YRAA 2VHTA 5EP1A 4B6EA 1W44A 3GLHA 2HF9A 4MKGA 4IDOA 5G40A 1KKMA 1VCMA 2WZQA 2GBLC 2F9LA 2YOFA 4HB0A 5AJXA 2RKOA 1XTQA 4XVQA 4CGZA 3HR8A 2CJWA 1OFIA 3AP3A 1KJZA 2OO7A 3ND8A 2QQEA 4LZZA 1UKYA 3EX7C 2NTYC 3JVVA 2D74A 3MUFA 1V5WA 3MCAA 3OIWA 5KUTA 4RSGA 3ZZ0A 2AKAB 1E9FA 1A82A 4OI0A 3F0TA 1M34E 1GKIA 4Q7MB 4IFEA 4JLPA 3R9XA 1LVGA 2GA8A 2RGNC 3KJGA 3AF4A 3L8YA 2P65A 3P1JA 1TF5A 4W5HA 1KK3A 2RAPA 5JLJA 1ZW6A 4ESVA 4LBWA 4QJ5A 3GJ3A 4L15A 5E7IA 5JEDA 2IC5A 2ZRGA 2VA8A 3GMTA 3KKPA 4D80A 4JYBA 1IN4A 2WWWA 2IYSA 3W3AA 1XZPA 4BGDA 1S3GA 1G5TA 2O5VA 3IIJA 4N3NA 1I4TD 1G3QA 1ZBDA 2VBCA 1JR3A 2F1HA 821PA 4HATA 4UJ5A 3K70B 2JCSA 4QGGA 3H2YA 3LBHA 4ZDKA 2GJ9A 4OQMA 1VIAA 2YKGA 1M7GA 4P4SA 1MT0A 1Z0AA 4UKDA 4LSGA 3OE7D 4NCIA 2QP9X 1AA9A 2IS4A 3LV8A 1JECA 4P3YA 2WMNB 4OK6A 2BMJA 2BVNA 1GKUB 3ICQB 2I1QA 3VNUA 3V4RA 2JLQA 2VPPA 4PQYA 1Z29A 4A8JB 2OFWA 3KUDA 3RS5A 3ADCA 2BWJA 2A3RA 3B82A 1N2CE 1CS4C 4A2QA 2G1JA 2QT0A 3QBVA 4TYYA 3ADBA 2O8DA 1CRQA 2ZE6A 1XTSA 5H1YA 4Q1CA 3NH6A 4LYFA 5DSZA 3SYKA 3IEVA 2NMVA 1XTRA 1QRAA 4JJZA 3BH6A 4IOJA 4CEIB 5LDDC 3IHWA 5H70A 4C0KA 1B23P 2FFHA 5KSOA 2QE7D 2XITA 4CRWB 4HB3A 3KFXA 1MO4A 1CJVC 2WJGA 1GSIA 3EPKA 4OQLA 3WMGA 4ZKEA 5G41A 5DO9A 1DAFA 3SZRA 1FTSA 4RJLA 4GDFA 2F1JA 2IS6A 5C46F 2LKDA 4TL6A 3Q9LA 3UXMA 4GRAA 4DVGA 5SZKB 3TMKA 1OW3B 4LJ7A 2P3SA 4Q7JB 4OHYA 4X8HA 4E07A 3TGPA 2IUSA 4D81A 3B1YA 4LHVA 4AD8A 3UMSA 5HPYB 4A82A 1OB2A 4M1KA 2ZJOA 2VP5A 3QSYA 2B8WA 1HA3A 1O3YA 2YHSA 3I5XA 5FL7A 3WNCA 1D2EA 5FUWA 3U7GA 2J87A 3BB3A 4TT3A 4OJKA 3EA5A 3GFPA 1OH5A 1E9BA 1G8FA 1O87A 4LI0A 4M0LA 3ZGXA 1CP2A 1L4YA 5C1BA 4Q02A 1COWD 3U2QA 4EQ6A 1C4OA 2Q9CA 3DDCA 1T0HB 1KMHB 3LFUA 4X8OA 4H1VA 4YQFA 2ZSBA 1G5RA 2VHQA 1RPZA 1T9HA 3DL0A 2ERXA 3THOA 1WB9A 3O8DA 2ZUCA 2PMDA 3L0PA 4Q1DA 1SXJA 3Q5DA 4JLJA 1YRBA 4EUNA 5K8TA 4QFMA 1GVNB 4B2PA 1DPFA 1TU3A 3FB4A 1KKLA 2QM8A 2H7VA 2PZGA 1DO2A 2ZRMA 2ONKA 5J4HA 1W46A 3AQ4A 4DIEA 4D0LB 3QXJA 1TQ6A 1OYYA 1F6BA 1P72A 4GMXA 4L9WA 1N5JA 1HURA 1SKYB 1WF3A 1IY2A 2CNWA 4XD7D 4IW3B 1G8YA 3AKCA 3CUEF 4QNRA 4QBFA 2W6IA 4OK3A 2QL6A 2PMKA 4MGYR 4F7WA 3P4XA 3TUIC 1ZCBA 5C4MA 2DPXA 2WWGA 2KI5A 2J0QA 1YHNA 1A7JA 3O47A 4IEEA 4C0BA 4OK5A 2V7QD 2A5GA 4RFVA 3QVUA 5AUQA 4C2UA 3L0SA 1PUJA 3K70C 4XWOA 1NBMD 1QG4A 1GM5A 2G1KA 4B3FX 5TV2A 1AQYA 2F3RA 2Z83A 3C41J 3IGFA 1F2TA 4Q4AA 2CVFA 4XJXA 1NVVR 4LC1A 2IUUA 1H65A 1OKKA 1QHNA 4RCYA 4KBFA 4TLAA 4Q1EA 4V0ME 4EIWA 2J0VA 2W6JA 5KSYA 1OIVA 4YMVA 4DLSA 2WOJA 1R5BA 4CEHB 2NPFA 1DAEA 1UFQA 4BFUA 4BLRA 4LHXA 2ZR9A 2CXXA 3LBIA 2W00A 4X8LA 1VCNA 2ZYTX 4LJ9A 5KTYA 2QY9A 3AVQA 4KXFB 4RD1A 1IN5A 3BH7A 2IYUA 4DDUA 4LUCA 3X1YA 2C95A 3DMNA 5IK2D 2VHUA 4AKGA 5HZKA 4EJSB 4QJ3A 2ZROA 1HQCA 3NC0C 1K5DA 4LV5B 2ZI9A 2ZYUX 3LH5A 1KY2A 1MO6A 1GNQA 2I1VB 2EVWX 1LS6A 4KV9A 1NVXQ 4Q4JB 1AM4D 2FJUA 2XTNA 5GJVC 5CDFA 2GCOA 4IJMA 4JLOA 2RCNA 5DH9A 1Z8FA 4G0NA 1I4DD 4MITA 1U0LA 2IYYA 2QA5A 3IDQA 3PQCA 4NPHA 3BFVA 4US2R 3CO5A 5CJPA 1G7CA 3Q8XB 3W6PA 1LF5A 4DLUA 2FGKA 4W7SA 2QMOA 1W47A 4HAZA 4MKFA 5DN6D 3WYGA 3QKRA 1HUQA 3U7FB 1M1YE 1BH2A 3CWZA 3VR2A 1V43A 4IRUB 5FFMA 4WA7A 1KO8A 1FZQA 1IN7A 2ECKA 2WSSD 4LCBA 1XB2A 1N5IA 4BE7B 1X6VA 1EXMA 3EG5A 3W6OA 3BFKA 2IF0A 4DDWA 4DLRA 4WXRA 1DAIA 4JSTA 1E2PA 3M1IA 2DWPA 2CCGA 3IEUA 4M1MA 5B64A 1H8EA 3ONWA 3RSLA 4RZ2A 3RANA 4A15A 3THWA 4TQ9A 3EPLA 3CWQA 5KOYA 1YKSA 3T5DA 2HLDD 2ZI6A 3QKTA 1JALA 5LB4A 4LYHA 2ZI4A 3VU9A 1XEXA 4PPQA 2CBZA 2WWHA 4IDNA 3FHOA 3OFND 1ANKA 4AG6A
chains in the Genus database with same CATH superfamily
4DJ5X 1DEKA 1SVUA 1U80A 1WDMA 3O8OA 3PGVA 4QBGB 1GU7A 1D9XA 2QM7A 1G6OA 2GAFA 3JYNA 4G36A 4E1BA 2JGKA 1Z4NA 1JKFA 5LC1A 4ZJPA 2QN9A 1KFCB 2GM3A 4TWIA 1PFGA 1NY5A 3E3NA 4L8FA 5DEOA 2HA7A 5CT5A 16PKA 3TSAA 4M6WB 1FSSA 1X8LA 3DEKA 3RUHA 2ZVJA 4EZIA 2ZP1A 4M7PA 4TX1A 2ZIAA 4LJLA 3NKFA 1R15A 1PT8A 5FAXA 2YWRA 1P60A 1KOLA 3TW0A 1WZIA 2M9MA 2XMSA 4W6QA 5ANRB 1SJ9A 3HN7A 4JEIA 4IOMA 4K9SA 1F8GA 2OTCA 2HW8A 3FUVA 3NHFA 2Z4RA 2ZT8A 2JFPA 1E7YA 3R7LA 5BNTA 4KC0A 1UC4B 4RSMA 1PZMA 1D5WA 1JDSA 2GFQA 2HQBA 4ZCLA 4ER0A 5A4FS 3HDGA 1LC3A 2QAGB 1D8AA 1PWHA 2X8AA 2C2WA 3FVRA 4NOLA 4TRMA 1RI5A 4C4SA 4FDAA 2O52A 3LHDA 3KS9A 2JGDB 1IPFA 3FCOA 3KUKA 3TRFA 1OLUA 3O03A 4RGBA 1W52X 3ASVA 2OUKA 2EJBA 2SECE 3ZHQA 2J5XA 2JJQA 5CW1A 2FR8C 2XRYA 3IIIA 2DPMA 4AI6A 1XMPA 3PKJA 4LMPA 2VDVE 4JJ7A 4J76A 1ZKMA 4OUDA 4UVIA 4F6RB 1LZLA 4F3YA 1S5PA 3ORFA 4R6WA 1JT2A 2Z0MA 3WBKA 4AZ0B 4OFZA 1EAMA 2ZDHA 3A1NA 5DULA 5TPWB 2B35A 2HXGA 4P83A 3PPYA 2GERA 2ZUBA 3D3WB 4ZZ3A 1MTOA 3BXOA 5D3ZA 4XWKA 3ZWKA 5IZ4A 1CB7A 5JVDF 5JSZB 4LRSB 1I5EA 1XF1A 2IY7A 3H2IA 1VL6A 4BLSA 5KZMB 1IG3A 1BQ4A 2OXEA 3R23A 4OA8A 3ROGA 3ELUA 4G65A 3UXHA 1HDEA 2WHEA 2ZIXA 4ANFA 1R6DA 2XYGA 3STHA 4FOOA 1RRVA 1VZ3A 4RWZA 5JPIA 3RS0A 3R44A 4CG0A 1BXKA 1JQEA 4WMLA 1TYAE 2BMAA 3O3MB 3FGZA 4C5BA 4DIOA 4ZHQB 1CY4A 1N6HA 1X2BA 2Q3JA 2MOKA 4YT2A 1FC0A 2ODWA 2PY6A 4D99A 1ZGHA 1FUYB 1GA4A 2HJRA 1UIMA 4B46A 4IIJA 5F21A 4P1ZA 4KE9A 2QX8A 3H8SA 4C4XA 1FQKA 4UHDA 1WIWA 4EHAA 4A2CA 1GZ4A 2PXCA 1OD6A 3IV6A 3OZRA 1QQTA 3TBFA 2C5HA 2WR8A 4R8RA 1EFTA 3LUKA 4DMGA 2BTQA 3KTAB 1LDYA 1PV4A 1A2KC 1PIWA 4LF6B 2V4UA 4TL9A 4FFMA 5FOUA 4AZWA 5A5EA 5ICMA 3WXBA 3BMCA 1QYCA 4MCJA 5IUJC 2O8EB 3WWCA 5TARA 5IW8A 1VYUA 1E32A 1N8NA 1F2DA 2PR2A 3KAKA 3PUYA 4GXNA 4NBVA 4UE6A 5F2EA 1PQ4A 4MWEA 2UYGA 1Z07A 1SXHA 4RCVA 4CFSA 1IN6A 4MEAA 3L49A 5C1OA 1OIWA 1Y9AA 1P0PA 2I8CA 3WLMA 2QMZA 1I5OA 2JDIA 2Y6UA 1VC2A 4PZLA 4U00A 5HKBA 1BDHA 2QP3A 3FFAA 1NVWQ 1M5UA 2KBFA 4ZVOA 4GUAA 1T91A 1PYDA 2C77A 3CPJB 3WGLA 4B7ZA 4CM6A 1QGAA 3O2NA 3OT1A 1TGVA 3WS7A 3BZWA 3RAFC 1L5FA 1QG6A 3MUNA 3DWFA 2OGZA 3BFJA 3E35A 3OECA 1A9PA 3T7RA 4I1UA 2Y1OA 2D62A 1YOVA 4Z0PA 3W5HA 1EA5A 1Z0DA 2JJMA 1AKNA 3WLRA 1G9TA 1Y9ZA 1MEJA 3IH5A 1MC8A 4ARZA 2HBRA 1UKEA 3NOXA 4S0XA 3U26A 4B6OA 4DUYB 1WTCA 4EKEA 2EFYA 1F2UA 3CUYA 1JKJA 2AKYA 1KSJA 1QV6A 1XAGA 4JXXA 4JNKA 1JFTA 1VG1A 3ETHA 2HFKA 4TUYF 5TQVA 3IT0A 1OBHA 1YCHA 3LQ2A 3A4MA 1TGYA 1I2MA 3QMVA 4INJA 2PH1A 1TPZA 5IAAA 2H1LA 3EUEA 2OO5A 1I7PA 4GQBA 5A7HA 3NRCA 1X8JA 3OH8A 1RRPA 1W5EA 3DXYA 3B13B 3FPAA 1DEAA 1UBLS 2IF2A 2E37A 4M89A 2LP4Y 2P9CA 1EM8A 5DIZA 2Y0PA 3DE7X 3BZUA 4EPVA 3A0UA 5F7XA 1I3KA 1Z6PA 1M6HA 121PA 1C30A 3BK1A 4J0IA 3A58B 1T2DA 2JHCA 3K9NA 1KTIA 1RXIA 3IKLA 1GR0A 5T4BA 2PNJA 3TIFA 4B2IA 1T26A 4HDOB 1TEVA 4F06A 2PO7A 1U98A 2QRVB 4ZIRA 2AMJA 2ZUDA 1ULTA 1FSZA 3RK4A 3GFVA 4DADA 3ZCQA 4OQXA 4R1UA 1Z25A 3FHTA 1Q1GA 1PR2A 1Z33A 4O5AA 2IUTA 2OAP1 3ZZTA 1SVKA 4Y2HA 3VZPA 4C3OB 3U4MA 3TIVA 1JH8A 5EJEA 3HEBA 3NHSA 4BO7A 1XYVA 4F85A 1SD2A 1XAJA 4FYXA 3Q72A 4K88A 5EG5A 5C31A 5KCZA 4RSHA 2Q45A 1MQAA 4TLDA 3WFIA 2PYIA 4ZOLF 4C88A 3FPEA 4NV0A 4RBNA 1XDDA 1LPMA 3PA8A 2GJSA 3RC1A 4AF8A 5TIIA 3J81k 5KTRA 3SQMA 4DZTA 3ZE1B 5L9AA 1O97D 1IYZA 1HT3A 1OROA 2OORA 1CWUA 1PYGA 2IQ5A 3HU1A 3PDWA 4LX0A 1WDWB 4P0TA 5IDYA 3U4HA 1FBTA 2WA1A 1VBFA 1AKRA 3BXZA 2BTOA 4H17A 4NYJQ 3HL4A 3TRIA 3TL6A 4HEQA 2Z6QA 1QDLB 1TYBE 5LWQA 3IBGA 1EEHA 5FV7A 2BMDA 2DP4E 4OLAA 3OEED 3FCAA 3GPCA 3GZNB 3F5SA 3TEMA 2WILA 1QE5A 2WKQA 4FZ5A 5DBOA 1KRWA 4BJHB 1ZBQA 5GPBA 1SZCA 3ER9A 2A4KA 2XUPA 2XXBA 3MJDA 1U8YA 3KHUA 3W9SA 3IAXA 2B1GA 4AMUA 1DVRA 3CF4A 2TS1A 1IWPB 1T9DA 1MRZA 2YQ4A 3DKPA 2Q8NA 4XH9B 3MSXA 4Y67A 3FRIA 1KDVA 3JQGB 3ODGA 2POQX 2Q1TA 4I2NA 1A72A 2ERCA 1F38A 1E98A 1T9ZA 3MCVA 2Y77A 3D4OA 5EJFA 1EZ4A 5TGZA 4YY3B 3SNHA 1P1KA 1RRGA 2WSMA 3KK0A 4ZVSA 4F1WA 5GOZA 1CFJA 3P19A 3PWSA 2BN4A 1QMGA 2F6RA 2IDMA 4O5OA 5ICCA 4GL2A 2C96A 4UTRA 1B41A 1A9TA 1QWOA 2G5CA 3ETDA 4ZAWA 3PUVA 4P2GA 4CG1A 5K5EA 3WGGA 3EZFA 2JGEA 2PUJA 3LPAA 4ARBA 4ZI3A 1Z0JA 3KKLA 4RVDA 2M98A 5JRJA 1Z13A 5DHPA 2EFGA 3OEYA 4ZYXA 4EEKA 1ZM3A 3EXHA 3IVAA 3OURA 4MGEA 5EE3A 3SJZA 5DX8A 4K9RA 5FJIA 2ZVQX 1M2FA 4D4HA 2ZB2A 2O7VA 2ZLBA 1KU6A 2AFRA 3KE8A 4KOAA 1L5LA 4CWAA 2R7MA 4LW8A 3T3HA 1KMQA 3WWZA 1F8YA 4R8KA 5H3CA 2FMHA 3MGGA 3PS9A 4LV8B 2C92A 1T8RA 5CJ2A 2ZGVA 3IE0A 3NBAA 5D86A 2ID7A 2GBLA 3H42B 4XJTA 4U7DA 1AGXA 1T25A 3DV9A 3KFVA 5HW0A 1A9ZA 2C9YA 1CUZA 3O8RA 5HDQA 4F8YA 4BKUA 5KNDH 3GLGB 1Y82A 2NT3A 4ESEA 5C80A 1JEYB 3VH2A 3K30A 3DOEA 1YMQA 1H3FA 2H4YA 1RYYA 3S40A 1VLZA 1XQYA 5KWEA 1I94B 3B3QA 1N2HA 1R9GA 1XHEA 1KARA 2IIQA 3KSMA 3NNSA 4P2BA 5FADA 1DRUA 3U4DA 4RVGA 2XSZD 3M83A 3CNEA 3DTTA 4KDCA 3ZY2A 3HBMA 1GPMA 3QJGA 5CB8A 1JQ5A 3QFTA 1Q1AA 3UWDA 3ZXIA 4DJTA 5EIXA 1ZM7A 5JZSA 4REQB 4XIFA 4EJ2A 3I9LA 2R8YA 4XWYA 2QYTA 3MJTA 4P4LA 3JWHA 2IOQA 2HPHA 5JMPA 4PLGA 2V0CA 2ZRCA 4A6XA 1FP7A 3DCYA 4JODA 4P3PA 4XSGA 2X0KA 2C8JA 4QLOA 3FDXA 1QAOA 4QSHA 1XEWY 2ERYA 2CLMB 1P9WA 1U0GA 2HPAA 3T34A 1QH0A 2E4YA 1K5HA 4BV8A 2WTBA 1JJFA 1Z34A 4UTVA 3O3OB 2B30A 3RQSA 4MA5A 2W2PA 1DJLA 2IS1A 3DO6A 3HJNA 4UUPA 3SLKA 3TO5A 1E2HA 5K0EA 2A14A 2NVUB 5HNKA 3KOWA 2VO1A 2D4AA 4ZDWA 1M74A 1SU4A 1RJFA 4LAFA 4TMWA 2UVDA 3G9QA 4NEQA 4UD2A 3IE2A 3ST7A 1QTRA 2F4VB 5CCXA 1NUUA 1PSDA 1QO0D 5AJZA 1E9RA 5EHGA 3RUCA 5A5FA 4UE3S 4RZUA 1BWPA 2FJ0A 4KQFA 1P1FA 3IQXA 4F72A 1RR6A 3ZWVA 2EKQA 4E5YA 2ZTHA 5JR3A 5ALLA 3EEOA 4JLAA 1IHUA 5BW4A 4K2HA 2ZS8A 4N5LA 5CD9A 4MEBA 5FP0A 3ZVLA 2WJYA 2QYSA 1NJ1A 1QH8A 3GJQA 3H13A 3I0ZA 1EQAA 1ZICA 3TH5A 3WLKX 1UBHS 2F90A 5IJ0B 3SXUA 1U3DA 3F5FA 1OI4A 2A86A 1GWNA 4CUJA 5KQRA 4KUHA 3U0VA 1K8RA 2BFOA 2GA9A 2QTHA 3HDVA 5DYIA 2Z6AA 3LQFA 1IDOA 2CKMA 1DGQA 1QHFA 5KNCA 3IEPA 4J3NA 4A0GA 2IH4A 1N33B 4KWTA 4YJGB 2RGGA 4GP6A 4EUHA 3UBTA 1OBVA 4IXWA 1P7CA 1RLTA 4L5JA 1QVRA 2ZBDA 5DYYA 3UJPA 4D57A 1OR8A 3IDFA 3K9WA 1CUFA 3BIFA 5AT1A 4KLCA 1ZOPA 3BJZA 3HRHA 4ND2A 4MMZB 1OFGA 5G4KA 3DL4A 3FMFA 2GS9A 1P1JA 2I4IA 2JRCA 1XLWA 4FYHA 4HNAB 2Z3VA 4R6XA 1EFVA 1DJMA 3NH9A 2YHIA 1XZNA 3DLPX 4XUCA 1YL6A 1Q14A 4G6ZA 3LCVB 4OAPA 1GPJA 3BULA 1CETA 1SG6A 4K1XA 3V9AA 3LX8A 3W8FA 1NC3A 2ODBA 2YS6A 1KOJA 4YMWA 2W2LD 3A8TA 1FYFA 3CLUC 1D1PA 1QH1B 1E94E 1X7WB 4M9SA 4MYHA 4O4LA 4ALIA 1O1YA 3DBLB 3HCAA 3EAGA 1RIIA 3QFFA 4IS3A 3TLCA 1WEKA 2C3MA 4ED9A 1JVSA 1N6KA 3ORQA 3QW2A 4XGQA 1V7PC 4FHDA 4P82A 3ZVKA 2OVBA 2YN2A 2NU9B 5AW4A 3KQHA 1NF3A 3EXEB 2CWWA 2C9MA 5CPFA 1ZRMA 2GSDA 1YR7A 4G84A 3W8RA 4DV7B 2XKKA 2XRZA 1VFPA 2P6RA 3ZCXA 2DXIA 3ESAA 2GDJA 4ACAA 4WK2B 2C4VA 1VMDA 4PZAA 2PH3A 4CTMA 1T6ZA 2G5TA 4C2AA 3O9MA 4N76A 3KEFA 1NVMB 3MAAC 2G36A 2WUEA 3M6IA 1KF0A 4R0NA 3GROA 2D7DA 1OFUX 1PWYE 1A5ZA 1OT3A 3CQ9A 2ZB4A 4P7GA 3RVKA 3U7EB 3W5UA 1LX6A 4JBYA 3IUPA 2IW3A 2X8WA 1Y9EA 3HBNA 2AEEA 4WIAA 2C5GA 4J1QA 3P4YA 5EMNA 3KB2A 3ZU3A 5IDWA 3IAM6 4O1IA 3RIHA 3TLMA 2E1RA 4E12A 1HYHA 2QG9A 1VSTA 3HXPA 3H2HA 4IHJA 2PKWA 5JH7F 5DHFA 5DM2A 1DT3A 2EL9A 4WOCA 3S5UA 2FEPA 1DKLA 1F4PA 1T0BA 2G1UA 2WHPB 1VKRA 2Y0BA 1JHUA 3LQ1A 3QYAA 4OI2A 3ZHTA 4BN4A 3TQSA 2J6CA 3DKVA 3E9NA 3MHTA 4XSVA 3BWBA 1Y8QB 3QHQA 4HFNA 4UPVA 2VDRB 3ABZA 2FMKA 4JVLA 1U7TA 2B5VA 3O8QB 4BZXA 4YPVA 1EIWA 2EJTA 1WCIB 4M46A 3THYA 4N5MA 2DERA 3PXCX 1WMDA 4ZC1A 4CL2A 4FFVA 1D2RA 3OHSX 5CA1A 10MHA 4NNJA 4PN3A 3LBFA 1GPNA 3L18A 1T43A 5EMJA 2YIVX 4YJKA 3DDOA 2WHXA 4ZQEA 1F2TB 3TW6A 5ELXA 3X1MA 5K45A 4X1IA 5J3JA 3AO0B 1Z75A 4P4GA 2OCXA 3CCCA 4HSEA 2C8VA 3EVEA 3H7IA 3ITDA 1IXZA 4OM7A 4QODA 3PL5A 5DN9A 3V6LA 4XCVA 4A10A 4DDVA 4F2HA 5J2UB 2ZJBA 1LLCA 1ZISA 2QORA 2QD5A 4WKNA 4Q9KA 1U3VA 4X45A 4XE5A 2IVFA 3PKZA 1NV9A 1P8JA 2TMDA 3QY0A 2AFHE 4K28A 4N54A 4KNVA 4K9DA 4K9KA 4KX3A 5J2TF 3W4IA 4NXMB 2DAPA 2AH5A 2YC4C 1BROA 2PWYA 2C7RA 4GBGA 3N0RA 5EHXA 3LKZA 1CVIA 2ZSKA 3GXBA 4WXEA 1B42A 1O2DA 1BS2A 2DHQA 3M4JA 4YJ3F 2AJDA 2GK7A 1UL1X 2DPLA 4LVUA 3AUXA 5F7JA 5A4IS 1JYFA 5I3CA 3BWEA 4I1RA 1WSBA 4EFLA 4X62B 2PGDA 1GTL1 2GXQA 1YA6A 2JGNA 3HR7A 2D5LA 4TTPA 4U2GA 1OJLA 2L0XA 2QYHA 1F1JA 3T99A 1RSZA 1WNTA 2OCYC 5HHTA 3SYNA 1PKXA 2GT1A 4M1TA 5ARBA 3LWNA 4FDUA 4JT4A 3S2GA 2G6BA 2VATA 5LZ2A 5KNBA 4NARA 5LZ7A 2H0QA 1T5HX 4WOKA 1Y6ZA 1OHHA 1Q20A 4HH4A 1Z5WA 5DI9A 4GYWA 3WWEA 4CHTA 1Z5GA 5KJCA 4BPBA 4JU9A 2GCOB 4OL0A 4L02A 1MUUA 4OHMA 2C1XA 3P97A 3OIFA 1R9NA 2Z2YA 4MW9A 5T8KC 5KMGA 4C89A 1N8KA 1ICIA 2FFJA 3EYAA 5HGJA 4AUNA 1B0AA 1Z45A 2CHQA 3CX3A 3LF1A 5DOZA 4EHKA 2AVNA 3WB2A 4J3JA 2BE7A 2BW0A 2VYVA 3AV3A 3UGTA 3CXRA 2XNCA 3BFPA 3TZCA 1N3IA 4BFXA 1Y80A 1UC8A 2WWYA 4MS3B 2HREA 3AEQB 4QGFA 4C6TA 4DCVA 2HCFA 5BSEA 1XEAA 5BWCA 5CAEA 5LP1A 1WKVA 4PLWA 2W6JD 1AZTA 2E82A 4LCJA 2C3OA 5EE1A 4M0PA 3P9CA 3LCUA 4A8JC 5CYFA 1A96A 2HBZA 1W59A 3GNLA 4GRDA 4NAUA 3V1YA 3NHRA 3R7SA 2ROQA 2NU6A 1V26A 1PG0A 1RABA 3AESA 1XIVA 4FMDF 4GMHA 4MA0A 4D8VA 5DSXA 1R0RE 3BGOS 3K5PA 4CMIB 2BCJQ 2MMCA 2Y1CA 3AEYA 4NU0A 1REQA 1JI0A 1U0JA 3X0DA 4F2DA 1LPNA 2YL2A 4H6PA 3U3ZA 3PRKE 4C0WA 4EL0A 3CHYA 5J1SB 2TRSB 1GAXA 3KD2A 5EEHA 3UKDA 3ZIDA 4Y1RA 1EBUA 4J6FA 1DEOA 2A3NA 2I03A 1NZDA 2TSYB 3UVEA 3TQIA 2JLBA 1H0HA 4P31A 5U9CA 3A10A 2QF7A 3P0JA 3THWB 4R2IA 1OUMA 3BUSA 1GN9A 4DLLA 2FFBA 1FXWF 1XLTA 2RGDA 3WIBA 1KEPA 4R2HA 3TUJC 1GGEA 2QN3A 5AXDA 1T3TA 2VQDA 3RC8A 1BE1A 3OUZA 2HRDA 3EBPA 3R3UA 1NHGA 4YXFA 2ORYA 3EHDA 3U1BA 2ECQA 2GEDA 2PZEA 1F5NA 4OQNA 4EI7A 2BEKA 3ZZMA 4ONEA 2QVGA 2Y9PB 4HK4A 4CNQA 1LSOA 1N2CB 4MNTA 4ZKDA 1XDSA 3FRJA 4WESB 3A9UA 1EFAA 2JLVA 3JWPA 4DR4B 3G2KA 4GXQA 4KIJA 2GARA 3G89A 3JPYA 1N4AA 2ATIA 1ZJZA 1VHWA 1LW6E 4JI7B 4IMJB 3BGWA 1JNXX 4D0SA 5AI0A 5JFTA 2UZ1B 2PV0A 2P2CA 3C8UA 3GRKA 2D5BA 1N1GA 5A3SA 4DSOA 6PFKA 1Y3FE 1CULC 2LIPA 3JD4A 1LPBB 3NRBA 1ODSA 4D9BA 2AG0A 4PYKA 3WRWA 3K20A 4FUQA 4Y9SA 3X1JA 1V3TA 2FTKE 7AT1A 1WR8A 4KE8A 1RJ9A 2AHOA 3OY2A 2H63A 3FTNA 3C98A 2H2WA 3HJUA 1CQXA 2Z8XA 1B7GO 3D31A 3NKLA 5DVZA 1Y33E 1FP4B 2CMFA 4YPOA 5BYBA 1JB1A 3OLXA 5ALNA 3SIWA 2FXVA 3D8UA 4GWKA 2LPMA 4AL4A 2DJ5A 4ROSA 5HE8A 3ZY4A 3UTDA 1U1IA 3KG2A 4EHHA 5CDHA 2QS9A 2V5VA 1I2AA 3GRYA 3OMWA 2JJ1A 4AIIA 1AKEA 3NS7A 1Z4IA 2FCAA 3NZEA 4H3HB 4L3OA 3LUBA 3UICA 1UWLA 4UOEA 5HWSA 1R64A 2FUCA 1RHQA 1XKTA 2ADMA 3C6YA 4E51A 4J0CA 3V80A 1K9SA 2OR3A 1YVRA 2XCQA 2ZPAA 2LE0A 3FUTA 4LHZA 4WKBA 3RE1A 4PBRA 3ZCVA 3U3JA 1B0UA 4DR5B 4P86A 4EA9A 5BQXA 2R6GA 5FOQA 1CQJA 2EW8A 5FTJA 3AF5A 5DMHA 3C6QA 3GPDG 3MZ0A 1MORA 3R0XA 4M76B 4C14A 2PZMA 1S01A 2EW1A 1ZJYA 2G67A 3D8HA 4JY7A 4PAMA 5KVQA 2BRUC 3VR5H 1HL3A 1IG0A 2WFMA 3RO7A 4BO4A 4D74A 3UPUA 2W2KA 1XD2B 1C0IA 2ALJA 3HA3A 2A30A 2Z1DA 3NX4A 4F2WA 3QTBA 2R62A 3C1AA 4FYWA 2IHVA 4WXPA 5JI3E 1QYDA 1UK8A 2O2GA 1QGDA 3GAFA 4M3NA 1L7AA 3DBHB 5BMVF 3I1JA 2C7QA 9MHTA 3N75A 3WKEA 3CPEA 2O6LA 2V65A 2FRXA 3M1LA 4GT1A 1XCLA 4KFSA 4WZAA 1ADJA 3LCCA 4DL9A 3H5OA 2VSYA 3BJIC 4ETIA 2RGCA 3RW9A 1P2VA 2Y0CA 1HF3A 1WPGA 2X5JO 3G8BA 4QE3A 2YRFA 3GH3A 3EFOA 4CM5A 1OU4A 3PFHA 3OEHD 4P38A 5AW2A 1LVUA 3D0OA 1YTUA 4FX5A 1NULA 4NAVA 2KQUA 2RK3A 4Z3KA 2HRQA 4DJEC 3ICWA 1KVSA 4R1TA 4BWFB 3PQFA 1FL9A 1E0DA 4EGAA 2JLXA 4IJWA 5AJUA 3HYLA 2CNNA 1N2ZA 4JP5A 1X1QA 5CX1B 4KWHA 4NEHB 4YDHB 3N2KB 3VPAA 2OCPA 1XAHA 1PBTA 3F9RA 3L6BA 2EKZA 4Q9LA 2QLFA 2ZAIA 3ZS8A 1GGJA 4YUWA 3DW3X 1A8SA 1T15A 3H2SA 3KQWA 3WNBA 4JB8A 2L17A 4F5DA 5IP5A 1J99A 2VQ6A 3QUSA 1BJRE 1FDVA 4QU8A 1K4YA 3PRHA 1WSWA 2BZ0A 1TQDA 2O2EA 5CB4F 2R8EA 1LGYA 4OHXA 1QC5A 3GLIE 3SE0A 5AK4A 1WWKA 3BB4A 2CJFA 4NCHA 2REQB 3WKDA 2VJYA 3KQOA 1HFJA 2B25A 3NM4A 1M83A 2H51A 2QTNA 1N9GA 2WHQA 3NHUA 1EDBA 2VN8A 3BK7A 3Q41A 1BIFA 3EZ7A 3FOEC 5L3SB 1RLOA 1WULS 4FYJA 4RFSB 2A8YA 2LCIA 4RZQA 3DE1X 4LHYA 4DRZA 2YN4A 3UY4A 3A9TA 4Z7QB 4ZZ2A 3VM6A 4DNPA 2FOIA 3A4NA 1MFZA 1GJRA 2VR1A 2WWXA 2XY4A 3BQNB 2PIDA 3FTPA 1VCIA 3ENKA 4ZT4A 5D00A 3RKRA 3VPGA 1MB9A 4LXTA 1G8JA 1C7QA 3JR7A 4IOLA 3L0OA 5JWHA 4TLMB 1E2IA 2I7XA 2H2GA 3IVXA 3OM0A 5COAA 3U9SA 5KS2A 3E1KA 2OHIA 4PHGA 4G09A 2VAVA 3NEYA 2OM2A 4XQCA 4INAA 3JD3A 3L4EA 3D2CA 5ICEA 2IK8A 1U3WA 3ZE2B 1JAIA 1GCUA 1ISJA 1NSFA 1PQWA 2C5LA 4ITRC 4KOEC 5AVYA 2XH8A 3NWOA 3QELA 1U04A 3R3JA 1H2FA 4WL0A 5J23A 3UFXB 1HSOA 4HEJA 2ACWA 1RYBA 4OXXA 3TLYA 4CIVA 5I01A 1F0PA 2BMWA 1ESMA 5CFRA 2OILA 2IWHA 5EIAA 3EQZA 1KAMA 5DW0A 4CV1A 1ORDA 3MB8A 1DZIA 3KLMX 1QR6A 3CRVA 4ALLA 1X38A 1WRBA 4HGOA 4BQQA 3BSSA 3OM9A 2JFNA 3MK31 4JGBA 5FNVF 2JARA 3EZNA 4DUGA 3VR6D 1R9JA 5HX7A 1XHFA 1PUIA 3N2IA 4ROTA 4E2WA 1VGQA 3FJYA 3P9IA 4TWJA 3TQOA 1E4VA 2BEUA 1MC4A 1MABA 3L0ZA 4RGQA 3SSOA 5FTNA 2UU9B 3C70A 4F6RA 3DDSA 4U9UA 4CT5A 2FZ4A 3HKBB 3SQXA 1RPNA 5DM60 2IDZA 1U2GA 2BHRA 2P90A 3I61A 2DU8A 4ZTUB 5DXFA 1OAOA 1GCOA 4KPUA 4BNYA 1MD9A 3GG9A 2W42A 3IIEA 1JLLA 4WBNA 5H16A 1P8AA 3U37A 4LZJA 1QOPB 2E4VA 3IAHA 4Y2PA 4BNZA 4YXWD 2LXNA 3QWAA 3UT5B 5C3MA 2H1IA 1YB1A 3AF0A 3SC6A 2R4TA 2HK7A 1AO3A 2BDEA 2GBCA 3KR1A 4OHVA 5IF3A 1SVOA 2BFCA 4N5IX 1H4SA 4I1VA 3CH6A 4MCHA 3SR0A 3EIXA 4DA0A 2C7OA 2WJWA 4IZIA 1ECGA 1JJBA 3AM1A 2DWQA 4JUDX 2JBHA 3SP1A 4IMPA 5DBIA 2EFJA 5DTMA 1KEEB 5KHAA 3UC5A 2BCGY 1Q12A 1SHLA 3DD5A 1WQ1R 1ZN9A 4P54A 1GAJA 2Z2XA 3L7NA 1QKKA 3LDHA 4JOSA 1D6JA 1FTYA 4N5DA 4B84A 4DWJA 1Y3BE 4HDRB 1PFKA 4L0MA 3DR3A 4LC0A 1I2ZA 5DWQA 2HF2A 4PLTA 3AJAA 1AGPA 1SIBE 3HHEA 2GCEA 5B1SA 3VI3B 3WFZA 4A2PA 1DB3A 3NWEA 5ALWA 4D9HA 1J2UA 1Q1ZA 4OF4A 3PHGA 4AULA 2IGTA 2W8BA 3K4PA 5HS6A 4MINA 1YKFA 4UVDA 1UDWA 1XI2A 4RH3A 5EXXA 5AW0A 2YWXA 3IPYA 3V4ZA 2HYIC 1L4FA 3KLOA 1VQ1A 1CQWA 3QU2A 4CKBA 2XRFA 1UMDB 1NW3A 4PLZA 1U7WA 4BNXA 1L7VC 3FSJX 4D4JA 4OLJA 5JBNA 1V5GA 2ZJ5A 5SV2A 3DDWA 3AUUA 3E4DA 4NYMQ 1L3BA 1OZHA 2AL7A 3BL8A 2XMQA 1TL7C 1YB5A 2FMTA 3JQFA 2PKEA 1T9BA 1RYZA 1IPEA 3QE4A 2QUBA 3TOZA 1ZZEA 4S12A 2C2KA 1LDEA 4ZAGA 3QQPA 1NZJA 2R8ZA 3D6TB 3B5IA 1CR6A 4PHHA 4TN5A 2NQ8A 1Z63A 3S7TA 3RJ5A 2PSFA 3QPVA 5IYZB 1P1BA 1R5NA 1V8OA 1NIPA 1YFZA 2QPOA 2VQSA 2G40A 1A95A 3U3XA 1G6HA 3MQ2A 4Q4HA 4PAGA 2ONJA 3JRNA 5KIAA 1ZAKA 1C0KA 2Z2ZA 1H0SA 5BW5A 3QVXA 3VXKA 1ZD9A 4NOMA 1XJWA 4LVOA 3HY4A 1IZ9A 1KZ9A 4N40A 4PBSA 2IL1A 1TQ2A 3ZNOA 4CJXA 4LXHA 4I7EA 2Q1YA 3JZMA 5D3MB 4AK9A 1YFLA 3QV2A 3VTZA 1CUVA 2NT4A 1RHRA 3E5HA 2VCHA 3KWLA 3T41A 3COZA 5FBRB 1HZZC 1B3RA 3AFOA 2ANCA 1T8YA 1S7GA 4ZTZB 1PGNA 1R0WA 1J07A 3F7OA 3NXSA 4MVJM 5DLDA 2YASA 4OYRA 5GONF 4MQFB 4Q1AA 1Z5PA 4COKA 3FVTA 3Q0TA 2PA0A 2WJVA 1PU2A 3RIEA 3GCZA 3QZUA 2GPSA 1DX6A 5K8VA 4X63A 3KCQA 4CYMA 1VPLA 1IMJA 1AKVA 3SC2B 5F9MA 3AU8A 4MAFA 2ZT7A 3BIWA 2K4MA 3ZHXA 4D3SA 1DJNA 1SZJG 2DZDA 1EA7A 2PR7A 3OIUA 2IYLD 4I08A 2YOHA 1UJ6A 3D5EA 4BTEA 1F06A 1XL1A 1W2WB 2QRVA 4M0KA 1TYCA 5DFAA 1FJHA 3NHMA 3CTMA 3EVAA 2I7VA 4QELA 1Z68A 1Y63A 1QTQA 4FNOA 3KL2A 1I2DA 4N49A 4WDQA 4X6YA 3EXIB 3R76A 3AUTA 2VNIA 1K75A 1HMYA 1TAQA 1I01A 1YE5A 1JHVA 4W4TA 2DR0A 3KHTA 3L1VA 1OPXA 4AXBA 2F1KA 1II8A 3AR5A 4R01A 4RWEA 4OGKA 4RH0A 3F2IA 3TRDA 2OSBA 3DOUA 3RV3A 2Q1UA 4KV7A 2HPVA 3TZQA 1Q1NA 2GAAA 5KOJA 5CUQA 2FFQA 3ZIUA 3AETB 4ND5A 3IAUA 3TDNA 3R3VA 1BXGB 3FTDA 5AVUA 1CUGA 1WD5A 3Q4GA 4J0FA 3WSTA 5J2UF 4G0VA 2ZU0C 2BEWB 4JYPA 3KZCA 4U9IS 1KQPA 4BO5A 1FW8A 3OCWA 1XDGA 4IWNA 5JT1A 3BBLA 3WC4A 2ZSFA 2EBFX 4DMKA 2G06A 1Q74A 3OJXA 4FYVA 3T61A 3N9IA 4J0KA 2JBWA 3MINB 3P2KA 3OQMA 3VNBA 5D3KA 1DCTA 3DGEC 1YDWA 1SHZA 2ZWMA 4JLVA 3MQFA 3FYUA 4RDHA 5JY1A 2IODA 3UAOA 2A1UA 3BWYA 3PQ4A 4IEIA 4Q7QA 5LKRA 3HCWA 4PC3A 3JQGA 4PGGA 1HEYA 5ALFA 1J2RA 4DQKA 3A36A 2Q3EA 2ZUWA 3FIJA 5BN4A 2WYUA 1YR6A 5LOVF 1BCSA 4HNUA 4D9MA 2VUSA 3QMMA 3CGWA 1CUBA 1K7CA 1KA9H 4Q3CA 2OXIA 1AO0A 2JG3A 3OP4A 1T2NA 2JEOA 1J42A 2PRIA 3ND6A 2C57A 2ZQ5A 4RK7A 5K0LA 4A8JA 4BEJA 5JCZA 4UJ3A 2XV1A 1D04A 2NO7A 3OZAA 2B8JA 4TOIA 3WDKA 1B2LA 1R0ZA 1FX0A 3LA8A 4BFTA 1SCDA 5EA2A 4C7OA 1TW2A 3RVOA 3DV2A 4UUQA 4C0XA 3WIVA 5EQDA 1E66A 2O3QA 4RD0A 2G17A 2PL5A 3D0RA 3UA3A 4FILA 4EG6A 3OBBA 3U62A 3MG9A 1X7YB 2VDOB 1ZUIA 1EHCA 1I7LA 4FI3F 4RS3A 2R3SA 1D5CA 1U94A 5IAKA 3TZ6A 3RSGA 5L3QB 2MU1A 1XTVA 1STOA 4DHWA 5H4GA 4AQYB 3JAWB 2CLEB 5TNXA 1NDUA 4GOMD 3H7AA 3KYBA 3SHVA 3UJCA 5AVQA 1UQRA 3D1VA 3I9OA 2IXAA 3AVOA 4WXYB 3Q5GA 4PINA 1Y5LA 2OZPA 4L5IA 3GLGA 4V0KA 1GYRA 4U7JA 1PEKE 2Q5JA 3F8SA 4IQ0A 4MP6A 1D2CA 2EATA 3ET4A 4OBBA 4PAOA 2O0JA 2J0UB 2X14A 3B3FA 4AJOA 3FVWA 2B1QA 4R3UC 2WSBA 2QAJA 3KZKA 2CLLB 3ILXA 4WZBE 2YY5A 5CK4A 3UB3A 2CXSA 1E4OA 2HX1A 2ZETA 3F9CA 4N12A 5F33A 2BSQA 5I9IA 4L1KA 2NV2B 2W0SA 1YBFA 1E0AA 3OZFA 3TXXA 5EMMA 2DWOA 3UV7A 4R2MA 3STTA 3GZJA 4DPKA 4M60A 2OZLA 2QX6A 2AI1A 1EVIA 2JH3A 5IZCA 3ZIAD 1EVJA 4TGLA 2HSZA 3I37X 4GQIA 4JQOA 1C9MA 1FP1D 4AJ9A 3LM8A 3VC2A 1YTLA 1M1NA 1MOQA 3NGLA 2GGSA 3PCRB 5B4VA 4O2AB 1EE1A 3RT9A 4YLYA 3E9YA 4GLOA 2W6CX 5DBFA 5HIMA 5KEIA 4KNWA 3WRYC 2DFLA 1T10A 4JUIA 2JH8A 2HA5A 1ZMXA 4DGSA 1BMQA 2JLRA 4HJRA 2GD6A 4JB3A 3STUA 4CXMA 1IEVA 1R18A 2OM6A 1NVVQ 4E46A 2XDWA 1S4MA 1SEVA 4LXUA 1VE9A 4QXRA 5H3LA 1XYGA 1A9YA 1RWVA 2C9ZA 1R0CA 3OE7A 4IOKA 3R8XA 3ZQKA 3DTVB 3M2PA 4BX2A 1LBSA 1UBJS 2QU8A 3K6RA 1HC7A 1UBMS 4INZA 3M0EA 1OLXB 2BDTA 3CMCO 3H87A 3I04M 4AQDA 4QFBA 1D2HA 2B20A 2OPBA 3KBOA 1A97A 1JLSA 4AU1A 1RBZA 1IVSA 1G8GA 1OXBB 4QVGA 5JI2E 3JQBC 2BM0A 2FEMA 4K9PA 2OLKA 2VSOA 1WD7A 4HCJA 3R1IA 5CIWA 3MJSA 2FP4B 3IUJA 1JAZA 1DRKA 2J9ZB 3RC3A 3L8EA 3S2IA 3OQNA 1E79D 5EMHA 3R4VA 4ZMSA 3T5BA 4H27A 4ETMA 4NNOA 4PGFA 3QP9A 3UA4A 3MLBA 3OE5A 3Q2OA 2P69A 4BJ5A 2IYQA 3F6BX 5IFKA 4ZAXA 3RSFA 1C7FA 4MKIA 2G70A 2VDMB 4WZ6A 2WJIA 4Y6OA 3K1YA 5AI9A 2JKVA 1ZEMA 2QMYA 1LLDA 3LW7A 1B6SA 2ASVA 4OFXA 4FCWA 2V5AA 2ZUFA 4MDFA 1JR6A 3N74A 5HQJA 4F6CA 5K0SA 1S2OA 4GR5A 3YASA 2PUDA 1GTVA 3D7NA 3IVMA 4FFWA 4OXIA 4URWR 4HL6A 4HNAA 1CZUA 2OBMA 2I6UA 1DBWA 4WCFB 2XUIA 4FW9A 3GT4A 2PRZA 1E1YA 2IPOA 2P6UA 3WGKA 1NXVA 2RDMA 1MKYA 5D5HA 3TGLA 1X9HA 5ALYA 5F3WB 4XGIA 2RARA 3IR6A 3TG8A 3E1GA 3IJEB 4AG3A 4C3VA 1XA3A 1QH1A 3HB4X 3TX2A 3DTVD 3DBLA 4O4IA 1I4EB 5BPFA 3LCRA 3BE5A 5AKHA 5K4HA 2CMHA