2A9KA

Crystal structure of the c3bot-nad-rala complex reveals a novel type of action of a bacterial exoenzyme
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
b'ALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Ral-A
publication title Crystal structure of the C3bot-RalA complex reveals a novel type of action of a bacterial exoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
total genus 62
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2a9kA00
3TNFA 1OHHA 4XSGA 2F1IA 4QKQA 1CKEA 4M21A 3TMKA 3L2OB 2UZIR 3RDPA 1RE0A 1KZ7B 4B75A 1I2MA 2GCOA 1WQ1R 2OXCA 4JJKA 2IX3A 3SYKA 4PO9A 4JIMA 3SI7A 5HZHA 2W2TA 1VYVA 4M9SA 2ORIA 3ADCA 3RHFA 1KK3A 1XMJA 2K5UA 4E03A 4I1OA 4ZDJA 4ACBA 4C7OB 4HAWA 1T9HA 1E9DA 3MD0A 1G8PA 2QP4A 2ZS7A 3OEED 4HEJA 2PEYA 2ZRNA 4JT4A 2WSSD 1E3MA 3W90A 5IF9A 1FFHA 3G0HA 2GBLC 1G5PA 2AFIE 5BYKA 4TN1A 1KIMA 1G41A 1CJUC 1JJVA 4BLSA 2RAPA 1ZD8A 3THYA 1LS6A 4PZZA 5FOXA 3MJHA 3ZS9A 1W1WA 1FTNA 1D2NA 3GLHB 3WYFA 1U8YA 1GTVA 3DMNA 4Q66C 1XTSA 4BFUA 3CNLA 3W5JA 3UATA 2C03A 3UXMA 1VECA 3BH0A 4EUNA 1KSFX 3VKWA 4OI4A 3BC1A 2GJKA 2R9VA 5CM9C 1Q57A 2ZROA 4Q5IA 5TXGA 1G7CA 1NN1A 1N0UA 1BMFD 1Q21A 3K0FA 3MRSA 4KHZA 4M53A 2B7CA 4Q4AB 4TQAA 2Z5FA 2IWRA 3FFAA 4HYYA 3THWA 2NOAA 1N5IA 3DKPA 4PSVA 1S9HA 4Q9IA 4TLDA 2IYRA 2BHRA 4KI0A 3C7KA 5LDDC 1F3OA 4B74A 3GLFE 2WJYA 5LD2B 1FUUA 3I61A 3ZVNA 1ZM2A 3TR0A 1DO2A 2VHQA 1YKSA 2PCLA 4P33A 3PUWA 1WXQA 5KYKA 1NN0A 1E0KA 2XXAB 1TQ2A 4OHXA 2RGBA 1NL3A 2VBCA 4GNKA 5FFMA 5FI0B 4D4MA 5JWOA 4CEHB 4L16A 1KJZA 4W5JA 2QRZA 4Q9JA 1XD2A 2FH5B 2B6HA 4II7A 5BXQC 5JSZA 2OUKA 1HYQA 3BOSA 4Q21A 3VU9A 2HF8A 2Q3FA 3KX2A 4NZYA 1VIAA 3SS8A 5GVRA 2EWWA 4FCTA 2QE7D 4FCVA 1FX0A 2R44A 2EW1A 1IBRA 1AN0A 3NBXX 3T06B 2IUTA 4B3CA 1SVIA 3F3YA 4DEXA 4PQFA 2CJWB 5G41A 2ANBA 4B6FA 3RC8A 1D2EA 1N5KA 5FOWA 4BFYA 3KQUA 1TNDA 4M1WA 2QAJA 1D5CA 5EJEA 3J81k 1YZKA 4US1R 3TSWA 1GZSA 1GNRA 2WZQA 421PA 1YZQA 2WICA 1ZU5A 4M1MA 1OH6A 3ZJYA 1G19A 4D6PA 3CH5A 4A0RA 2R6DA 2N1BA 3B1YA 2CHQA 5IHPA 4EFLA 3CR7A 2V7QD 5GADl 2FEOA 1G1MA 2GEDA 3ICQB 4LBZA 2QPOA 4QM7A 1DS6A 2GHIA 3KB2A 1N2CE 4PAOA 5DI9A 3W6OA 1NBME 4UJ5A 4DSOA 5EE0A 5AJXA 2A5FA 1TEXA 4LHXA 3TH5A 3EZ6A 3U6BA 2F3TA 3M4YA 4ESVA 3TLXA 4LWZA 4M1SA 4LJ7A 1XXHB 2ZJYA 3DPUA 4PSAA 4TTQA 5LB4A 5KDDA 3V00A 4QGFA 1V43A 3LH5A 3AM1A 2AXNA 4NYMQ 2WJIA 3FDIA 4OHWA 1E9AA 2Z0MA 2X8AA 4LV5B 4DB4A 2XNDD 2H57A 3I4LA 1OYWA 2QL6A 4Q4HA 3WBKA 3RRMA 2NO6A 4R98A 3AV0B 4LJ6A 3AVQA 2C8VA 1XEFA 1IN6A 3HR8A 3CF6R 1F2UA 4QC2A 4LY6A 1OV4A 3W34A 2DCUA 1MRNA 4D82A 2VP0A 4V0KA 4D4JA 1YZTA 2ZSAA 3AVVA 3IPXA 3LLMA 5CITA 5EE3A 3PJRA 1NKTA 2FN4A 1GIAA 4QG7A 5KDLA 4B6EA 4ZV4A 2IF2A 5K8UA 4W5HA 4X8LA 2X77A 1XBTA 3KJEA 4WA7A 4D25A 1HQYE 5H1YA 2XZPA 4AG5A 1KDRA 2EYUA 4F7WA 1KI1A 2O0JA 1T5IA 5BWMA 4M9XA 3K53A 1N6RA 2RHDA 4M1OA 4JBYA 1SULA 4Q1DA 4FWTA 3RS3A 3BXZA 3LAWA 1US8B 5DO9A 3ETLA 4B3GA 3HR7A 4FWIB 1IN4A 3E5HA 4RD4A 5GVSA 1YZUA 2KB0A 3I5XA 3CLVA 4AYWA 4A6PA 4KLNA 3Q3JB 4X8OA 3KJGA 4XVQA 4AURA 4JLBA 521PA 3SBDA 3T1TA 5C46F 1AS2A 2FZLA 5JEEA 4HZUB 5EZ6B 5KHOC 1KI7A 2XTZA 4PHGA 1MO5A 1KNQA 2CBZA 3NKVA 1KMHB 2REOA 4UXHA 1W36D 2QZ4A 4KYUA 3T1OA 1RYFA 1V5WA 2H17A 1GVNB 1TAGA 3CF2A 1E2GA 2OCPA 1KY3A 4PHTA 5SZHB 1E9EA 3QXSA 1IY0A 1UF9A 1NLYA 1II0A 4OBEA 4LPKA 4CF7A 5E7JA 3SQWA 2QAGC 4URYR 5KO2A 1EX6A 4LYHA 4O3MA 1IJEA 4U02A 3R9WA 4I81A 5JWHA 1FNMA 1M8PA 2GILA 1E9RA 1VG8A 1GOTA 3FWYA 4XJXA 4MDEA 4L15A 1ZUIA 4GOKA 1R2QA 1HE1C 4RZ2A 5C18A 3UK6A 1S8FA 2VP5A 2F9LA 4RD1A 3SEAA 3T35A 3U7EB 1F48A 2XNDA 2JEOA 4JLAA 2FFBA 3TSZA 3BK7A 1R8SA 2WJJA 3FMIA 1GG2A 2EWVA 1KTVA 5DN6D 3AKEA 3O47A 4TWZA 2OXRA 3SR0A 4DVGA 2VL7A 4BZXA 4D4KA 2YC4C 4OYHA 4AY2A 4Q4JA 4QHSA 3WYAA 5CYOA 4DDTA 4BECA 5AJYA 2BWJA 2AX4A 4LCBA 2O8BB 2WAXA 2IS1A 1JECA 3IBGA 4Q48A 1Q1EA 4MRSA 3TIFA 5A0FA 3A1WA 3ADKA 4XVUA 3ICEA 1N25A 1UKVY 3A1VA 5HCNA 1FP7A 2O8EB 4OJKA 5EXPA 4EPVA 2ZYVX 4OK6A 1NF3A 1LV7A 2QQ0A 4PO8A 4M2LA 4XH9B 3A4NA 2YOGA 1OIWA 1P2SA 3H2YA 4XTCS 2YKGA 4ZCLA 1CJMA 2B8TA 4ZPXA 2ZJZA 4DIEA 3FGNA 1JPNA 4MYCA 2JLZA 2X19A 4GZMA 2W58A 3KXLA 2DR3A 2C78A 2CLSA 3FKQA 2CNWD 2OCBA 3BORA 1N0WA 1TEVA 2XJ9A 1KKLA 2Z4SA 3KKMA 1TU4A 2DWQA 4B34A 4EFNA 3KQLA 2CEAA 2WPDA 3A6PC 3KUCA 5KDOA 3JVUA 1N6NA 3CRW1 1ZINA 4NE2A 1ZP6A 3VQTA 5JHGB 3TQCA 1GRRA 1C9KA 1W4RA 1R10A 2GCPA 4RFSA 2HXYA 4FXPA 4C0BA 4AKGA 1DAIA 1NY5A 2JIZA 1WBDA 2OBLA 3OIVA 5L3RA 2VHJA 2QG6A 2QAGA 4LV8B 2LCFA 2J41A 2H5EA 3HWSA 1IJFA 1G7SA 2ZXUA 3BE4A 3EA5A 3K0SA 3FPAA 3LW8A 2ZR0A 4KBGA 1Z6YA 3KKNA 1NI3A 1W48A 4FINA 2FSGA 1XPRA 2RGNC 2ZRAA 1XTKA 3ZIAA 2JLRA 5JZVA 5FOUA 1E2DA 1ZIPA 1LVGA 1T3LA 2W6JD 2AK3A 4L4UA 3L8ZA 5G53C 3D7MA 1PZNA 1AGRA 5G3ZA 1BH2A 2VYFA 2V3CC 1KHTA 4QOSA 5L3QA 2PH1A 4NU0A 1T0JB 3C5HA 3U4QA 1NVVR 3IIKA 1F6BA 4NMMA 1KK0A 1OLOA 3C4JA 3PV0A 1F2TB 5HKKA 8OHMA 1QBKC 2QROA 1U0JA 3CO5A 2EFCB 3QI2A 4CVNA 1CRQA 3NVAA 4DT1B 1E0AA 2QENA 4JLNA 2YVUA 4G5QA 1EGAA 4DWJA 1RRFA 2GRJA 4MKHA 1XDBA 3MFYA 4I1SA 1KO4A 1A1VA 4TSFD 1E2FA 3DDCA 2GETA 4TLEA 4B43A 2F1JA 2G0NA 3IDQA 3LDAA 1YE8A 3NXSA 3KZ1E 2F9MA 4NYJQ 3R8FA 2N42A 1RRCA 4HUQA 4XIGS 4OQLA 2P67A 3U7GA 2BVNA 5F9HA 2E9SA 3GMTA 5DE3A 3HU1A 2OILA 4IDNA 1O3YA 1RW4A 2AD1A 1YZGA 2NQ2C 4UXIA 3KTAB 3SBEA 3IIJA 5D3MB 2WJHA 3QXXA 2BBTA 1AZSC 2X2FA 4U00A 2IYLD 3QEJA 4XWAA 4CDGA 1J2JA 1II9A 5JMTA 2AKAB 1RIFA 1MKYA 2WV9A 3RAPR 2FGKA 1TX4B 1SVWA 3DM9B 1NBMD 3O8RA 1G4UR 2VEDA 2J45A 2ZI9A 2O8DB 1J90A 1U8ZA 4GZLA 3AGQA 5CLLA 1JAHA 4WW0A 2KE5A 2VHTA 1ZD1A 1G9XA 3TW4A 5HR5A 2D4HA 3MAAC 4DLVA 3BH7A 1NJGA 4MGZR 1Z2CA 4PC7A 1KO1A 4WAUA 3NBFA 4IOLA 3NC1C 2ZAMA 5JRJA 3Q9LA 3RANA 3B1ZA 2VP4A 1ZNWA 1YR7A 1QF9A 3CPEA 3QF4B 2P65A 1WP9A 2RGNA 1TUEA 1BS1A 2C9OA 1G20E 3NDPA 3D3QA 4QJ4A 1AKEA 1TPZA 2IW3A 4EJSC 4EKDA 2RCNA 4FIDA 3NC0C 2IYVA 4C3ZA 3CWZA 3L8YA 1W44A 3BERA 1Z22A 2FJUA 3X1ZA 1W5SA 1C4OA 1G64A 2C77A 1OKKA 3P20A 1VG1A 5JS7A 3K0CA 3W6NA 1E2EA 3V9PA 1XU4A 4BFXA 4TMXA 3CRQA 5C4MA 4W5WA 2FFAA 4XSHA 1CP2A 4YMWA 2Z6VA 1Z06A 2OFXA 1HUQA 4ZCMA 2Q3HA 4XD7D 1IN5A 2MMCA 5AWFC 3BB3A 3C5CA 4URVR 3GLGB 2ZUBA 3QXJA 1UAAA 5EP4A 2B7BA 2I1QA 2ZANA 4QGAA 5JRZA 2GXQA 4QHTA 4AI6A 3DVLA 5B57C 1G7TA 1XFAA 4NP6A 2UVQA 4JLPA 3KQNA 2GA8A 4DHEA 1BOFA 5AUPB 2WMNB 2WVJA 3UG7A 4JZKA 3LX8A 1VCMA 3GJ7A 4TMTA 2JDID 1KI6A 5CJ2A 4OJQA 3H0KA 1U8AA 1ZYUA 1RRGA 1CRPA 3KUDA 4WVFA 3P4XA 3OIUA 5H8WA 3NG1A 3NIBA 3X1XA 3KL4A 4E07A 2AN9A 4MDFA 5ANRB 4NHOA 1U0HC 4C0JA 3GP8A 2HLDD 4JT2A 1OHHD 1GRQA 1NBMA 1S0UA 1FZQA 1XEWY 2WWFA 1E2MA 1LNZA 2IT1A 3EAQA 4AK9A 2JLVA 2W6IA 1UKYA 4TTRA 5AJVB 5F98A 1W2HA 1N6OA 3PUYA 3THXA 3GFTA 5L3SA 2B92A 2QQEA 5JJLA 1E1QD 1XEWX 3JZMA 4Q1CA 1TQ4A 3B5JA 2VQSA 1NVXQ 1U90A 1UBGA 3CBQA 4MRVA 4DUGD 1XMSA 4BLRA 1CR1A 4HLDA 3RRNA 5FBVB 2KBFA 3G82C 1J8MF 1E9BA 5GJWC 4ABYA 2PT5A 5DHFA 1E6CA 2QMOA 4UNNA 3X1DA 1OFIA 2DWOA 3UKDA 5JWRA 4EJSA 1R4AA 1DAGA 5A5GA 4PPNA 1ZCBA 1E2HA 2J9RA 4KJZA 3GJXC 2PLFA 1Z6TA 4ZIRB 1UKZA 1QG4A 4KXFB 4EPRA 2O5VA 1QHHB 2NGRA 3OESA 5TDHA 3GLIB 1X1SA 3WRXC 4HATA 1A2KC 4QGGA 3RS0A 5J4LA 1RZ3A 1TQDA 2C9YA 1X3SA 2OCAA 3SZRA 4AIIA 1XEXB 5FTNA 2EFGA 1YRBA 2REBA 3FKSA 2QA5A 3QVUA 4P4SB 5FPKA 2CHGA 5KSZA 3MSXA 4BRWA 3SFZA 5JI3E 3A1TA 1FUKA 3AVOA 1KMQA 3VR2A 5GJBA 4NDZA 1G3IA 2KJQA 1UEIA 5FBRB 3QE0A 4U5XA 4BASA 2V6JA 1FQKA 4AYXA 4JVNA 2H7VA 2ZJOA 2Q6TA 2Z83A 3W3AA 4Q4LA 1N5JA 4A1FA 1OFTA 4QHYA 2P6UA 4LHWA 5EQTA 1XCPA 3EZ7A 4M9QA 4Q47A 4JL8A 4AC9A 1OH7A 4TLAA 4C0AC 3IQXA 2JDIA 3ZZTA 1I2DA 3DM5A 4DSTA 4JLOA 3B7GA 3OEHA 3NHBA 1IY1A 5AUNB 4A0HA 1HY3A 4B73A 3QF7A 4C7OA 2V1UA 3AVXA 3BB1A 4MYHA 3ZD7A 4DZZA 1S4QA 1COWA 2GXAA 4Q9KA 3R9XA 4HSEA 4HDQB 3T34A 1R7RA 2QSYA 1CBUA 2HLDA 3R7WA 3DOEA 3RABA 3OAAA 1QHXA 4D81A 1QRAA 1IQPA 4TLBA 1JB1A 1M6NA 2D7CA 2QU8A 2VP9A 2ODEA 2QMUA 3CRMA 3I32A 3P1JA 3UANA 4TT3D 1KGDA 4ASUA 3CX7A 2F43B 2FSIA 1E0JA 4HAXA 3L82B 1NG1A 1SXJB 2ATXA 1E1QA 1HT1E 2GK7A 1DG1G 3SJBA 3FFBA 4LHVA 1M2OB 2RGGA 1KAOA 2VTKA 1ZNYA 5HE9A 3RRZA 4B3FX 2Y8EA 4DUGA 2IF0A 4CEIB 2F1RA 3AVUA 4NYIQ 3NBZC 1IY2A 1XTIA 2JASA 4MQBA 1Z0KA 2FG5A 2GWHA 2O52A 3E70C 1NJFA 2AFHE 2J87A 1VYTA 1VCNA 2C04A 2PCJA 1QHYA 4MITA 1XCMA 4FMBB 3TJZA 1X8JA 5EE5B 2KBEA 1RYHA 2J59A 2J3EA 3ECCA 2ZU0C 4F4JA 4OKSA 2Q9AA 2OBMA 3T5DA 4P31A 4ZDWA 1A2BA 1B23P 4AYTA 4LI0A 4Q9HA 4BFZA 2ZRBA 4IDQA 5EUMA 2IHYA 1G3UA 4Q1BA 4I1VA 3MWKA 1OH5A 2ZRHA 2XXAA 5K8LA 3HYTA 3A4MA 1RKBA 3QOFA 1R0XA 3OFNA 4TMZA 1JAIA 2HEIA 4MKFA 4TQ9A 2VSXA 1AJEA 3KKQA 3GJ3A 3F8TA 4AKIA 1I4LD 2BJVA 4YQFA 4N3NA 5AUOB 1UDXA 3IKJA 1PJRA 1M7HA 2X2EA 4DLUA 5LBIA 5BW8A 4QBHA 4QXAA 2GCOB 4POAA 5KNCA 5DSZA 2Q9CA 2ZSDA 1SVLA 1CIPA 3AP1A 4NCIA 5JJIA 2TMKA 4NKRA 3VR6A 1QHNA 2CK3A 3ZH9B 3ZLJA 5P21A 5FUVA 4A36A 2ZRIA 4RSGA 4R71A 3S1AA 1ZC3A 1DAMA 4EPXA 2CL0X 1LS1A 1QHIA 4GFDA 1KSGA 2NMVA 4JKYA 3Q8XB 4LSGA 1BYIA 3I5YA 4F4IA 4ERNA 1P9WA 1QVAA 2RGCA 5J4VA 3THYB 2CLDX 2YYZA 4CEJA 3PEVA 4KLZA 2Q9BA 4YDHB 4EAQA 4PQRA 3T12A 2ZYTX 1GUAA 4YMVA 4TT3A 3K9LA 1XNJA 3I1FA 1KK1A 4GRAA 4V03A 5CB8A 1XXHA 1NG9A 1OB5A 3VKHA 1ONBA 4HLQB 4JVLA 3EC2A 4X8HA 2O0HA 4Q01A 4CIDA 2ZRGA 2L0XA 3NEYA 1DADA 2QUZA 4LJ8A 1FP6A 2H1LA 1RJ9B 2OO7A 3AKDA 4YONB 1YR8A 4V02A 3THWB 4R9UC 1ESNA 1TUIA 2ZYWX 2RMKA 3R20A 4Q03A 3N5CA 4ZDIA 1VHTA 2FV8A 4BFVA 2GBLA 3P32A 2EFDB 2O8FA 2VP6A 3ZVRA 1E2LA 2HCBA 3IIMA 3QNUA 4QBIA 2V8OA 1UADA 4YXWD 2QTVB 1P75A 1T3SA 2XAUA 2GJ8A 2NO1A 4KODA 1IOZA 4OI1A 1YR6A 1DO0A 2PL3A 4M1YA 2IC5A 2ATVA 3QPVA 1KZGB 3Q7PA 2FGJA 1ZBDA 3RS4A 4EIWA 3VHLB 4TYNA 1TTTA 1KYIA 4G0NA 4TMVA 1LW7A 5KPDA 4BE7B 1S9DA 2ZI6A 3BD9A 1II8B 2EVWX 3GFOA 3QG1A 5CDFE 4MUBA 1P60A 1Q1BA 3KKOA 2GK6A 1T4GA 5JS8A 1US8A 3ADBA 5D3QA 3TVTA 2ZM5A 3OE7A 2ERXA 2CE2X 3C15C 3BAFA 2A7QA 1JBKA 2PEZA 4LC1A 3KXIA 2R8RA 5EXTA 2YOFA 4LBWA 4HZUA 4RZXA 3B9QA 4Z8XA 4BFSA 2R6GA 5L8VA 3TW8B 1DPFA 2WIAA 2WSMA 4DDWA 4C0KA 4BRUA 3U61B 2XSZA 4D80A 2VRWA 2JLUA 1EK0A 4FMDF 3CM0A 4RD0A 3OIYA 3FHOA 3L0IB 1E79A 4PTLA 2ASEA 4V0ME 1Z0IA 2A9KA 3ZQJA 1SKYB 1XTJA 4K46A 5FTJA 3R9IA 2A5DA 4AG6A 3EPJA 3WP1B 4IEEA 2MSCB 1ZAKA 4G5SA 2J0UA 2ZUDA 2AR7A 5FBQB 2GF9A 3EPHA 4PAMA 3Q72A 1UFQA 5B2ZA 1Q3TA 2IYWA 4A15A 1HA3A 2BOVA 2VSOA 2WPDD 3ASYA 4URZR 4C2UA 3PFIA 3K70D 2ZUCA 4KFSA 2FF7A 1G5RA 2BMFA 1KDPA 2A5GA 2QY9A 4RFVA 3UMSA 3CZQA 2JIZD 1IHUA 3IILA 5JEDA 3TSOA 4LBYA 2D7DA 4PR0A 4D2IA 1MO4A 4KITB 3ZVMA 5F9FA 4YXWA 1ANKA 2XX3A 4IDHA 5KPJA 3BFKA 3EPKA 4A4DA 4DLRA 1Z83A 5EUQB 1NVUQ 3EZFA 4US2R 2WWGA 4HZIA 4H1VA 4LGMA 2PZGA 4TQUS 1AQYA 2BBSA 3CPHA 2VSFA 2WAYA 3AQ4A 1P2VA 3ZIAD 1TL7C 1EFRA 3SDZA 2NO9A 5FR2A 1DARA 2IWHA 2FFQA 2XITA 5CK4A 1U0LA 2ZI3A 2OEPA 3AH8A 3CIOA 3ZD6A 3NTUA 4B48A 3PUVA 1IM2A 4R2HA 3RYTC 4YLGA 3CKLA 1VMAA 4EQ6A 1JQLB 4Z1MA 3IGFA 3HDTA 1VDZA 3QEOA 4V0NA 4DSUA 1W4AA 1Z6AA 1P72A 2R6FA 3VNUA 2ZJBA 3KFVA 2IEYA 5HKKD 5L3VA 1IAQA 4TYYA 1T91A 2V54A 2HCJB 3TAUA 4O0MA 4AD8A 3D6TB 1ETUA 2ZRKA 3CB4A 5HZKA 4CT4B 4FN5A 2MSDB 1Q20A 1RRPA 1T0HB 3P27A 3TE6A 1HTWA 4HDOB 4BQSA 3AVTA 2VP2A 2F7SA 3N2IA 4KAXA 4GT1A 2E1RA 2Q0HA 3UWOA 2H18A 4H9GA 3O8DA 2NTYC 1FNNA 2WTUA 1T8UA 4URUR 1UBEA 3GJ5A 5F2EA 5FL3A 1KNXA 2F1HA 1E9CA 4WXRA 4JLVA 2OG2A 4Q02A 4UNQA 5TVKA 3ZQ6A 3MWJA 2D74A 5EE1A 3U60B 3NBYC 3MWYW 5FPSA 3K9HA 721PA 2GKSA 1XJCA 1ZNXA 2ZJ5A 1OFHA 2VA8A 2ORWA 2NO0A 5B64A 1U81A 3W6PA 3C8UA 3AVWA 3CWQA 2W2XA 2OT3B 2CLCX 5BYJA 4DLWA 2C2HA 2F55A 3FB4A 1A4RA 2PJZA 2RKOA 2W83A 1AIPA 2XB4A 3AP3A 3CZPA 1GP2A 2ZSEA 4KV9A 5IDVA 1ZU4A 2WWWA 4AKEA 3OIWA 2V4ZA 3SC3A 4Q4JB 1G5TA 2OBNA 1O87A 1E2PA 1Z6GA 3TUZC 2QMHA 4W9MC 2WWHA 3H86A 3TKLA 2WIBA 3PCRB 2H92A 3ASZA 2IK8A 1OPXA 4DRZA 2FDCA 2QP9X 3SJZA 4NBSA 1T6NA 2OFWA 3CNNA 3UMRA 1DAEA 1E1RD 1XB2A 2EFHB 1Z3IX 2NZ8A 2ONKA 2HF9A 2G3YA 4FW9A 1JEDA 1XXHE 2ZVQX 3WYGA 1F2TA 2CL7X 2QM7A 4CRWB 4P4TA 5K8IA 4DT1A 1Z8FA 2OLJA 3EC1A 5E7IA 1X86B 1FQJA 4A0GA 4C4PA 3A1SA 3QKTA 1AA9A 4ARZA 2FZ4A 1AS3A 3K9GA 3QIAA 4NYMR 3W5IA 1MABA 1S2MA 1JXMA 2CDNA 2C95A 4OK5A 2JLQA 3QY0A 4JLKA 2ZJ2A 4HB4A 3U2QA 2PZFA 2WWIA 3HJNA 3O8CA 1GNQA 1IN8A 1OKKD 1Q0UA 1Q1QA 2RGEA 4LJ9A 5TV2A 3EIQA 4DBLC 4BLOA 4BEJA 2P6RA 3LWNA 2HT1A 1P62B 2W2VA 2ZITA 1S3GA 1W36B 4LK2A 2R6AA 3V4RA 2FEMA 2BMJA 2NZJA 1U2RA 5D3MA 3K70B 2QT1A 2KI5A 4DKXA 1SHZA 3AGPA 3WMGA 3ZS8A 4OI0A 5EE9A 2FNAA 4D0GA 1E69A 3E1SA 2JLWA 3IO5A 2XTNA 4RCZA 2CVHA 5DISB 4IVRA 1D9XA 1HURA 2FPMA 2O8DA 4ILEA 4F38A 2QPAA 1HEIA 1ELOA 1G16A 1R5BA 2IHBA 3QXCA 5E7MA 5DI3B 4KSBA 2J0VA 2C98A 2JJ2D 2ODBA 3U6KA 4PC1A 3VR4A 5CM8B 2WKQA 3ADDA 2QBYA 3H4MA 1E98A 1X6VA 1KJWA 1OW3B 3V4FA 4B33A 2BV3A 1CS4C 1SHKA 3EW9A 1KKMA 5EXXA 4ZCIA 2OESA 2VHCA 2YNMA 3RRYA 2IYZA 3QF4A 4HB0A 4QJ5A 3C41J 4V0LA 5KNDA 1OXTA 3PVSA 4DCSA 1J99A 1DAHA 1GITA 1Q3HA 2D06A 2P5SA 2XZLA 2ZI4A 5KSPA 3U4QB 1VIYA 5BN5A 1G8YA 1Z63A 1NLFA 3KB1A 3P26A 4C2TA 3DO6A 3VX3A 5K8TA 3QKRB 2DFNA 1ZD9A 2O8CA 2GVDC 2W6ID 2ZPTX 4TYQA 4A8JB 4BZPA 1NSFA 4JVMA 1E1RA 4RZ3A 4DLSA 6Q21A 2BBWA 2BCJQ 3RS2A 2HXSA 1N0VC 4Q7KA 4QFMA 4LPSA 4PPGA 5C1BA 2ZR7A 1D8TA 1GL7A 4LJYA 1DAFA 4MRRA 4A2PA 3Q5DA 3QUSA 4JSYA 3LBNA 3RLFA 2FE4A 1CLUA 3OHMA 1NNEA 4MKGA 2G83A 3K0AB 2OLKA 4HUQB 1OH8A 1HQCA 4JL6A 2DFKB 3GLGA 3U3JA 3G5UA 1S96A 4PO1A 121PA 5HE8A 1JR3A 4QL3A 1P9NA 1NVWQ 3LY5A 1FMLA 4IVQA 4NPHA 4PZYA 3U3KA 3X1YA 4E5UA 3H1TA 3X1WA 1ZIOA 1ESMA 5FTLA 1QG2A 2DHRA 3BFVA 4DLTA 3F0TA 3AEZA 1GL9B 3F5FA 1QVRA 4IXMA 2OZEA 1ZUHA 3FKSD 4OI2A 5KU1A 1X1RA 3GJ8A 4RCYA 1ZCAA 3KJIA 1W47A 3AF0A 3I72A 4G5GA 3B6EA 4MKIA 3U44A 2GAAA 1U99A 2REXB 3IQWA 1KAGA 1E2IA 2DFTA 1SVKA 3LBHA 4HAVA 4PANA 4Y0VA 2OHFA 1GKYA 4B3XA 2XZOA 1E4YA 1KI4A 1Z29A 4XWKA 5J5CA 4FMDB 1JR6A 1S1MA 2GTPA 4Y0AA 1SVOA 3SJAA 2ZRDA 3AP2A 4M22A 4Q1FA 3KDSE 1XF9A 1SXJC 5BN4A 3B9PA 2G0TA 2I1VB 2JJ2A 3RSLA 3LNCA 4C0LA 4ESHA 4F92B 3OEHD 1KDTA 2AK2A 2P2LA 4MGKR 4KSCA 3REFA 2AXPA 4URXR 5DYIA 1Z0DA 2VF8A 3QKSA 1XPUA 1E0SA 1COWD 2YWHA 4TL8A 3LFUA 1G8FA 2JJ1A 4JKIA 1X8KA 3SYLA 3C14C 3LQRA 3OAAD 2QP3A 3CONA 3GLFB 5B30A 3CF0A 2ZE8A 2ZE7A 3QQ5A 4PQYA 3K8YA 3MWLA 4ASUD 4TZ6A 4QBFA 5JECA 2V6IA 2BM0A 3TQFA 2MMGA 4MYTA 3GLIA 4WZBE 2J0QA 2CCKA 1XEXA 2R6CA 2ZSFA 5IK2A 2NG1A 3EWSA 2IS4A 3WNCA 2DBYA 1SGWA 3CH4B 4IOKA 4MGIR 3LVQE 1D2MA 4M4SA 4OK3A 2GDJA 3TK1A 2ZEJA 4X8MA 4NCKA 5FH9A 2FFHA 1LB1B 2GXUA 4IDOA 1H8EA 5E95A 2XNSA 3A4LA 4L9WA 4LJAA 2QRNA 4EPWA 1OT3A 5CDFA 3BGWA 1CTQA 3QPWA 3WHKA 1W4CA 5BN3A 5CIWA 4HAZA 2G1KA 3H84A 2GZAA 4KBFA 5FPHA 3N70A 1W46A 1PLLA 2IBMA 4H1UA 1GM5A 2O0KA 5LD2C 4D0LB 3VTKA 3M1IA 3VX4A 1TU3A 4HAUA 1E2JA 3EIHA 1R5OA 4IXNA 3SFVA 4CW7A 2UKDA 1G8GA 1VCIA 2GJ9A 4S35A 3SU8A 4JYCA 1H8HA 2AWOA 2R65A 3KQKA 2D62A 4Q7JB 4WOPA 4IEIA 4C0QC 1I4TD 4G5OA 3RSOA 3OFND 2DWPA 1KI9A 4Q7LA 3AF3A 4TTPA 4XOIA 1ZJ6A 1PLKA 4V0OA 2OAP1 3ZZUA 3RS5A 3IUYA 2ZREA 2HUPA 1MOZA 3NEJA 1LY1A 1DVRA 2HT6A 2ZE5A 5L3SB 3THXB 4B44A 4I4LA 4IW3B 1HV8A 4V0MA 4M9ZA 4G5RA 2G1JA 2KSQA 4RD3A 4F91B 1VCOA 2GJAA 4NYJR 1Z0FA 2FWRA 4KFRA 1PLJA 2CK3D 2E87A 2YJTD 1N6KA 4KVGA 3B85A 3ZVLA 4U7DA 5KSYA 1SXJA 4LYAA 3EWAA 4IFBA 4JVSB 4IOJA 5A4JA 1M1YE 5C2JB 4B32A 1ZM7A 4RZUA 4CEIA 221PA 2G88A 1P4SA 1L7VC 1M7GA 2W0MA 3K9NA 2PMDA 3Q85A 5FPTA 4DIDA 1OIVA 1P7CA 2PLRA 1JI0A 5AJZA 1CR2A 3EZ2A 1MRSA 4B71A 3FVQA 2G6BA 4Q1EA 1G3MA 2H16A 4LBVA 2IYTA 2QSZA 2ZRLA 2ZSBA 2IS6A 3TBKA 4LJ4A 4MYUA 3SJCA 2IA5A 2OSBA 5B58C 4PFSA 4B47A 2GEVA 3WHLA 1LF0A 3IBYA 3GLHA 4PPFA 4QBGB 1EXMA 2DYKA 4R2IA 3VKGA 3WP0A 3PG5A 2J5XA 3PENA 4NL4H 3CRRA 1JQJC 3CNOA 1G18A 4D0NA 5IRCD 2ZRMA 1G8HA 1U98A 4GMDA 1XZPA 1B0UA 3SHFA 2X1VA 5SZJA 3KQHA 2FOLA 3LW7A 2GF0A 5EP3A 2QTHA 1OXVA 2ZQ5A 4EPYA 4GDFA 2R62A 1E94E 1VG9B 2XGJA 3BWDD 1F5NA 1ZUNB 3AVYA 3VNVA 4ITRC 4S2EA 1J70A 5CK5A 4KU4A 2ZRFA 2OAQ1 3PITA 4Q4AA 5H68A 2RGXA 2ZRPA 3QBVA 4F4CA 1GDDA 5EZ5A 2BDTA 1MR3F 1DG3A 5DHAA 5CB6A 1TADA 3UG6A 2C99A 5FPYA 3QG5A 4HLUC 4RY2A 5FL7A 2ECKA 5G40A 1OE0A 3DMDA 1T3HA 4YMSA 2AKYA 1XJQA 4CEHA 1OYYA 3HPQA 3R7WB 5KUTA 5TB5A 1VYUA 2QTFA 1DBSA 1CJKC 4O2RA 1YQTA 1E9FA 1JJ7A 3GLGE 1WF3A 2BC9A 3FTQA 1JALA 2BEJA 4FCWA 1CULC 1JR3E 1Y63A 2DFLA 4WXPA 1YRAA 1Z07A 2ANCA 1E2QA 3MJRA 4LHZA 3OE7D 2CJWA 1KDOA 1K5GA 4HLCA 2V55B 1W0KA 4PC3A 3PIRA 1CEEA 1UDWA 1W0JA 1PV4A 4JJZA 3K0EA 5E3HA 1DEKA 1SVMA 4G3XA 2WBLC 2WJGA 4IDPA 2DY1A 5GJCA 3DZDA 1RJ9A 3DL0A 4UJ3A 1K5DA 2XSZD 4GMXA 1J7KA 2B8WA 1Q22A 2GESA 1Q44A 2KWIA 4IVPA 1Z28A 1E79D 2IYXA 2VIIA 1TF7A 1AGPA 5FUWA 4KFTA 4B76A 5JI2E 4LHYA 2C9CA 5CLQA 5FOVA 1E99A 3FMPB 3HYRA 4GPTA 4OQMA 3PEYA 4QRHA 1N5LA 1F60A 4Z8YA 2GZHA 3QSYA 2VH5R 3T1QA 2A30A 3UWKA 1KO5A 3BRWD 4PX9A 4YMTA 5M04A 3MGCA 3HPRA 3PR1A 4TMWA 4DLXA 1XX6A 3K0FB 1T8TA 3TVDA 4IFEA 2QPTA 4FMCF 2ZRCA 2BMDA 3CW2A 3BIFA 4M1KA 5EP1A 1WCV1 4IHQA 1KI3A 3WRYC 4TYPA 2CMKA 5FBWB 5HCIA 2FSFA 3Q5EA 1II8A 5J4KA 1OSNA 4Q9LA 5H70A 2WM9B 1EFCA 2GVZC 3I92A 3SE0A 2P5TB 4C0HA 1JPJA 3S1AB 3GD7A 1Z47A 2EFEB 2RH5A 3TRFA 1N6IA 4O25A 1W49A 3DKVA 1G4AE 5SZKB 4C9BA 5J4YA 4ZDKA 4DDUA 3GLIE 1PVOA 2P0EA 2J46A 1KI2A 1XD2B 1G21E 3ONWA 4HLUA 3OEEA 2J1LA 3W8RA 3RC3A 1Q1ZA 5JSZB 1E2KA 3SQXA 2WSSA 1Q12A 3AF1A 5AUQA 3VU9B 4DLYA 4D26A 1DELA 4PAQA 3AF4A 3PUZA 5DGXA 1NIJA 2AHOA 4NCHA 5UKDA 1EFRD 3I3SR 1FX0B 4CEJB 3GPLA 2CCJA 3B8HA 1PUJA 5JFGA 1M7BA 2A5YB 2VLIA 4JS0A 3GJ6A 4MH0R 1OF1A 3GEIA 1W2GA 5DH9A 1ZM3A 3P4YA 4I1UA 4LOAA 1OXUA 2IL1A 4Z1MD 4RVCA 4ACAA 1ODFA 2ZETA 2FU5C 1G291 4B2LA 4DXAA 1MH1A 1CU1A 1ZM9A 1KO7A 2YC2C 1P73A 2HJGA 2BEKA 4JYBA 1GRNA 1DOAA 4RD6A 2J7PD 2WOJA 2WWXA 4QGHA 3PEWA 2Q3MA 4A2QA 5J47A 3TGPA 1E96A 3MG9A 3NH6A 1XJ0A 3U3OA 4RKEA 1UBFA 3DOFA 2LKDA 1XTRA 1Z0AA 2JGNA 1BMFA 1Z0JA 2IEZA 1LF5A 2F3RA 1KMHA 1D9ZA 5TY0A 1R6BX 3AUXA 2PMKA 1GFIA 1NMZA 2LKCA 1A7JA 1NVVQ 2O8FB 5FBLB 5HTKA 4N0DA 5J4HA 2IUSA 4PPQA 1P2UA 5DNYB 1Z5ZA 3TR5A 2JCSA 1DE0A 4Q7MB 2XTMA 2WWYA 4BWYA 3OZXA 4EDHA 4J0QA 1HT2E 4G1UC 3AF2A 1K6MA 3R8CA 4MRNA 3IHWA 3NWJA 3T1VA 5FOSA 1N6LA 3LXXA 1QDEA 2D2FA 1SXJE 2EU8A 3I8XA 4TYWA 1P9RA 1UBCA 2OE2A 4Q4HB 1EWRA 2YV5A 1RC8A 4WBSA 1KI8A 5FOTA 4GP6A 1G3QA 1GILA 1P61B 4ZO4A 1AK2A 1F2UB 2QE7A 1W5TA 2JLYA 4DCVA 4NYIR 3VAAA 3BFXA 1KJYA 3EASA 4WIAA 3LLUA 4JL5A 2I4IA 4MA4A 3LX5A 5KTYA 4E09A 4F93B 3ZYCA 3REGA 4JMPA 1E32A 4HUTA 1WDTA 3I62A 2G9NA 2QGZA 2CVFA 3GLHE 5KNBA 4BPBA 3IEVA 1RPZA 1L2TA 3WNBA 4CZ2A 1W36C 1NN3A 2O8BA 3EZ9A 1PUIA 3JZAA 1WB9A 4PC2A 3K70C 2V7QA 3N2EA 3THOA 1AS0A 4UNRA 3FYHA 3LRPA 2IXGA 1KO8A 3LBIA 3EARA 3T5GA 4CYMA 5DYGA 1FTSA 4QNMA 2O8EA 3I73A 3M6AA 4IRUB 2A5JA 3LO5A 4L5BA 1TQ6A 4HI0E 1EFHA 4BLQA 4JBXA 2B21A 5AJWA 2J0UB 3A1UA 4CT5A 4E22A 1YJ5A 3IPYA 4ON9A 1EFUA 1NMYA 3GFPA 3VHXA 2ORVA 3U3RA 2J7PA 2GCNA 4OQFA 2WOOA 2QI9C 4Z54A 3DHWC 1L4YA 3MCAA 1D6JA 2BMEA 3B1WA 4LX0A 821PA 1MO6A 4LJ5A 1UEJA 1JEEA 1YZLA 3HU2A 1QZXA 1JNYA 4LRWA 1K8RA 2ZAOA 3FHTA 3D31A 1WRBA 3FOZA 3GCGA 4KYIB 4C30A 1JXOA 4A8JC 4QJ3A 4DDVA 2HJVA 3O8BA 1W7AA 2PBRA 3WNDA 3UIEA 3AVPA 3Q7QA 4B35A 1GNPA 1WMSA 3EG5A 1P2TA 2ZU6A 5FUXA 3ZGXA 4OQNA 2V9PA 4LZZA 2ZR9A 1TF2A 1NP6A 4DEYA 4Z51A 3D8BA 2VPPA 4GOJA 4PC6A 4HB2A 1WA5A 2MSEB 1Y3AA 2OM2A 3C16C 5KSOA 2FPLA 4LYFA 4EQ6B 1FW6A 3ND9A 2QMEA 1XP8A 3QKUA 2OV2A 5JLJA 3AB3A 2PX3A 1N6PA 1CJTC 4XWOA 2C5LA 1OB2A 3IEUA 1BKDR 2WKRA 4FD2A 4DB2A 4BFWA 3EX7C 1E9SA 2Q21A 1P3JA 1ZRHA 2G77B 3A58B 2NIPA 1T5LA 4YMUA 2RHMA 2IUUA 3VR1A 3TAHA 1GWNA 1QHSA 1NMXA 2FSHA 2NPFA 4KFUA 4DCNA 4A2WA 1G17A 1FMJA 5DIFA 1IXRC 2OCYC 3PEUA 3WMFA 4ZKEA 4K81B 2ZVPX 1P6XA 1TF5A 3B13B 3SNHA 4HDCA 2CXXA 2YWFA 2RGDA 2AL7A 3LA6A 4JBWA 1G3RA 2GXSA 2PX0A 3A36A 5C4GB 3W9YA 1JR3D 1XRJA 4DCUA 4N0EA 5E4FA 4LDJA 2BM1A 5HPYB 3NDBB 1ZVQA 2JA1A 3FMFA 3BH6A 3SN6A 2QEQA 5DI3A 1XD9A 3U5ZB 1GAJA 4OHYA 3WXMA 1XTQA 5FI1B 1AM4D 5CJPA 1R5NA 2FPKA 1EFTA 2P6NA 2VF7A 3KTAA 4NONA 4PHFA 1SKQA 3IO3A 3OF5A 4RFSB 2GNOA 5FTMA 1ZW6A 1KSJA 4AKHA 1A5TA 3W8NA 2P3SA 5DN6A 1IONA 2YZ2A 4EFMA 2ZS8A 1ZMXA 4GSYA 3L43A 4OHZA 2QAGB 2ZTSA 3K0CC 1VPLA 1GKIA 4RJLA 2IS2A 3I8SA 4I99A 4D4LA 4B3DA 1NN5A 3QKRA 3VR5A 1NY6A 4P4UA 4A8JA 3B1VA 4UKDA 1SKYE 1DTSA 4RD2A 4A82A 3GJ4A 4Q19A 5GJVC 4C0SA 1UPTA 1MV5A 4DCTA 4OQXA 3FMOB 3HP1A 3VFDA 4XVRA 3LD9A 2ZE6A 2IYQA 4ARZB 1GKUB 3HU3A 3W3ZB 1EWQA 1MABB 1XD8A 4M0LA 4DJTA 4GI7A 3EPLA 4P3YA 1AQUA 3K0AA 3L0PA 3CX6A 4FMCB 2QT0A 4MGYR 4US0R 5FTKA 3UMFA 5L3QB 3PUXA 2JJ1D 1ZNZA 2BIFA 4IJMA 3AKCA 1X8LA 2RGAA 1NKSA 3L0SA 4BFTA 1XZQA 4UNPA 1MT0A 1UKEA 1NIPA 3RNLA 1Z2AA 1UM8A 1ZM4A 2ERYA 3A8TA 2ZI7A 4O2LA 3GJ0A 1CJVC 2CNWA 5IT5A 1YHNA 3CR8A 5JCPA 3BBPA 4NTZA 4WZ6A 1FPMA 4JLMA 1S1CA 5IK2D 3SHWA 1UJ2A 2BBOA 2JATA 3GEEA 2ZRJA 1VTKA 3TUJC 1GSIA 2V1XA 2JAQA 2NO7A 3RS7A 1OIXA 1H8ED 5TMPA 1YZNA 3CRVA 1BO6A 2BCGY 4BLPA 2HYIC 4NCNA 1XWIA 4TL7A 2WKPA 3WMEA 3GEHA 3NHAA 4M1TA 3LV8A 1KY2A 1Z08A 1R0WA 4P32A 2HDNB 1NRJB 1WBBA 1RFLA 1VHLA 1XMVA 2QBYB 2WJVA 1U9IC 3B82A 3VR3A 2EYQA 2UZ3A 2QNRA 4B2PA 5G3YA 2ZIAA 1H8HD 4GL2A 3B60A 2VHUA 1KSHA 2W6JA 4UNSA 1ZC4A 3LXRA 3EIEA 1NSTA 4QM6A 2ZI5A 4IKEA 1AZTA 4HB3A 3KXKA 3U7HB 2D2EA 2WMOB 2O8CB 4LYJA 4LC0A 3K09C 1U94A 3A37A 4A92A 1YR9A 2R2AA 1XPOA 3QENA 2IXFA 4A6XA 3GLFA 4PXAA 4MUAA 4TL6A 2HV8A 1J8YF 1EG7A 4BZQA 2IYUA 2C96A 4ZI2A 4Q00A 5AK0A 3FE2A 1LFDB 3MMPA 3U3MA 2HYDA 2W00A 2IYYA 3NH9A 1SXJD 4A0FA 5FUYA 2J7KA 4Q18A 3B1XA 3CPJB 2PZEA 4TSFA 4JSTA 3ZDQA 621PA 2YOHA 3U7FB 2QM8A 1FL9A 1P5ZB 4BEBA 1SQ5A 2ZJAA 2VO1A 1IXSB 1IXZA 1SVSA 4UQOA 4ZI3A 5EP2A 3MLEA 1M74A 2GEUA 3PQCA 3SOPA 5JJKA 4IOMA 4MRPA 3UPUA 5CIQA 3AKYA 4LUCA 4P0TA 1OXXK 1OXSC 5EXSA 3PXGA 1KK2A 1BIFA 3QJYA 2JLXA 4L8GA 1TMKA 3BS4A 1HE8B 1KOFA 2AD5A 4ZKDA 4AWXA 4ZIRA 1C1YA 1HH4A 2CCGA 2H8KA 4GOXA 5F3WB 1XCGB 1QHHA 2PT7A 3E2IA 3WBJA 2XOKD 5JBQA 4BUJA 2XJ4A 4NCJA 3QVVA 3U44B 1DAKA 4L9SA 4YC7A 4R7ZA 1WE2A 2CL6X 4GBMA 4K8OA 2QGNA 4W7SA 3ZZ0A 4P4SA 2ZJ8A 3M0EA 2JJ8A 5BQ5A 3AUYA 3VMFA 2Z4RA 3IHLA 4EPTA 3ND8A 4HAYA 1FOEB 2WHXA 1YVDA 1N3BA 2ONJA 3L0OA 3MUFA 1AKYA 5LPNA 1MO3A 3CX8A 5DLQC 4JLJA 3WY9A 4GP7A 2OFOA 4OHVA 5TARA 2ZS9A 4PZLA 1E4VA 1KI6B 4KCGA 3B2EA 4DC9A 2ODWA 1G7RA 1QHGA 2LWIA 4DLZA 3JVVA 1U9IA 3B78A 4XTRA 2NPIA 5FL7D 4M8NE 1CR0A 3QPUA 3QKSB 1OFUX 2YHSA 4RKFA 2PJRA 2A78A 3RWMB 2YWEA 5SZIA 1GL6A 2J0SA 1NLZA 2A3RA 2N46A 2CHVA 2QORA 4NH0A 4JLDA 3T15A 2GAOA 4G01B 2D3WA 2XEXA 1VKJA 2IXEA 1LTQA 1W4BA 2I3BA 1S3SA 1R0YA 3X2SA 3K09A 1R8QA 1L4UA 2BJWA 2ZYUX 5JHHB 4Q1AA 2F6RA 4TZ0A 5ELXA 4OL0A 4YDSA 4UXJA 4QNRA 5J40A 5LB2A 2DPXA 1W0KD 4BLTA 2F43A 4URWR 1EX7A 3SYNA 2CE7A 2ODNA 3T61A 1EESA 1W0JD 3KJHA 1I4DD 3BJIC 4XD7A 3EXAA 3TUIC 3FHCB 1L8QA 2IYSA 2FA9A 4KO8A 3RWOA 4TL9A 2QN6A 4N1AA 3KKPA 1RVDA 1BYUA 1CXZA 3DEFA 4A9AA 3LVRE 4B3BA 2W0SA 4PSKA 4EJSB 2BKUA 2JLSA 3LQQA 5KOYA 1XMIA 1CR4A 2AWNA 4DSNA 3QBTA 1E2NA 4BGDA 1YU9A 1VG0B 4B2IA 1Z6XA 2YINC 2DB3A 3K1JA 1OJLA 2XB2A 3KFXA 5CYPA 1SZPA 2YWGA 2RB4A 2BKEA 4LV6A 4TMKA 1M34E 4PHHA 2FX3A 3DZ8A 3CUEF 5JCZA 1G6HA 4TLCA 2SHKA 1H65A 1IN7A 5FR1A 3BB4A 2XOKA 3GQBA 4CGZA 1G6OA 5AR1A 3EA0A 2A2ZA 4FI3C 4WZAE 2Z43A 3QXHA 2EQBA 2FMXA 2GJSA 3RVBA 1N6HA 1R0ZA 4KVAA 1A82A 2GZDA 1CF4A
chains in the Genus database with same CATH superfamily
4BVBA 1V1JA 3VAAA 1OHHA 2ZJ4A 2J9FB 2GNAA 4QKQA 1KEEB 3DV0B 4NV0A 1EZ1A 4KGXA 2ZQYA 4QQRA 5DK6A 2XCRB 4M21A 2D2VA 5MFPA 4NJEB 2UZIR 1XU7A 2WLSA 5G0VA 1C1HA 1RE0A 1QIDA 4PWYA 1GPWB 4TS3A 3CF4A 3FYTA 4TKVA 2GBFA 3G9TA 2J5KA 2WIDA 1DX6A 2IX3A 3SYKA 1C41A 3OQ6A 4C06A 4E13A 4JIMA 3SI7A 5HZHA 4UM9D 5B1EA 5JFTA 3ADCA 4WERA 3G2NA 3S28A 1XYYA 1XVIA 3EQ7A 2XT6A 3EG9A 4ACBA 1YCFA 9ATCA 1I7PA 1FJGB 3KLPX 4PRYA 3TINA 4NABA 4R8VA 1H5QA 1GCOA 1P8JA 2QP4A 2H4JA 2QJRA 3OEED 3SKVA 3R9XB 2DTXA 2YS6A 1SBHA 3CG0A 4BGUA 4GZ6A 1ATIA 8AT1A 3FR7A 4L8FA 1R8JA 4TN1A 1KP9A 3AINA 1NQVA 3IOYA 3STWA 2FPWA 1C7QA 2WJWA 1Y7IA 2R8YA 2Q9UA 3E1GA 1GSHA 4QT0A 3ZBQA 2RJNA 1LS6A 3MJHA 2C82A 1EVQA 3T5MA 1ZJZA 1CE8A 1XTSA 5AI0A 4BFUA 2CDAA 2HFKA 1Y6GA 3CNLA 2OHHA 1EJ6A 3E53A 1CUVA 3KE9A 2Q5OA 2VNIA 4TTTS 2B94A 5EWMB 3SZ3A 1VECA 1MX3A 1KSFX 3I4CA 3VKWA 1XZ8A 3VO9A 1LQ2A 2XWQA 1NUQA 4AY5A 3EC7A 4O4LF 1FFWA 3H13A 1RQGA 1YIOA 3EBLA 1Q21A 4J1NA 4IWNA 2DERA 2M98A 1LPAB 3VSBA 1L5LA 3FCXA 3L1UA 4TQAA 4HYYA 1KWKA 1N5IA 2EJWA 2GM4A 1NR7A 1QGDA 4Q9IA 1QM5A 3IVGA 5DHUA 5FBHA 1GCGA 5E1MA 1KU0A 3KSDO 5LDDC 3COJA 2XH8A 3GLFE 2WJYA 3MMZA 4DGSA 2ZIXB 4QTUB 1FUUA 3IB6A 1J0AA 4EUFA 3U4AA 5AK5A 3AHEA 3TR0A 1L4NA 1UBKS 3CN7A 3M7IA 4L6CA 5JC8A 5CD9A 1W75A 1JH8A 1WHSB 4P33A 3PUWA 1HWYA 4C08A 2W42A 1YQGA 1TVMA 1ESCA 3GLVA 1IJBA 2VBCA 3OQ1A 4R5HA 5FI0B 3SE7A 2BH2A 4MUJA 3DZIA 3JU3A 1KJZA 3EFOA 3O2SB 4H59A 5HMLA 2QM3A 3UH0A 1XD2A 2A67A 2FH5B 2YS7A 3H1AA 4RPHA 4QLOA 1EHCA 3BOSA 5F23A 4WLFA 4YJ2A 1HNWB 2HF8A 3KX2A 3PU6A 2P4QA 4LISA 1G2QA 1GTL1 1ZKDA 4N03A 4KR3A 3VYWA 1E8MA 1V2HE 3NBXX 4WLEA 5JR3A 3RWBA 4PGGA 4XX0B 2IUTA 5E2IA 3DLCA 4DEXA 3FJ1A 3GNSA 5G41A 2OORC 4B6FA 1NXXA 1XAJA 4LE2A 1D2EA 2JCXA 5FOWA 2VBIA 3NGXA 5A9TA 4AL4A 2QAJA 1VBKA 1D5CA 5EJEA 5IT0A 4O2BA 4RANA 3CVYA 2VATA 3J81k 3AJEA 3IQEA 4M1MA 1ZU5A 2FP4B 4D3FA 3WL4A 2PO7A 1G19A 4MS4B 5BSRA 2R6DA 2N1BA 3B1YA 2CHQA 4WE3A 3TCKA 3ZY6A 1HLDA 4IIEA 3AY7A 5GADl 4G0QA 4PBRA 3I2HA 5AYVA 1IL0A 4ZK6A 2QPOA 2H2WA 5LR6A 3AOEC 1A9OA 4PAOA 3OQJA 4BO1A 4RX1A 3CTPA 2Q5IA 2V7GA 1P9LA 3PE6A 5FD8A 3W1WA 3TH5A 3AR6A 3U6BA 4LHSA 5A2QA 2F1OA 3SFTA 4A8PA 5DKFA 4M1SA 4KIFA 4LJ7A 1XXHB 5CFPA 1NI5A 2CV1A 3HUDA 3EB9A 3OE4A 5KDDA 3NMUF 1JYFA 2VUHB 3NGMA 3EH2A 1SC3A 4N7RA 1K08A 3QQPA 5LDGA 5E8RA 3GNLA 1IIBA 3EW7A 3EQ8A 3I6IA 4RVFA 5PNTA 5BV2P 4BO5A 3AM1A 3L77A 3PTLA 4FDTA 4JI3B 4RBNA 1H2FA 2IP1A 2IQ5A 3AB8A 3FDIA 3T41A 1WCWA 2INGX 4CG1A 1GPMA 1YVUA 3D7LA 5GAJA 2F8MA 3VAYA 5IJ0B 4Q4HA 2I3GA 2RONA 2HIMA 5CW2A 5AHXA 2F2TA 1NYRA 5A3VA 1PQ4A 3WAJA 1WZEA 2IOYA 4P36A 2GI4A 1JIJA 4PYLA 2DJ5A 3CF6R 4QC2A 3CX3A 3J80A 3KQSA 3W34A 4D82A 4V0KA 4D4JA 3DJFA 5K01A 4RTLA 2IJGX 1IZZA 3LP6A 3MIZA 1E1KA 3FSRA 5H9WA 3FOFC 2Z5GA 4F6LA 5KDLA 1EX1A 4QG7A 4B6EA 3PC3A 1APBA 1X7YA 4RK1A 2IF2A 2Z1MA 4S0ZA 4OGFA 1UMBA 4EVQA 2Q5FA 1UBUS 3F6EX 1NAIA 1XBTA 3KOWA 3BXGA 4WA7A 3NTLA 1KF0A 4ND8A 5KKAA 2XZPA 3IDAA 2PV0A 4EM6A 4WOCA 3TLAA 1DWPA 5BR8B 1SBTA 3MRXA 4YRLA 3H2IA 3OQHA 1N6RA 2RHDA 4M1OA 3EE6A 3FG9A 2D5BA 3IR7A 1BXGB 3QVWA 4HMOA 4Y1EA 2WQ6A 4BXOA 1QF6A 2NZWA 2Z1DA 3KWMA 4QVGA 3N8NA 1ISFA 3RS3A 1A5ZA 1U3VA 2J5RA 4G84A 3ETLA 1S3IA 1XZCA 3MCTA 3HCFA 4CUKA 4RD4A 4UDXX 2HQOA 1YZUA 1WDMA 1HLGA 1ECCA 2SCUB 4KLNA 3Q3JB 2OORA 5J59A 4MDHA 3HLTA 3HFRA 2HJWA 1MH9A 2GMWA 3HDYA 4JLBA 3SBDA 4WDQA 4P3PA 2BHTA 5CM2Z 2FZLA 4RYLA 4HZUB 5F12A 4IWYA 1KI7A 1TDJA 3C7TA 2XTZA 2DT8A 3MTQA 1L6RA 3ZY3A 1MO5A 1YB2A 5CFNA 2CBZA 1L5QA 1O54A 4ZYUA 3JX9A 5JNTA 2H4ZA 4YJ3F 1W36D 3ESAA 3GEGA 4A10A 1XK6A 4AWAA 5HUJA 3IVAA 4U4AA 1RYFA 4C01A 2FYTA 3ZWMA 1ZQ1A 1Y8QA 2IIVA 3Q11A 4AQDA 4J29A 4DPMA 4JGIA 4PHTA 4CIWA 1Z68A 2DSNA 4EG7A 1QV9A 3AOEA 3QXSA 3A0UA 4DV1B 1IZ8A 2A1TR 2HZ7A 2QAGC 5ESRA 4O3MA 4LYHA 1O6BA 5JCJD 4I81A 1D0VA 1L8LA 5ALQA 4U7HA 1PTJC 2QUAA 4I3GA 1FYVA 4PYOA 3VYUB 3ZDRA 2GILA 3N58A 2AI3A 1FFXB 4YRGA 2XDQB 5EN4A 4JA2A 4MDEA 3L79A 1LI4A 1WU8A 2NUTA 4LN1A 4U5QA 1GN8A 5C18A 1KJIA 2VP5A 1F20A 1VPVA 1LTHR 3JATB 1QR2A 2P9TA 3ESXA 3QSGA 1TAHA 4MV8A 1ZJ4A 1TZBA 2FFBA 5HFNA 2XECA 4ZQIA 5IW8A 1YFLA 4E5DA 2O2GA 3BK7A 3V46A 1PCXA 4A6DA 3DS8A 2ONZA 4JI8B 5A6SB 3E4DA 2EWVA 4OHPA 4FE4A 4ZWNA 5DN6D 3AKEA 1RLTA 2O5RA 3B53X 4S2UA 1RWXA 4TWZA 3SR0A 5A7FA 2FP3A 5BNTA 3H19A 3VZBA 2VYQA 3AIIA 3R76A 1UZNA 2BISA 2VDMB 4L85A 2DHDA 2Y1OA 2O0LA 4OYHA 4QHSA 4Q4JA 4TRNA 4X6YA 5ESXA 4D5EA 4DDVA 5BN1A 3II6X 2G36A 4ETWA 3ML1A 1KBOA 1LC3A 2BWJA 1BVRA 1JQDA 4WV3A 4H6PA 3DG9A 4LCBA 1C9DB 4JLWA 2FPPB 2IZOA 5GONA 1SXPA 2IS1A 3TIFA 3HBNA 3INGA 1Q1EA 4MRSA 1UXOA 3CLUD 3A1WA 4XOUA 4BC0A 5DF1A 3HEBA 1SCUA 1ICIA 2KYRA 3FF1A 3LHSA 3PJEA 2M1XA 5C81A 1V37A 2BFMA 1WD5A 3QIVA 1JQ5A 1QR6A 1M0SA 1NW9B 2C9DA 4H35A 4LOJA 1I13A 1M5UA 2RGUA 2PBFA 4M2LA 4I55F 5LOVA 1ZIDA 2C7BA 4NXNB 5D5QA 4ZEVA 3DTVB 4XTCS 2G4CA 4D57A 2JH3A 4EP1A 1IDOA 4IHAA 4Q1VA 4BO7A 4QDJA 5KAMA 3NTVA 1XMPA 3AHIA 1SXQA 2ZJZA 1S2LA 4GOMD 1SH7A 1EAYA 1MVNA 2ACEA 3TKYA 3ELDA 4R69A 2FW1A 2IY8A 5H4HA 3UJHA 2AA3A 5IVDA 3WLTA 4ZA2A 2YN0A 2JLZA 2X19A 2AUNA 3JPWA 1N8TA 2W58A 4TV9A 4RSMA 5CNJA 5TRTA 3KXLA 2O20A 1QKJA 2R8ZA 3NW9A 4NNOA 2OCBA 1N0WA 2HGSA 2XJ9A 1K68A 3B70A 5DASA 4EFNA 1NUTA 1SQGA 1L7PA 3GN2A 3KQLA 2CEAA 2WPDA 2QTBA 3KUCA 2WYHA 3NOXA 1H3EA 1E4OA 4OHCA 3JVUA 1MXHA 3WFJA 4DQXA 2V6GA 2G70A 3AEQB 5H0IA 3TQCA 3DOIA 2C2WA 2GCPA 2EBWA 4RFSA 5JHGB 2HXYA 1CVLA 3ZE9A 4O8ZA 5EIBC 4WMLA 2JIZA 3EVNA 2WJZB 4YXFA 2Q28A 4YR7A 4DR1B 4HDNB 2QRJA 3OIVA 1UZLA 4UVDA 2VHJA 4JLUA 2QAGA 1XZMA 5AXDA 5THQA 1G7SA 1V45E 4OQYA 1XC7A 1R8YA 2B83A 4R81A 5EFZA 1J6UA 1PTJA 1Z0SA 4GLFA 5LVAA 3UV7A 4DWOA 3UMBA 2I66A 3HACA 2HQSA 5KREA 1LPNA 4X6LA 3ANYB 3E0QA 1FYEA 1OASA 2WYIA 4FINA 2A1TS 5HF8A 3W78A 1YKFA 2FLVA 1NQWA 3AY3A 3G2MA 5CVJA 5M3BA 3ZOZA 1RYMA 4E70A 1JHRA 1HYBA 2JJMA 3TIGA 5B7PA 5C4IA 2EIXA 4YJGB 1T3LA 2W6JD 4JB8A 4W8HA 3W79A 5HZMA 2QZJA 4EEKA 4B8YA 5KVAA 1K06A 1QTIA 5G53C 3FTCA 3ZWXA 2FMIA 2VYFA 1OLUB 1MX5A 4DY4A 1NMQA 1KHTA 2C2YA 1U7XA 4QOSA 4L4SA 4FYIA 3ER9A 4I7EA 1PYDA 1T0JB 4U8HA 2MJLA 3U4QA 3ENWA 4C0XA 2R5FA 2WSBA 4NMMA 1TKCA 5LJIA 1F2TB 1XROA 3X3HA 5GM1A 5BWNA 8OHMA 5HKKA 1LZKA 1U0JA 4ZVKA 3QI2A 5KKCA 3NVAA 1SIWA 2V6FA 2YZGA 4WDRA 2E85A 1U8EA 3MIIA 3TTTA 2OR3A 3VHRA 1HC7A 1DXQA 5CLFA 3K6SA 3QPBA 2I7DA 1RRFA 1XCLA 2GRJA 2Q6IA 4I4TA 4MKHA 4P1ZA 4UVHA 4M8KA 3JAKA 3PPIA 4Y8VA 1KO4A 2GHQA 2R48A 1A27A 1FDIA 2X5JO 4TSFD 5JV5A 1ZD2P 2GETA 3FX2A 2G0NA 1JH9A 2YCLA 4EF5A 2F9MA 3OO0A 4KRGA 3WLPA 3BQ9A 2N42A 3RR2A 3QYJA 4BOYA 1RRCA 4PINA 4JC5A 4D8UA 4XIGS 4H16A 1QJ4A 2ZTMA 3EIXA 1NVBA 4P81A 3JQBA 4CM7A 4KQHA 2R1ZA 5JVDA 1ZK2A 1C7IA 2IDMA 5HJEA 1NUUA 3T6KA 1T2DA 1PDVA 3FNRA 2QVLA 4QPNA 3HU1A 4OLFA 3U1BA 2Y93A 2WUEA 3WTBA 5IASA 2I8AA 3HYLA 4IDNA 3PWTA 5JCOC 1KEWA 2XB9A 3KTAB 3TXAA 3QXXA 2GPJA 3OT1A 1BJTA 2JLAA 3H75A 1JFLA 3H9JA 2QDXA 5JMTA 2XUIA 3M6FA 1PK7A 2OV1A 3CIFA 3GUHA 1RIFA 3PFGA 1MKYA 2AFHA 2FWMX 3DE2X 4FSXA 1UXIA 1FUEA 2HWUA 3ORHA 2WV9A 3HXTA 3VO1A 1K4KA 5ALJA 1GTRA 3PS9A 2FGKA 4HWOA 2EKZA 5K2OA 1JVNA 2EOAA 1DEXA 1BC5A 1SHTX 4G8BA 1G4UR 1CERA 2J45A 2VEDA 4FYWA 4R83A 4TM8A 1UMDB 1J90A 1U8ZA 2O1SA 5JU6A 3SVLA 4N9QA 3P9KA 1W5EA 5JS1A 1JAHA 1Y9JA 3BMXA 4R8KA 1IATA 3AKZA 3ENKA 4DR7B 5KVSA 5I8ZA 3UJ9A 3MWDB 4P86A 4ER6A 3LUGA 4JJEA 4TVSA 2O4UX 2GM3A 2TYSB 1RHUA 3GOHA 3MW8A 4DLVA 4BNGA 1NJGA 1H69A 4ZQEA 1Z2CA 2HFJA 3GEPA 1KO1A 3NVKI 4YP7A 2QX9A 3CGWA 1HL7A 3BMOA 3TOVA 4CLRB 1A0OA 1QQ5A 1L1QA 1Z17A 3BM5A 3DZKA 4F3TA 3RTGA 1YR7A 4L73A 3VZCA 1WP9A 1WD7A 1BS1A 2XRZA 1G20E 4U2GA 5BSKA 4FHFA 3VR6H 1AKEA 4FD3A 2IW3A 4G8DA 4EJSC 2RCNA 2ZWVA 3M3DA 3OZ7A 3KVOA 3VVCA 3C8ZA 4D8WA 1V5FA 1ZSVA 3L8YA 4WBNB 5HTOA 1V3UA 3X1ZA 3UWSA 2VRCA 2ZR8A 4K6GA 4G25A 1YE5A 4X20A 3DH0A 1FTYA 1AY0A 4BP8A 1F12A 2EP8A 2YQZA 3W6NA 1XU4A 3BSSA 1FRVA 4OREX 1V3VA 4PS0A 5REQA 2Z8YA 1PT6A 1NE2A 3Q12A 1P0FA 4BFXA 1I6WA 2BI8A 5BXYA 7REQB 3GEDA 4Y6GB 4KOEC 1BXKA 1Z06A 2VDRB 2OFXA 4W5TA 3KNZA 4XD7D 1PFQA 1Q0ZA 3EMKA 2R7KA 4URVR 2BKVA 2ZUBA 4Z3OA 2JIOA 1UAAA 4FEYA 1PT9A 1ISRA 2I1QA 3FROA 4L08A 5JRZA 1H6DA 3BDIA 2CVZA 4TN5A 1V1MA 2AW5A 4W82A 5EHZA 5K9ZA 3IYLW 1JE1A 2HB6A 2IXTA 1GU1A 4TKLA 1KQPA 5B57C 1UBJS 4U0JA 2OMKA 4NP6A 3ZC3A 1O9GA 4DRXB 3GUZA 3DZBA 2AOVA 2QM0A 2B1IA 1YONA 4JLPA 1OLSB 1XN1A 1BOFA 1K9SA 5C53B 2WA2A 3BJEA 4YUAA 3UG7A 4JZKA 1U0EA 4BV8A 1B6GA 1EMDA 1JLMA 3B3AA 5FPPA 2PRKA 4N0MA 1PJCA 5LA6A 5CJ2A 4RHFA 4Z86A 1IM8A 1BCRA 1HPLA 1OLXA 1U8AA 1ZYUA 5F2OA 4GO1A 3FWKA 3U5TA 3KUDA 5JCOA 4GC9A 4RE6A 3OIUA 3CGGA 3UXEA 4GOLD 1UMKA 3NIBA 3X1XA 3KL4A 4QEDA 4XWGA 5ANRB 4HCJA 3K5PA 2C00A 2OMEA 1WY7A 1UBRS 3EPRA 1YR2A 3O2JA 3M3HA 1H4VB 1YBHA 3QMPA 3GP8A 2AOWA 1L3BA 2FW7A 5LYJF 4WNCA 1BRTA 3FH0A 4BCDA 3GFQA 4J1QA 3HA2A 2ZBEA 4Q4DA 1S0UA 2Y0CA 5KOHB 4QIHA 3JQAD 3HYNA 4X9XA 2GYWA 5CFLA 2PGLA 5AJVB 1W2HA 1P77A 1WB6A 3GA5A 2G63A 4YY3B 1RE1A 1QNLA 5AW6A 4YTEA 1P1IA 3PQEA 5CHYA 1R0CA 2WP8J 4YEDA 4IJ6A 1T35A 2V59A 2VJNA 2DLDA 4HDMB 3O8LA 3L4EA 3QPCA 4HLDA 4DVJA 1BEZA 4WPGA 4PWZA 1SCAA 1ZD4A 2KBFA 1L4EA 1J8MF 2YY7A 5IM5A 2CDRA 2PH7A 3AETB 4ABYA 3DCYA 1E6CA 5JXWA 1K7CA 5HFJA 2ZZMA 5CU7A 4OU5A 1U28C 3UKDA 3GGGA 3Q3EA 4EJSA 1ZW1A 3T3DA 3WISA 2Q8QA 4DADA 3OOWA 3JD1A 4MHTA 5BMOA 2C3OA 4B4KA 2PLFA 1UP7A 2FUNB 4BMYA 2WDZA 4EPRA 2UYQA 4AJPA 3KYCA 4MW2A 4WNYA 4KDFA 4OX9Y 2AR9A 2PZBA 5FEUA 1JLLB 4LCJA 1ONNA 4HATA 4QGGA 1BVHA 2HEGA 3KQOA 3V7UA 4YMIA 1RZ3A 5L6MB 2B99A 4AIIA 4QXPA 2GPNA 1L5FA 2HN9A 3FKSA 1EVYA 1FBTA 5FPKA 5T64A 3T8YA 3OZEA 4TUYF 4YQYA 1KGSA 2X23A 5KSZA 2Q4TA 4J94A 1QK3A 4MI1A 5C7OO 4YWHA 3SFZA 3A1TA 1ZJWA 1FUKA 4LZJA 1MW9X 1N2JA 3VR2A 2AN4A 4P53A 4NDZA 1IQ0A 1M1NA 1POXA 2GGSA 2V6JA 2K4MA 2JIQA 1Y8AA 2MOKA 1L7EA 2PUTA 4JVNA 1WX1A 3T9CA 2H2DA 2W2PA 3WGNA 1G59A 1P7YA 1V5IA 2B3DA 3W3AA 3PLRA 4GUDA 3SHQA 5KNCD 5AHKA 3ILVA 3OI7A 4ZAGA 1TA4A 1OFTA 4QHYA 4LHWA 3IQDB 5EQTA 5LLSA 3WGUA 2AEJA 2J6BA 2Y3IA 3EXG1 3EZ7A 4GPIB 3U40A 1OH7A 4N40A 2B8JA 3BCHA 3QVGB 3KZCA 1CQJA 1I2DA 1R9NA 3WFIA 4AS1A 2IW1A 3B7GA 3OEHA 4PNZA 4PCVA 3CUSA 2DC1A 3S55A 1QU2A 1IY1A 4BS9A 4A0HA 3WWPA 1HY3A 2IEDA 2IE8A 4C7OA 2AG0A 2Y9PB 3BB1A 3L8GA 2GM5A 1M1UA 1W9HA 4RGQA 1COWA 3DVAA 1OC2A 3Q41A 4F2GA 4Q9KA 4HSEA 1H2XA 2G72A 3PQ2A 3UT0A 3GFBA 3DOEA 5C7LO 4GX1A 1QHXA 4D81A 2WIGA 2OHJA 4N7JA 4BWFB 1HRDA 5B36A 4C03A 2WI8A 3I32A 3LT5A 3H6KA 4X0EA 4TT3D 3WZMA 4MS1B 3H2BA 5CXSA 4Z3DA 4ASUA 1CCWA 1NG1A 3PXUA 4M46A 1SXJB 4D3DA 1HT1E 2I2DA 2VEOA 1XO1A 5A05A 3SJBA 3ZBPA 3C3XA 4Z7QB 4EYGA 5HE9A 2IHZA 5AW9A 3RRZA 3QELA 1SK9A 4B3FX 3QYPA 1SU6A 4D4KA 1AQJA 2M1ZA 3UC5A 4CEIB 1EJBA 4C5CA 4AY2A 4ARSA 4F8YA 4FNAA 2FZWA 2HR1A 2JKVA 4YV0A 4MQ6A 3O93A 1T4MA 5C7YA 1T2FA 3A2KA 4X00A 2VWHA 5LMNB 2HW8A 1SUAA 5ADHA 4OB6A 4WOBA 3B48A 3I6MA 1U28A 2FN3A 1QIEA 1SKMA 4UU7A 5AKXA 5FCDA 4ZVRA 3W6ZA 1EVJA 3FWNA 4J6EA 4ZQHA 1N5DA 2OBMA 3RIEA 3O9VA 4PAGA 1SXHA 3QVLA 4N76A 3COWA 1U0TA 3CNBA 4Q9HA 3WIUA 5DTQA 1FJHA 1MJHA 2AMLA 3UOWA 4E46A 4QUBA 2K7FA 4IDQA 4Q1BA 1G3UA 1YIAA 3DNFA 3I45A 1F06A 2ZRHA 5HMMA 4N3BA 1JDNA 3ELWA 1RKBA 2UYYA 1KZYC 3WOVA 1UMCA 2HEIA 3M83A 4HDRA 4MKFA 4TQ9A 3NNDA 3VPHA 1T6XA 3F8TA 3IEXA 4NVRA 1MAVA 4LZPA 3L8FA 4LZAA 1JDBB 2P7IA 4KUEA 4N3NA 4XDGA 1UANA 1W6RA 1PJRA 3KXPA 3SCZA 4FBLA 1M7HA 4DLUA 3ZU6A 5BW8A 4QBHA 4QXAA 3DFIA 3QTLA 2Z95A 3KWLA 4BMSA 4DCJA 3NVDA 3WVNA 5DSZA 4ZVTA 4H7JA 2H0QA 3R75A 1CIPA 1FNDA 2XMRA 1IHYA 2ODTX 4MVJG 3ZLJA 3EG9B 4L4XA 1O0SA 3ZH9B 4B84A 3HO1A 2LIVA 3DAPA 1ULHA 4RSGA 2PWPA 1QBGA 3H16A 1IC6A 4IBOA 4WOKA 1HT3A 3TJRA 4PPYA 1E92A 5AXCA 4BJ5A 3HI4A 1FDOA 5KOIA 4KFCA 2XI4A 5KYWB 1GPBA 4JKYA 1T6BY 2JIDA 4MB2A 2ISCA 4BVGA 1QVAA 3H9CA 5ICGA 2CLDX 2O2HA 2YYZA 2NU7B 4N6OA 1CIJA 1VE9A 4ND5A 4RWEA 5E1DA 5BSTA 3PEVA 4J91A 2JGMA 1C3VA 1SO8A 4Q15A 3UJ3X 4YDHB 1I7LA 4EAQA 5LP6F 1N34B 3LQ4A 4PGMA 1CE8B 3T12A 4R9RA 4EHJA 4FOOA 3K9LA 1N3LA 5LYYA 4XI9A 4EKIA 5HVNA 1RNLA 3UAOA 1KK1A 1YHYA 4GRAA 4V03A 3ZPXA 1CEYA 1SWVA 1ONBA 5B1SA 1R88A 3EC2A 3SJUA 1C3EA 2O0HA 4Q01A 1Z39A 2A94A 2YUTA 4PLTA 4UUMA 3WMRA 1GAXA 4X93A 1Z5WA 2JFBA 2J08A 3MQFA 2OO7A 4GQIA 1O08A 1YMUA 2IOFA 3G85A 3O3MB 4J2HA 3DB1A 1GCUA 4KV7A 1VLZA 1LNSA 3ZNPA 5U1PA 5JH7F 4PX3A 1Q19A 1TUIA 1U7UA 3RGWS 2WM8A 1J8QA 3C98A 3L04A 4J2TA 1RXSA 1R6UA 4BFVA 1YTUA 1GPYA 2RC6A 3IR5A 3ZJUA 3IAEA 3IEPA 1YA6A 1IZYA 1BMTA 1EXDA 1ZK3A 3IIMA 3K8ZA 4QBIA 2OK8A 2O6HA 2V5AA 4CDRA 1O6ZA 4XM2A 3OLWA 4L0CA 2QZ9A 2GJ8A 2J48A 2NO1A 1KZ1A 1GRVA 1FSFA 3ENNA 9LDBA 3JQDA 1GXSA 3EFOB 5K8JB 2QTGA 4TZTA 3E22A 4FFNA 4YNBA 2FEXA 4K3UA 5KHLB 1VMDA 2Q1UA 2ATVA 2X1HA 2G4LA 3QPVA 5DBFA 5FV4A 1R4ZA 2HNAA 3VSDA 4YJ2B 4NESA 1YMQA 3NT2A 1USUA 4EIWA 3C43A 3LUBA 2TSYB 3ZW7A 3E3MA 4KO3S 2PLNA 1I2CA 1EJ0A 2PUWA 4HNSA 4BE7B 3TEJA 3I9KA 2ZI6A 3BD9A 5BR1A 3VR4H 5LQCA 2W2KA 2CSXA 2P6OA 1P60A 2ADMA 2FUKA 2F4NA 4QRDA 1J0DA 2VFAA 2FF5A 4DQUA 3QEBZ 3AONB 2I33A 4ECAA 2EBUA 3GH3A 2PGAA 3SZGA 1MOSA 1DMSA 2MT9A 2HJRA 4O2BB 5EINA 3ABZA 1QYRA 1B93A 4II3A 5IU6A 1L7XA 1OU0A 2A7QA 5KNDH 2I6QA 1VJTA 4GGPA 2XUDA 2E49A 2I6SA 2R8RA 3HXKA 4LXGA 1L5HA 1X15A 1GNTA 2YOFA 2ZZKA 5EIXA 1E3WA 3HNRA 2NV0A 2C3MA 2W2QA 3E3LA 4IP0A 1O9BA 3B9QA 3TR6A 5TVGA 2ZXFA 4BFSA 2O2ZA 4TMFA 3PDIB 1WDLA 3TW8B 2H7CA 1I94B 3O4IA 2P9YA 4CNBA 4J8PA 3PRHA 4IHJF 4D80A 3R3UA 3FYDA 3LHKA 4EMSA 1BQ3A 5KI6A 4YUXA 1SCQA 2P2CA 3EAFA 3JASA 2EZ9A 4TTAA 5ICMA 2O59A 1HDOA 4M1ZA 3E8XA 2CNOA 1QIMA 2A9KA 3HJUA 4XD2A 3TQQA 3QLEA 1Z6QA 3HDHA 1PR3A 1QCYA 3TFWA 5LQDA 2A5DA 2ZRQA 2LW7A 3PBKA 1BE6A 1V3QE 3KSMA 2XYQA 2ICAA 2Y76A 5DWDA 4IIBA 3JTEA 3PZBA 1UBHS 2PR7A 1ZCFA 4OOFA 1E6LA 8ATCA 1T25A 2BGLA 2QG9A 1Q3TA 2IYWA 5B2ZA 2BOVA 2YMLA 4HN2A 2OV6A 1PL8A 4URZR 4K05A 2HPHA 5GZ3A 5IJZA 3LQFA 3E61A 4AMUA 4C2UA 2I2AA 4JB3A 1KZ4A 1TVKB 2YHUA 5LM3A 1G5RA 1WCYA 2GAJA 3HWRA 1J4AA 3L1IA 1FQOA 4MPRA 4AM8A 1T6YA 3EFBA 4XGQA 4ANFA 5AKKA 3IILA 1O6FA 4IR7A 3TSOA 1M1ZA 2YRWA 3R2JA 1G2PA 1NVDA 1OWLA 1MO4A 1RXCA 1X7YB 3FHLA 4KPUA 1UMBB 4ETIA 5F9FA 2H63A 2DWUA 2Q1YA 3Q10A 4MHSA 2D0IA 4I14A 2YFKA 1Z8DA 1PJLA 3ROTA 4A4DA 4DLRA 4ND8B 3RKSA 2I34A 2NP6A 1QO9A 3HZRA 5DTJA 4CQLA 2WWGA 4HZIA 1ZK0A 2AXQA 3STXA 1EK1A 2PZGA 2R00C 3IP9A 3ISVA 1RD4A 2JHGA 2BBSA 3UK1A 1W52X 1SVUA 3CPHA 1EDOA 5CMLA 2D1YA 4EW2A 4EHDA 1SIBE 2PQ6A 2XUQA 3A10A 1EGVB 1Q14A 2K7ZA 3LPCA 1TL7C 3FVRA 2XHEA 3SDZA 2MDTA 2NO9A 3V42A 3U4MA 5CK4A 1UC9A 2OEPA 2P62A 3E9ZA 2OBXA 3EQ2A 4B48A 2Q2NA 4K5QA 4Q9NA 3RYTC 3PHHA 1XEAA 2BDUA 2B1QA 3CKLA 3CU5A 1PHRA 4Z1MA 2O3JA 1B74A 3WS7A 3W9SA 2I1LA 1O6CA 1DQYA 3KZKA 4DSUA 3CLTD 1FMFA 2EF0A 1DDGA 2C8LA 2ZBVA 3PNLA 4NQRA 1RC0A 3OJXA 2A92A 4RIHA 4ND2A 3TYXA 3VV3A 1IAQA 1ODSA 3O4JA 4TYYA 2V54A 1IY9A 2PBLA 1I0ZA 4H18A 5AW4A 1VSTA 4EKYA 4AD8A 1OAOC 5IBPA 1OCEA 4BLWA 5KTRA 5HZKA 1HF3A 1Y8QB 2HADA 5K3EA 3TE6A 1T0HB 4BLVA 2BL4A 2R5NA 4Y1GA 4HDOB 1XAIA 3K4QA 2VP2A 2PGXA 1VMEA 2B25A 3TZHA 4F3CA 3LUDA 2E1RA 1FBNA 2Q0HA 1MB4A 2H18A 3GQVA 4NK4A 3NWEA 4RQBA 5D3ZA 2YBEA 3H4TA 4EVIA 1THTA 3G89A 1HTBA 1P7VA 4RF5A 5F2EA 3OOHA 3O03A 5HS4A 5A5EA 5DHTA 1KNXA 5G2OA 3EVTA 3ZY4A 3FRJA 3SBXA 3MELA 2OG2A 3GNQA 2P2NA 2C2XA 3SS9X 1EUQA 5IEJA 3PXAA 3MWYW 3TMYA 4DIOA 1NI4B 3CLUC 5DBGA 2EJCA 1XJCA 4PVCA 3GLSA 1I5RA 4CMCA 4XPZA 1U5BA 3Q2KA 1PWXA 4WZBA 1F4LA 2EP5A 4MPPA 1EDDA 3C8UA 5EUBA 4BNMA 2IPOA 1EFPA 4V2IA 3CUUA 2OT3B 4R1SA 5BYJA 3C7DB 3P9RA 2C2HA 2IEIA 2FB9A 1T2AA 3PC2A 1E1LA 4OHMA 2F55A 3CXUA 5A03A 1T6ZA 1A4RA 2PJZA 5J3JA 1AIPA 1KP3A 3O38A 1GP2A 3AZQA 5HX7A 4UVIA 4DL9A 4NBLA 2JD0A 3OTGA 5FJJA 4Q4JB 3HABA 1R8XA 4LI3X 4PICA 4LOLA 4ZTZB 4F9EA 5FNVA 5HDQA 2WIBA 3TG2A 2ZB7A 4RHUA 4D8XA 1PD0A 3B3GA 2FWJA 4UU0A 4EB0A 1AKUA 3MHPA 1NX6A 4KUGA 2PGIA 1T6NA 1G9SA 1UPFA 2OFWA 4UFOA 2JGDB 5AK6A 1DAEA 1MAWA 3TZKA 1Z3IX 4EB6A 2ONKA 2HF9A 2ZVQX 1U3TA 4XWWA 3BQMB 1ZHHA 4RGYA 2Q62A 2RSLA 2AEEA 2OLEA 1FB5A 1T9CA 4EY6A 1IU9A 2F59A 2GN6A 2Y66A 4NK5A 5TIIA 1UZAA 3BHMA 3BWBA 2CYAA 5E7IA 2IY9A 2FQXA 4A0GA 3E5RA 3T5AA 4ARCA 1SIOA 4G0YA 5CX4A 1PFVA 2B9VA 3C2QA 3SZLA 3HCCA 3QIAA 5LWHA 1B8UA 2BUBA 1Q6YA 1YJ8A 4OK5A 1FYXA 5CA1B 3ZN2A 3TRIA 2ZJ2A 1VOTA 2ZXEA 1IWOA 4OMUA 1JWAB 4TV9B 2Z3WA 3RC7A 1GZHB 2WWIA 1ORVA 1NQOA 4N12A 4MIEA 1Q0UA 5EMMA 1DWOA 4BNYA 2HT1A 1J8DA 1D2CA 1NF2A 3MGBA 3M2TA 2PPLA 4Q82A 5IJWA 4CMJA 3RSHA 3CISA 3BK1A 1S3GA 2VHYA 1SCKA 2PBZA 5FFNA 3SR3A 3AJAA 4L1KA 5CRIA 1GARA 1M1YA 5FJIA 3SMQA 2BMJA 4RTJA 3K70B 1Z37A 1TQ8A 2QT1A 3JRWA 1T3GA 4K2AA 3INNA 3NIGB 1EDEA 1LGYA 1PZHA 3JRNA 1YC5A 3AGPA 3E5MA 3D9QX 3U26A 4LMPA 3RUPA 4D0GA 2XCQA 4NBWA 1E69A 5ISMA 4WY8A 2HSJA 2XDYA 1ML4A 3T99A 3UCEA 3ESBA 3JWPA 1PZEA 4CETA 1QE0A 4JXZA 2XTNA 1JJBA 3DYVA 4RCZA 3URMA 4UTXA 4X3PA 1D9XA 3AILA 3D4OA 4YP5A 3G2LA 2BSAA 4OP1A 3IT3A 3NIDB 3QFHA 4FOPA 4X71A 3WHIA 2O8DA 2QPAA 3ZHOA 3L92A 3DP9A 2BHNA 3A2MA 1G16A 3EGXB 3KYBA 3BVPA 3QXCA 4RPGA 3RVLA 2O50A 2WE7A 4X1OA 2J0VA 4QXQA 4CQMA 3OZAA 3U6KA 2Q5CA 5CM8B 1C7RA 4OX9B 5EPUA 1OR8A 3H4MA 4OO3A 3M6MD 1GU0A 3QBDA 3V4FA 3WJ2A 5ITZA 1A76A 2PVCA 3T9DA 4X7RA 5FWYB 1Q0HA 5EXXA 4EO9A 2OOKA 2O2XA 3I2FA 4IQ8A 1EUDA 1JEOA 2HA4A 4HB0A 2F00A 2IOFK 2Q50A 1LBIA 1VLVA 3C41J 3H5OA 4BMCA 2CLFB 1B73A 1C4XA 2QVGA 3UWDA 1BHSA 4AECA 1CDZA 2ZI4A 4BO8A 5CVVA 3U4QB 2PL5A 5L3ZA 2D59A 5BN5A 1G8YA 1WXWA 2CDCA 5AK3A 1T8WA 3JQGA 3KB1A 3DLPX 2H1OA 4DG9A 1L1EA 1D1PA 2DFNA 1ZD9A 2NAPA 3ST7A 4BVLA 1I7NA 2GVDC 1TU0A 3FRIA 4FGJA 4NOMA 2QTTA 4TYQA 3U56A 4BZPA 2X1LA 1YRLA 3ABRB 1OOEA 1E1RA 3K6SB 4QFCA 5EYPB 4DLSA 1MHTA 4I4TB 5I8WA 3CLRC 3JAKB 4NCAA 2CB0A 5GIOE 4B17A 4LJYA 3WK9A 4MVJM 4MRRA 1XTBA 5HOQA 3V4ZA 3Q5DA 2O3QA 4JSYA 1HQDA 4HUJA 2MYPA 4HRXA 2PUDA 4MKGA 5IC5A 1BN6A 4MR7B 3UXYA 4QXMA 5JVDB 3PL5A 3S81A 2F3QA 1S96A 3DNMA 3DHYA 4PO1A 2BFPA 4URFA 2V7XA 5J5AA 1EE2A 4CMIB 2ROQA 5A9SA 5EGNA 4HMPA 5F2KA 1JR3A 4F1WA 2W93A 4NPHA 4RK5A 2PK3A 4PZYA 1BEUB 2AW3A 3HMQA 1MLDA 1DUVG 4GNRA 4MEBA 1RAAA 3RCBA 3C8DA 4EYKA 5C9ZA 5LQAA 2VJMA 3OT1B 4X84A 2AEFA 2CNLA 3T3EA 4WCFC 2ZKIA 1CDEA 2FSVA 2R86A