2A9OA

Crystal structures of an activated yycf homologue, the essential response regulator from s.pneumoniae in complex with bef3 and the effect of ph on bef3 binding, possible phosphate in the active site
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an activated YycF homologue, the essential response regulator from S.pneumoniae in complex with BeF3 and the effect of pH on BeF3 binding, possible phosphate in the active site.
rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
molecule keywords Response regulator
total genus 40
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a9oA00
5TQ2B 6ABPA 3JVIA 4MQEA 1CYEA 2E4UA 4XAQA 1MAVA 3OM1A 2JBAB 5EWLA 3JS5A 3GL9A 2E4WA 1GCAA 5BQ3A 4EVSA 3O2SB 2VUHB 2MSWA 2P9HA 3KYIB 4RU1A 3UK0A 2JVJA 2BGGA 3CFYA 3CG4A 4NCBA 5DLEA 2MYTA 3RVPA 3QX8A 3HUTA 3Q15C 5CNIA 3LUGA 3KCNA 2XDYA 1CEYA 3HVRA 1NATA 1PHRA 1M5TA 1BAPA 2W42A 4RK7A 4Z4IA 4LRQA 1K66A 1KGSA 3JPYA 2QSJA 5TQ0A 4OLAA 3RVJA 4ETNA 4OLBA 1ZH4A 2FN8A 3F7NA 2PJUA 1KMIY 2IPAB 4MR8A 2JK1A 3SY8A 1PUXA 3EGCA 5EWMB 2QVCA 5BRAA 3C3MA 3Q41A 4KRFA 2QW1A 3H5TA 2FEPA 2H0AA 2VK2A 4KZKA 4F11A 4KV7A 1ISRA 2GI4A 3HV2A 2CHFA 1EFAA 1JF8A 1QO0D 4MGEA 1M2FA 3KHTA 2HQBA 4YGXB 1MB3A 3NNSA 5CNJA 2RDMA 5TQ2A 3C6QA 4YWHA 1S8NA 3BRQA 3EJWA 1DBQA 5ED4A 4RXTA 3KSMA 2JB9A 4RK6A 1YS6A 4MRMA 4B09A 1Z2DA 4JA2A 4PE5B 1APBA 3DZDA 4XLTA 1SD5A 5EWJA 1XHFA 1TVMA 3CS3A 1SXHA 1ISSA 2FTKE 3H5VA 1A2OA 4RV5A 5TPZA 4LDAA 4Z0NA 1RZRD 4HNSA 5FBKA 2FMKA 3A10A 5KI6A 1JX6A 4RK5A 2JVIA 5IUJC 2V0NA 3N0RA 5KQMA 4YO7A 4NQRA 2NZUG 2DRIA 4KFCA 3TMYA 4Z4FA 1JBEA 5DTEA 1FFGA 4G0PA 1C4WA 2PL9A 5IBQA 1QO0A 3H1GA 3H6HA 3MYYA 4N76A 1YK0A 1EAYA 3N75A 3W9SA 4W5OA 5JNTA 3K9CA 4JASB 4MQEB 2FQYA 4ZYLA 4M88A 5TPWA 1NXVA 3NHZA 3KKEA 3FMVA 5E3JA 1ZAYA 1TLFA 4S04A 3CU5A 4WXMA 4RXMA 3RVQA 1AB5A 3T6KA 1NXTA 4HNQA 4L4UA 3SNKA 2CWDA 3HZHA 4Q6WA 2ID9A 3HJFA 4EY3A 2MYPA 2X7XA 3GT7A 1DBPA 1SXGA 3DGFC 1QKKA 3Q7SA 4EYKA 1FFSA 1E6LA 4F12A 4N0PA 3F6CA 3P9YA 3H6GA 3DLHA 3OLZA 2AYZA 2P4UA 2FMIA 5DGCA 2GWRA 3HDGA 1VLZA 4E7OA 5ABPA 2N9UA 3MIZA 1DP4A 3QEMB 6CHYA 2QXYA 3EDCA 4O1HA 5EWMA 1IIBA 1XHEA 1P6UA 4F06A 1U0SY 2QR3A 5KWSA 2PE5A 1A04A 2FW0A 2FXIA 4MS1A 3GYBA 4DADA 3T8YA 4RK4A 3HCWA 3URMA 5FWYB 3HXMA 3LUJA 3IP9A 3ILHA 3HSYA 2IDMA 2YHAA 4Y9TA 4H60A 2PL1A 2IPLA 1EWKA 3LKBA 3H5OA 1SXIA 2LP4Y 4KMRA 3OMXA 3OQMA 4W5NA 2PUDA 3H5IA 1NXPA 1P6QA 2H3HA 2E4ZA 3NNNA 4TLLB 5FWXA 4YLEA 1TMYA 1GCGA 4MRMB 4Z99A 5GOTA 3ROFA 4RDCA 4E7PA 3BBLA 4ETMA 3EQ2A 4ZPJA 1CHNA 4WWHA 4W5QA 5BR1A 3EODA 1W25A 3Q7TA 4EYOA 2F8TA 2JCGA 4ZJPA 3H1EA 3GBVA 3MF4A 1RXEA 5HSGA 4L85A 3KYJB 1T34A 2WRZA 3QK7A 4LX8A 4GPAA 4JB2A 3LKVA 2Q5CA 1GLGA 3O1HB 4YCSA 5IX8A 1E6MA 5B3JC 4QPJC 5CNMA 1DC8A 4JOQA 3IPCA 4Z4CA 1OXBB 3A0RB 4XARA 2VYCA 2FLWA 1NXXA 2WB4A 2RGYA 3L6UA 4PEVA 1PEAA 2PMCA 1YK1A 3KTOA 4FE4A 5TPWB 2MSKA 1W9HA 2ID7A 1L5ZA 3G1WA 1RNLA 3MQ4A 3OM0A 2HQOA 2FQWA 2CD7A 1DCFA 1USKA 3RH0A 1ZHHA 3RVKA 3N6VA 3FDFA 1RPJA 3GA5A 5HKOA 3FFTA 3H5LA 3NNDA 2O20A 1JDPA 1P8AA 2NUBA 1J56A 3S99A 3GRCA 4OBBA 3O2JA 4QYMA 5TQ0B 1ABEA 4HNRA 3C97A 3GWGA 2HQRA 4Z9AA 1NTRA 3RVRA 1Z25A 4HYEA 5EWJB 1YS7A 4EUKA 4Q6BA 4P98A 3T95A 1BDIA 4QICA 4EYGA 1JFSA 2LIVA 5F64A 1QQBA 3FGZA 3SAJA 5KC9A 1M2EA 3RVOA 5TPZD 3IPAA 1JLKA 3TB6A 5JNSA 3OO0A 4MPTA 2A9QA 1F51E 2R4QA 3M6MD 2RJNA 1USGA 3OLXA 5DCLA 3M9WA 2PUBA 3QX9A 2GBPA 5TQJA 5C5EA 3BREA 3TO5A 1Z26A 3O1IC 3OQNA 3JY6A 2PKXA 5KQGA 3H1FA 4CBVA 7ABPA 4N41A 2VUIB 1YTUA 1Z13A 2QU7A 3CKMA 4LE1A 4MR7A 3RVSA 1U8TA 4D6XA 2LPMA 2IPNA 1A0OA 3JPWA 3E3MA 2E4VA 3KS9A 1TJYA 5JNRA 1PNTA 4P1ZA 1LBIA 5I4CA 3F6PA 4IGAA 4D74A 4RWEA 4YRZA 3VNAA 2PLNA 4EGSA 5B3JA 4KNYA 3LUHA 2R47A 3HDVA 4KK3A 4PYRA 1FQWA 3QLTA 5CHYA 5KC8A 5T7BA 4W5TA 2PAFA 1JFVA 3A3KA 1YMVA 3OQOA 3HO1A 4MLCA 4RK0A 2TMYA 3NHMA 1JFTA 2NT3A 3KLOA 3LFTA 9ABPA 2M1ZA 1D1QA 3N0WA 2FSPA 3IP7A 3F73A 1QMPA 2F8SA 1DZ3A 1JL3A 3N53A 5IC5A 1DCMA 1Z12A 4GNRA 1NXSA 2FLKA 5TE9A 3QLVA 3MM4A 4XASA 5KQLA 1Y1LA 2PUGA 4IF4A 3R0JA 2PUFA 2OENG 4NICA 3QLUA 3OLYA 2NT4A 1R8JA 1K68A 1D4ZA 1EWTA 3OMWA 3LTEA 3VNBA 3I42A 3MA0A 3N0XA 4Z4GA 3IP6A 4MYRA 2OQRA 3CLKA 3O2QB 1PEYA 3C3WA 3RVMA 2FQXA 1SRRA 4OTZA 1KRWA 4RKRA 3ILYA 1XWWA 1D1PA 4YP9A 2FMFA 1U2QA 4IILA 2QVGA 3CG0A 4MR7B 3DGEC 2FN9A 4WT7A 4O5AA 2PUAA 4KQCA 3EULA 3K4HA 1F4VA 1E6KA 2L19A 3O74A 1LJUA 3O1JC 1YMUA 4OG2A 3B2NA 4TMYA 5IUNC 4H3HB 1E2BA 1ZGGA 4OATA 1DRJA 2IYNA 4EVQA 3H75A 8ABPA 1DBWA 3SG0A 1C0EA 1JHZA 1PNRA 1B00A 1EWVA 4MS4B 5FWXB 4MS1B 1NXOA 4ML3A 1NXWA 5JS2A 3UUGA 5IULC 3M9XA 2WMYA 1JH9A 3FFXA 5JNVA 1H9CA 4DQDA 1P2FA 3D02A 5FBHA 1QPZA 1MVOA 4KQ9A 5BRJA 1Z15A 4G0YA 2B4AA 2IKSA 5KQPA 3CRNA 2L2QA 4NCAA 4RZSA 3RVLA 1Z17A 2NZVG 3G85A 4RSMA 1ZITA 4RKQA 2B1JA 4FB4A 4KREA 2WJAA 3QEKA 2LUOA 1JDNA 4RY8A 1LJLA 3OLVA 2M98A 2JRLA 4Q7EA 4XFKA 1U04A 1QP0A 4G0QA 4Z9BA 4H3KB 1URPA 2LBPA 3KLNA 3RVNA 1ZDMA 2FEKA 3CTPA 2R48A 3DBIA 4KVFA 4XXHA 1QNLA 3O75A 3TD9A 3CHYA 1HEYA 1VRVA 5IEJA 4UHKA 1LK0A 1GUDA 1QP4A 3LUKA 5T3YA 2CHEA 1ZVVA 3OLWA 2GX6A 2A9OA 1YIOA 1OXKB 1BA2A 3I09A 1LBHA 4IMIB 4RY9A 3CZ5A 1QQAA 1ZH2A 3GV0A 4RXUA 1BDHA 4Z4HA 3LMKA 1D5WA 5GQSA 4YR7A 3O21A 3LUAA 2HSGA 3LOPA 2A9RA 3OO1A 4G0XA 3CZCA 5HM6A 1DRKA 3LUCA 4LZLA 3ROTA 3IDOA 3N8IA 4MR9A 4MS3A 1I3CA 3QLVC 4O1IA 4N47A 4LE2A 2WJWA 1U2PA 1JYFA 1DG9A 3JVDA 3Q9SA 5DKFA 1WETA 4G0ZA 4PZ0A 1MB0A 1FSPA 2JBAA 5EWLB 3GBPA 3DLBA 5JNUA 1MIHA 4MLDA 4WUTA 3RQIA 2MYNA 4ZMSA 3SQNA 3BRSA 4LE0A 3TX6A 3IP5A 3I45A 5D2CA 4TN5A 4EYQA 4D6YA 4IRXA 4N03A 2AYXA 2R25B 2YHBA 3NBMA 4MS4A 4YS6A 4G97A 1RZRA 4WXEA 1GUBA 3EAFA 2GKGA 2ZAYA 3QLUC 3Q7RA 4ETIA 2A9PA 1VKRA 3HK2A 2IPMA 5CNKA 4FE7A 1DC7A 4EVRA 2HJ9A 4NV3A 4YV7A 1NY5A 4MR8B 2RJOA 3LUFA 4G86A 5PNTA 3UKJA 1UDRA 1YVUA 2FVYA 3SM9A 3E61A 2KYRA 2FMHA 1VPWA 1ZGZA 4UHJA 1Z18A 3KJXA 1USIA 3LUDA 4F8JA 4ZMRA 2MYUA 4MS3B 4MR9B 1TM2A 2L17A 4IMJB 2PUCA 3EQZA 4RS3A 1FFWA 1ZESA 1ZN2A 1RXIA 3HM9A 4PICA 3T38A 1D2AA 1Z16A 4F3TA 2L18A 1ABFA 3C3KA 2PUEA 2E4XA 2HPHA 1BDJA 4RY0A 4G0OA 4DN6A 1L5YA 3KG2A 1ZY2A 3L49A 4JP1A 4MQFB 4MQFA 1JYEA 4KPYA 1Z2EA 2E4YA 4W5RA 2IOYA 1BVHA 2QZJA 3CNBA 3BILA 3HUUA 3I5AA 4S05A 1DCKA 2J48A 3QEMA 5IUKC 1KRXA 3D8UA 4TLMB 5C5CA 1QP7A 4JAVC 5HQJA 5JS1A 3FFWA 2JVKA 3A0UA 1M5UA 4JB0A 2I6FA 2FEWB 3HEBA 3MMNA 1EHCA 4QYWA 4WZZA 4G0MA 5FWYA 4KK4A 3HS3A 1AB6A 3QELB 5IEBA 3JTEA 2QV0A 3QELA 2MSLA 4N0QA 4MAAA 2WY2D 2FKAA 1JWLA 2ZWMA 4Z4EA 4LDZA 3H5WA 1DJMA 5JNWA 2WWVD 4RK1A
chains in the Genus database with same CATH superfamily
2RH5A 4L5JA 2VDUE 4RTSA 4IJUA 3LZCA 1J1IA 5KJ1A 2HM7A 4REQA 3WNCA 4E4TA 2ZIXB 3NOOA 4UEKA 1AMNA 1EGAA 4ND4A 3GFBA 1IFXA 2WJIA 5AW3A 5ITZB 4U4AA 2EU8A 1X38A 2MYTA 5IS2A 3VHXB 2QRZA 1ZI8A 2ZJ1A 3NHUA 3LDHA 2BGUA 5DGXA 3ORFA 5FLEX 2VDJA 1H2HA 1X7ZA 2ZJ7A 2O2HA 4QYIB 5KINB 4JC5A 4LXQA 3EVAA 2A1TR 3NAQA 4XUEA 3EAGA 3OZIA 4LCEA 5IXYA 1E3SA 1AUXA 1LRLA 2XJ4A 1DE0A 1ONBA 1XK7A 2ZBGA 1XZQA 3FKQA 4M38A 4WLEA 5TQ0A 3TM4A 4Q93A 1QORA 1GV1A 2BMFA 3H9CA 2PGXA 4TVKA 1VCNA 2CNWA 4C2BA 1VLJA 3PCXA 1E7MA 4MR8A 2WG0A 4NYMR 4WXPA 3INGA 4RNDB 4UAUA 3TZBA 4ATNA 4V39A 3PKZA 2WWRA 4YUZA 1NJ6A 1JR3A 1T9ZA 3DAPA 4A4DA 2OXFA 3IIEA 5H81A 3R7AA 1Q0RA 3EXHA 1COWA 1DIGA 1FX1A 5KWVA 4DC1A 4QHTA 3UTCA 1MABA 4MGEA 4UTNA 4B47A 1D07A 3QA3E 5FHRA 3DXZA 3ENQA 3EWSA 2GHIA 1JXOA 3KEQA 3CRMA 1NBHA 3WYNA 2PCLA 5BSRA 2XVAA 3M5CA 3HJUA 2R96A 4LF7B 1ILWA 2PZMA 1PGNA 2VHTA 2XGMA 3KVVA 1T25A 2Y99A 5IAJA 4AJNA 4JV5B 1MIOA 4ESEA 1I4DD 4KQXA 4X1YA 3S7TA 4D41A 1Q12A 1YRQA 2V6JA 3LH5A 1WL8A 2DX7A 3JU3A 3BEDA 4R3NA 3WYCA 5JD4A 2P79A 1RC8A 1P3Y1 5IDVA 3QXXA 2Y1OA 3OF5A 5KQMA 3A9RA 3CKYA 1TKBA 2GO1A 2OE2A 3VU1A 3W8FA 4D9MA 1OXTA 3K9QO 3ZWYA 4FB5A 4F5DA 4DEYA 5FDFA 5I4KA 1AUOA 1QE5A 1XRNA 3TSZA 3SHWA 2FPPB 3A9CA 3H2YA 3OWHA 4KPUA 3OCVA 4P9NA 1XQVA 1LH0A 2Q5JA 2GUWA 4JFAA 3ROMA 4AULA 4C6TB 8OHMA 3B3FA 3WQSB 3DNFA 3A1FA 1O94A 3B1ZA 5AXCA 5JYEA 1VIDA 4OUKX 1QTQA 2BEJA 5DW3A 1YJXA 1HDYA 2COEA 2XZDA 4S04A 1IRIA 4RETA 4AY3A 3SVTA 3NMUF 2FYTA 2X1MA 2PX3A 4W1PA 4C0LA 2VAMA 4M8NE 1BVRA 1XYYA 1KVUA 3PL5A 4FQ8A 4K1LA 4OGLA 2UUAB 1XZCA 5E6UB 3HVIA 4BP9A 1FJXA 1XZAA 3A58B 2ZVDA 4RJTA 3LVBA 3ZYZA 1DQSA 3IMKA 4PCVA 1N0IA 4ZVLA 4OP3A 5AI9A 4ND7A 3RSOA 1CQWA 5D3MA 5AJHA 2C04A 4MARA 4AMVA 4CN9A 5JY1A 3PFKA 4KR6A 2HREA 3OEEA 2AXNA 1G21A 2IYZA 3SEQA 3V1TC 2PZAA 2WAOA 3BMNB 2DOKA 3EHEA 5IBCA 4HRVA 1MC8A 2EDCA 3LF1A 1PYGA 2I1LA 1QH0A 1HL7A 4ZOLF 2PE5A 2JIRA 3G2HA 1Q17A 3CEHA 3B8EA 3DTTA 5B4VA 4IKPA 4YNBA 2AG0A 4RK4A 3C45A 1NNI1 3EWNA 3HJGA 5FWYB 3TVDA 4V2IA 3HSYA 4K6FA 2ZBFA 5JPIA 1BFDA 1VL2A 3ZGZA 5AFSA 2PGJA 4H60A 3V34A 1Z2OX 2AOWA 5LYJF 4KMRA 2EJWA 3OMXA 3D3WA 4YX9A 3MMSA 3PWSA 3KOZA 3T9EA 3HCNA 3D8HA 1HKUA 3RHTA 1NF8A 3MB8A 4U2CA 4X3PA 1H2BA 1KR2A 1FMTA 2BGJA 2Y1FA 3E35A 2BH9A 1D03A 3LKZA 3ZV5A 1ZUIA 3LK7A 2HDOA 4A8HA 4G1EB 4LHXA 5CLIA 2I87A 2WG2A 2EQ5A 4DZZA 2V98A 3F7TA 1UPBA 3JAWB 4UM9D 3PJEA 4Q9AA 2X0EA 4JLUA 3GJQA 1CUXA 1RXEA 1OSNA 4JEIA 1P0PA 1U5AA 3AB8A 3OC0A 4ISCA 5TT0A 3PDIA 1GO2A 1JU9A 4XIYA 4XPZA 2O8VA 3QYAA 5FWDA 2PBFA 4BQIA 3NV9A 2AHOA 1JQKA 3NEJA 4WZAE 4X92A 1W48A 1PN3A 1QB7A 2NSLA 2OY0A 4LF4B 2QYSA 2FLWA 2F9FA 3FHOA 5DGTA 5F52A 3WIUA 1JDBC 3N39C 4MRRA 5LCXA 5DISB 4W8HA 2GS9A 5DCWA 3IURA 4QFDA 2C9CA 2MSKA 2DLNA 1E1NA 1U2TA 2VYNA 1EVYA 1ODFA 3RB8A 5CIYA 4I6GA 5H9VA 4Y6SA 2PYDA 5GZ3A 4ZVUA 1FXWF 1OIVA 1XAHA 1TVCA 4MVCA 5EIOA 3L0DA 4W8GA 4LMRA 3WRXC 4GP6A 5HKLA 5FNZA 5LBIA 4LFAB 1FP2A 4Q1VA 5C1IA 5ESDA 3EGDA 4L9WA 5ALYA 4TSRA 2PUCA 4DOMA 3A1WA 1N2CA 3DZ8A 2JG3A 3W04A 2BIFA 3PX7A 4EABA 5DIZA 2YWRA 2BR3A 1NTRA 2VK4A 3EIXA 1ZUD1 4GQBA 4OHFA 3CPEA 6REQB 5LOVF 1LB1B 5LA6A 4XD2A 1GYPA 2CXHA 1C41A 2G8LA 2FSIA 3LF2A 4QICA 4ZEMA 5KYVA 5F64A 4MV1A 1R6VA 2V96A 4PZDA 5CHEA 4HN2A 5TPZD 4I66A 2B1QA 3MERA 3WNVA 4AO7A 3CVJA 1H05A 4YRDA 1TVEA 2A9QA 3PDUA 4HDAA 1EKXA 4A10A 3PHBE 4A0RA 3KB2A 4OHWA 1M72A 4NMWA 3I6MA 3E9EA 3NONA 4RD2A 4J1TA 4TXJA 3TO5A 3AEKA 3NXKA 1QKIA 4H7EA 1ZMXA 5I9IA 1RI1A 1AZTA 2NGRA 2O8EB 2HHHB 1SBHA 4CPDA 1EXWA 5DHTA 3PHHA 1VSBA 3NP7A 4D6XA 1VIYA 4BPRA 1ZQ1A 1JZSA 4M22A 1D6SA 2RIRA 3JPWA 2H0RA 2E4VA 2ZE6A 1QGDA 3O0TA 4MV4A 1MQAA 5BQ5A 3E2IA 2ZE5A 3TYXA 2I7XA 1EFUA 1KO7A 4D0GA 3WMWA 2XCRB 3U3RA 1WEHA 4XVRA 4PYRA 1A9ZA 1R6BX 1YQUA 3OQ1A 2NV2B 3DOHA 3O8OA 5TLSA 3CUUA 3DO6A 3NHMA 3SQLA 1BE8A 1CY8A 1WE2A 2WBLC 3UM9A 3VZDA 3W4KA 3W7BA 4MO9A 1E4OA 3ANLA 2OG2A 4Q4JB 3DA8A 1C9DB 2G7MC 3IP7A 2XUFA 5GADl 1GTVA 1UJMA 4PLCA 3IUBA 3VC2A 5JSQA 5HUJA 2BGNA 4DHEA 2C92A 4ZYUA 3MPOA 2Q6OA 3QLVA 3P9QA 1ZIXA 2IW3A 3W2EA 3V1YA 2YZNA 3FYTA 4O4LA 5LDGA 4C08A 1EBFA 4HDKB 2EL9A 1DQPA 1KBOA 3OUUA 3SS7X 2IXDA 1E2DA 1WLYA 4AQ7A 1BHO1 2PUFA 5BQOA 4B4OA 1XTVA 4MV6A 1SB8A 3BIOA 2RC6A 5DYIA 2VHUA 2YJGA 3WLQA 4A1FA 2VXOA 1NMZA 4ON9A 3AOGA 4MV8A 3CLKA 4FOTA 1D2NA 1S96A 2W6ZA 2IQIA 3EDMA 4L74A 4JI3B 3RUPA 3TSOA 4OTZA 1YU6A 1ZCFA 1RM4A 2VDRB 1M2NA 1NDQA 1MC4A 1U2QA 2YOGA 2AVNA 2XOKA 1AVTA 2G4CA 4R68A 3CX7A 5EZQA 3T94A 1XEAA 1JH8A 4IJKA 4M1EA 2QD3A 4NAVA 5ECGC 4AM8A 1ZFNA 4PLWA 1ZMRA 4JI0B 1JECA 3CZ9A 3M5PA 3NC0C 1F4VA 1QFMA 2FHPA 5KWIA 1G8KA 5EE9A 3GUYA 1E59A 3BA1A 4K6GA 3NOQA 4X0EA 4ZT7A 4OAOA 5IH3A 2YFQA 5FYQA 5BN3A 3V4OA 2VWPA 4KXYA 2YXPX 4FU0A 5EXXA 4CHGA 3U44B 2E89A 3V8NA 4LJAA 2ZUFA 1ZRMA 3DLPX 2F1IA 1OFGA 5CCDA 3U7HB 4L22A 2GFHA 1ZJ4A 4TMXA 4E1VA 5AVKA 3TXAA 4B35A 3GRFA 5HF6A 3W9UA 3R9XA 3VPHA 1JAHA 2YV1A 3NXSA 2W90A 4MIOA 2L2QA 3QNUA 4NJOA 4CMEA 1IN8A 4Q4AA 4E33A 5DI9A 2BFMA 1COWD 2ZI9A 1KK1A 1NHGA 1SCJA 4ZO7A 2VHVA 1SIWA 2D1RA 4KE6A 4U6SA 1Q15A 1UBUS 2C7GA 2ZIUB 4PN3A 4NDNE 5TX7A 4R2LA 3RRJA 1E2FA 3RBXA 1FDOA 1DVRA 4MGHA 3TLKA 3UXHA 2OQ2A 2QSZA 1EIZA 1TIKA 1TKRA 1YC2A 2G0AA 3K5WA 3T15A 1Y3DE 2OZLA 4TXNA 1QX3A 1VRVA 4HNAB 1HFKA 3UFXA 1WZNA 3M3DA 3ZVNA 2J4DA 4MTCA 5ILOA 3FPEA 4EB0A 2JJYA 3IB6A 2H1SA 4CL0A 3E3LA 1ZRHA 2QR5A 3QTTA 2W6JD 3EVDA 2QJFA 2CXNA 3RT7A 4A2PA 1A9XA 4AP9A 4G5OA 4XE5A 2OFOA 2IA5A 2XEDA 4PANA 4TT3D 2G9NA 4FR0A 5JS6A 3G2NA 3HZRA 4LJLA 1NSFA 2QTFA 1WW8A 2C0PA 2YS6A 1Q83A 3QV2A 2XTMA 2OWEA 2IYFA 1H94A 1F12A 4RIFA 2IS2A 3L79A 3ROTA 4JL6A 4NU8X 1AHPA 1B8OA 4GEGA 1PO7A 1A95A 3OFVA 1JW9B 3ETCA 4G1BA 1DEAA 3NATA 4YRMA 1RWKA 3FCOA 4YQEA 4H1UA 1WU7A 4HXFB 3K4QA 3T7JA 1WETA 2NUAA 2C4TA 2V6IA 4CEJA 1L4EA 4MV7A 5KKCA 4K3VA 3I52A 3F1KA 3CLHA 3ITEA 2E18A 4ITRC 2JBAA 3RKSA 3GBPA 1WZUA 2QPLA 4B7UA 3ESYA 1NC1A 4DTCA 3SICE 1DI0A 1W0JA 2XB6A 1JHRA 2WUWE 3C7DB 1KE1A 3KSAC 2P7IA 3REQA 3ONEA 3HKEA 5D2CA 5DTRA 4B3CA 1K92A 1WMDA 6PFKA 3DM5A 5LUBA 4JUFA 4LY6A 1QIKA 2RIPA 3FHLA 4E09A 2IE0A 2EKPA 3TFQA 1T1GA 4WXEA 4G25A 1HZZA 4HGYA 4JITA 13PKA 4G5FA 5ELMA 2BMWA 4NNOA 3VPXA 1RJFA 1II8A 2FWRA 3RTBA 4AZ0B 3GLIA 1CZLA 2I2DA 1ACMA 2J5XA 4WN3A 4EVRA 1IDN1 2WJGA 4DJAA 1XALA 1K98A 1CQZA 2F1RA 4NY1A 3QTBA 1WUYA 3HCRA 3O4HA 3GFGA 4UHJA 3VR3D 2BFPA 2ZZKA 3DMRA 4AF7A 2QVXX 1RWPA 2D54A 5D8DA 1L5HB 1E9RA 1YTLA 2C83A 1JZTA 4KC0A 1FFAA 4LTNA 2EJTA 4KOEC 3STXA 2BDEA 3I9V1 1D4FA 3ZIAA 2VP6A 2Q1WA 2A1TS 4TLDA 1Q3HA 5AKXA 7MDHA 3DYVA 5E4JA 1KVQA 1TUEA 3V1KA 3K70C 1NMQA 3ZIUA 1IEXA 1VQ1A 3FXAA 3K96A 1YZQA 2Z56A 3C3KA 3WLMA 5CFQA 5AVQA 2DHEA 1J0BA 4DDWA 2PUEA 5HGJA 3SYTA 2QTBA 4MI3A 3IXLA 4G0OA 3D2LA 3EZ2A 2HA4A 5LPNA 4JN6B 4HS4A 3DE6X 2YIMA 3HA3A 3KWMA 4OHXA 4GOXA 4K2HA 1P73A 1VL6A 4W5RA 5MGNA 3KYDA 4X1KA 1KDVA 3COPA 2XCLA 1RHRA 1B4DA 2QLJA 3ICWA 1QNFA 1IZZA 3ZDFA 1QAMA 4FLMA 3JZAA 5B53A 2YHIA 4FS8A 3UJ6A 2CBZA 2XB8A 4LRTB 4DY6A 5HDBB 4QYWA 3LSYA 3LQRA 3T7TA 2I2CA 1J2UA 1Q3KA 5AXBA 4RDHA 4DGQA 4X7RA 2A57A 3QELB 5A9TA 3R1IA 2EWWA 4FOPA 4JI4B 4I4IA 4BVLA 2FKAA 4Y2XA 1IZYA 4Y2YA 3QEOA 5BQPA 2OFFA 3JQ9A 3B1VA 1JLHA 1VE5A 1JLRA 5E9QA 4KQIA 1AXGA 2G5CA 1SWVA 1WUKS 4HN9A 4OIFA 1PQWA 2CFOA 4GMGA 2WIFA 1USWA 3A6EA 3C3AA 3HDQA 4GPIB 3STYA 3DV0A 5DGHA 3KYIB 5CG1A 1Y3BE 2WYUA 3FJOA 1CF2O 2XW6A 1WDLA 3VSCA 4DSOA 4CT0A 3LSTA 5CM9C 5AHWA 2FR8A 4G01B 4Q1DA 1C1DA 2AF3C 2GSWA 3B78A 4I2NA 3B5IA 4K7JA 3FHTA 1VSVA 2C03A 2P3LA 4BZWA 3WP0A 3KX2A 4NE2A 4U7FA 4IIXA 1SA0A 3D4PA 2WT9A 2XDYA 5LBUA 4BO8A 4FFBA 4RPKA 1S2NA 2IF2A 4YRQA 4BP1A 4IUCS 4L6IA 4BWVA 5CFPA 1LPAB 1OQAA 1MO2A 2QN1A 3SJAA 3HB9A 2W22A 1N5MA 1DLJA 2AF4C 3HBLA 4BMZA 1DCTA 3FUTA 4DA8A 2FN8A 2KS6A 1FNMA 1UM9B 2PJUA 4HYYA 4CMIB 4XB2A 1M2JA 2NNLD 2CVHA 1UWKA 4YJFB 3F5FA 3Q41A 1KXZA 4HGRA 2DFPA 2XWBF 3OHSX 3Q2OA 4P3KA 2JI7A 3V1MA 1W4RA 3WJ7A 1C50A 3S2GA 4DBLE 3AI3A 4D96A 2A0XA 2A9JA 4AX4A 1T91A 4WD3A 1J8YF 1YIDA 2NXWA 1W30A 4K9MA 2CDBA 2JLZA 3KHTA 1A1SA 3O3CA 3HFSA 1RE1A 4YGXB 1KFEB 5HRCA 4JL8A 1YRLA 2WYHA 3KEMA 3O8LA 4ITUA 1NBME 1QJ4A 2CWWA 3LXUX 4RJKA 1ZP6A 1IHUA 2H52A 1DBQA 1PU2A 2YYAA 5CT5A 3O47A 1B0AA 1RBMA 2G1AA 2QIOA 3A6DA 3GG2A 5CDGA 1D7AA 4URFA 4Q05A 3DZDA 4XLTA 4JQZA 1XHFA 3PRJA 4G65A 2ZRIA 4Z6KA 1L6RA 2GERA 1DV2A 1A9QA 2PGIA 1N9ZA 1Y7IA 3FNIA 4RV5A 3T5PA 1HPLA 1ZVJA 4QULA 1NW4A 4UE2A 2I4LA 5ELLA 4DBLC 4Q12A 3GEHA 3S2YA 1YQQA 1E92A 4NESA 1NW9B 4P86A 1W0KA 4ENPA 4EW1A 1DELA 4WPGA 2R1VA 4IRMA 1I6LA 1VHQA 1X70A 1JIQA 3QE4A 3OCUA 2HL6A 2IEDA 5AHOA 5K4AA 1PWEA 2V4ZA 4KRXA 5M29A 2PGLA 5BV8A 3PA8A 2XVZA 1YK0A 4R8MA 4CLXA 2I4OA 4WSOA 4F2WA 3ME5A 1JLLA 2G88A 1QC5B 3H11A 3IHLA 4QYSA 4ZCMA 1DIAA 1EINA 4MQEB 1DZIA 4HDOB 1BOOA 1N92A 2WWGA 3I4FA 1EXNA 4C2TA 4G5HA 4KTVE 2IV3A 3WHKA 2WTAA 1AKNA 3RC9A 3WZMA 5IABA 2B8EA 1U0HC 4KLRA 5FUXA 4BLOA 1P3JA 1U0LA 3DKIA 1OH8A 1ONSA 1C30A 2DHQA 2P3OA 5SICE 2N42A 2GAJA 2FMTA 2RGRA 1DKQA 3MELA 3RTAA 3OQBA 1EFVA 1DJLA 3GJ0A 1A2KC 2HV9A 3HABA 4IDNA 4V0RA 3WBKA 4MCAA 4P6VF 2XMCA 4L4YA 2FZWA 2A67A 2CNBA 2JIBA 1QKKA 1WCYA 2WJ3A 2B1IA 2ZRPA 3QE0A 4JBNA 3UXEA 4F12A 1E7SA 2QL5A 1W47A 4I2VA 1PGQA 1ZL2A 3PUZA 4WZBE 4BJ6A 3VR6H 1JG4A 1M3SA 1OMOA 1YS4A 3RNLA 5TY0A 2YHUA 1Z0IA 3OLZA 4OGKA 2P4UA 5CVTA 3JR7A 2FY8A 4ACBA 1CIPA 2NQTA 1SBCA 4YUWA 4DZTA 2ZRJA 4MYCA 1W93A 2W9XA 2C61A 3LKDA 3EZ6A 5ABPA 5BP7A 2AW5A 2IHUA 3LHIA 1QSGA 5IBRA 1N57A 4AQDA 4EO4A 2PWPA 3PWTA 5KWSA 2J3IA 5C46F 5EEGA 1Z3IX 2CMHA 2ILTA 5EZSA 3R7LA 4DA6A 2VDWB 4ER6A 4RIGA 4J3NA 5EHGA 1E5TA 1G5IA 2RGNA 3L8CA 3NW9A 3PCTA 3C4QA 4C0HA 3JRXA 5C5DA 5DLQC 1FP4B 2IZ7A 2I9PA 3IP9A 2CUTA 4DLBA 8ADHA 4FI3C 2CHQA 1BWPA 1P1IA 4LK2A 3QMPA 4XPIA 4OQ4A 2FFJA 2O0JA 2B0CA 2GCNA 3RKRA 5KNDD 4R84A 1RLOA 4WNAA 4ARIA 1P1CA 4ZV9A 2CW5A 2YS7A 3IIIA 4R1OA 3I5MA 3SHFA 2VAVA 5B2ZA 2WFZA 2W83A 4M8LA 3IUQA 3RU7A 2XOKD 4JQSA 4CNBA 5C9ZA 4FZVA 3QVOA 1JDVA 2AG6A 5BWBA 1NI3A 3TOZA 1JEJA 3GCGA 3LQKA 1SKUA 4FFDA 4N6OA 4Q9HA 5ADHA 2FDCA 4JYAB 3A6ZA 1KO8A 4N82A 2BR5A 3HCPA 4BZXA 3OI7A 1Q1BA 2FG5A 2P2NA 4MUKA 5BR1A 4B4WA 2QHXA 4HTFB 2IUFA 2G5PA 3R0VA 3TJZA 3D5EA 3BF7A 5BWLA 1J5PA 3O3OB 4J4HA 4JI1B 4A73A 2BEWB 1G6Q1 3LO5A 2C4HA 1H65A 2AA3A 4BFYA 2XQIA 4P82A 2VSXA 3NWPA 2OKGA 1KP2A 2HU5A 4AXBA 1AS2A 1HG1A 5KMGA 3KEGA 1DB3A 2MJLA 4P7BA 2D5IA 1YBHA 3ENVA 4FMBB 2HEGA 1M2OA 2GBFA 1W5TA 2A5LA 2IEBA 4G4GA 2Z83A 3ICCA 4Y6RA 10MHA 1QH8A 2PMCA 2ADFA 2B1RA 2EZ4A 4GW3A 5A3VA 1K5DA 2HN9A 1IUOA 1MT3A 1VHWA 4GMDA 4OGFA 4RF3A 4XWKA 4CN8A 1AG9A 2QPOA 2HQOA 5A62A 1VMDA 3PDCA 1ZW6A 4IJ5A 2Z9DA 3RBAA 4D79A 1J5EB 1GPLA 1C7FA 1U5BA 3QF4B 4CG3A 4A0SA 1FSGA 3PV0A 4DF3A 2PX8A 4LOHA 3OKFA 5L8VA 1H2ZA 4HQRA 4BMSA 4C9BA 1D6MA 2WFLA 1QQ7A 2CMFA 1NMYA 3IBTA 3LC7O 2ZUTA 3X3HA 2PVPA 2O7NA 3IJPA 3JW8A 5AVJA 3PRYA 1LNZA 2P9QA 4K28A 4W1SA 5TQ0B 5EXPA 5CT4A 4IDOA 1U0GA 1G20A 1RXWA 2E85A 3SSOA 3EA0A 1JQ5A 4OGGA 3FGOA 1BDIA 4HN4B 1UPUA 1JJIA 2IPOA 3ZQ4A 3CUSA 2IPXA 4DILA 4EG4A 4OJKA 1AE1A 3KVYA 3IPAA 5DSTA 3TB6A 2VDWA 4AMBA 3ZUPA 2VPWA 3B1FA 5ALDA 2JZOA 3AYXB 521PA 5IVDA 3R6GA 4AS2A 4UQLA 5TF4A 4WINA 5TQJA 1CULC 2X5JO 1Z4JA 1Q0QA 2ATVA 1LNSA 5HJEA 1KDOA 3AEKB 4NBSA 5CA1A 4MIEA 3S3TA 3GMSA 1VI6A 3QI7A 1KMQA 2ZIVB 1CE8A 1RLMA 2GK6A 1PYDA 4PG7A 4HATA 3W8RA 3ZWDA 2VUIB 4F3RA 2HEIA 1O94D 3TG8A 1OX5A 1Z13A 1ADJA 1ZNWA 2DUJA 3FUCA 5DMXA 4BNIA 5LLTA 1ESDA 4CWAA 1LPSA 1GPAA 1UXGA 2CVPA 5JNRA 4OLFA 1QGUB 4S0ZA 3T3EA 1N7GA 3UC9A 2B83A 4L15A 1QO7A 2VRCA 2BBOA 1O5TA 3QFRA 3VC7A 1Q0TA 1YAJA 4FC6A 2FW7A 4ZIRB 3E0QA 3JQQA 4F46A 3CLSD 2JDID 2ERYA 2TMYA 3KOOA 4MH0R 5BVHA 1JQEA 2YBDA 2FUEA 2QN7A 3HNPA 1U2DC 3KLOA 4AO6A 3EXEB 3S2SA 4NBUA 4TRNA 5FCDA 3N3AC 4MVJF 4X00A 3D6NB 1WXDA 3SF8A 1ZQ9A 2BCJQ 3D4BA 3FBWA 1A8PA 4WE3A 3WK9A 4RTRA 4XTRA 1RVV1 1G21B 2NXJA 1W4ZA 1XD2B 3L0SA 4PX9A 2ZBDA 3JQAB 5KX5F 1P9RA 2QMOA 1UC8A 1VGQA 4Y67A 9GPBA 4C89A 4E5VA 3CNNA 1HEIA 2CLLB 1J2YA 3ES9A 3UQYS 1JWAB 3PJRA 1IN5A 1J8QA 1WQ4A 4GYYA 2NT4A 4IWYA 2VQSA 3TVYA 2PPVA 1AN9A 3U0VA 2PKCA 1OI3A 2VHZA 4CNQA 4YJ2A 2Q1YA 3IOEA 1J8DA 4EA8A 3STUA 3T54A 5AM2A 2K7ZA 4JP5A 5BQXA 4JVNA 4R4JA 3C3WA 4GQAA 5GZ1A 2ZRMA 1DEXA 1KRWA 4RH1A 4RKRA 2J3QA 3CZ4A 2ZYVX 4EB6B 1YZLA 3H2JA 5FBWB 1J7JA 3QSYA 4PCAA 1X8JA 3H2KA 2J0EA 2X4GA 2FSHA 3D64A 4R83A 3R3YA 1E9VA 5BSUA 3AUYA 3JYPA 4LIPD 3SDBA 1CB0A 1BFUA 1U0NA 2HA3A 4LI3X 4N0EA 3JYOA 1KARA 4M54A 5KYXA 4KXLA 4YAOA 1S7GA 3U37A 3VXKA 3PNVA 4NENA 1HZZC 1KY2A 1MJFA 2GPSA 1TMKA 1ZD8A 4FBGA 4HTFA 4F0JA 5JROA 4ZALA 4UTZA 4OATA 1JFFB 3OPYB 1DRJA 2FW9A 5FEMA 3EEQA 4I1RA 5K8TA 1V7ZA 3OFND 3GU3A 3FOFC 1INLA 3HYTA 4BV3A 1Q19A 3PBKA 1M2GA 1X39A 1F2UA 3OE1A 3LI2A 4X85A 2ECOA 1NULA 4DQDA 4D4HA 2RAPA 3F3SA 1WQ1R 2ZWIA 4KQ9A 5KQPA 1S5PA 4N12A 4N7BA 5CA0B 2RBEA 3Q3VA 3ZBUA 4W7IA 3MW8A 2B1JA 3IVAA 1QVWA 4LYHA 4KREA 1MN6A 1V3UA 1MJGM 4PTLA 1W36D 2GBCA 4IDEA 4HB2A 4B8YA 2LUOA 4RDXA 2QKYA 4I1PA 4B46A 4B1FA 2NN3C 3DWIA 3LJKA 4IIJB 1JRLA 4TSFD 4E14A 621PA 3GH3A 3GO4A 3INRA 1UOOA 2IRWA 1R6UA 4MUHA 4BC1A 5KNBA 4N7MA 3UB2A 2J31A 5A4AA 3EFEA 3K5HA 4R40A 3O3MB 4ALMA 1KDYA 3TD9A 3EC2A 4JWKA 3R2JA 1WV0A 4UHKA 1C8KA 4JQYA 1T8TA 5EQDA 1DV1A 2BAGA 4C20A 4QDJA 2A9OA 1LFAA 5CXXA 1M2HA 8GPBA 4OHZA 2FW8A 2FN3A 3WZLA 3BD8A 4UOZA 3CZ5A 5FWNA 5LNK1 1T24A 1PIWA 4F9GA 2Z2KA 2OECA 2K7FA 1U7XA 3PIIA 4Z4HA 1UZNA 2Z4TA 3DNPA 3FVQA 3VKWA 1FW6A 5GQSA 4IIBA 2XYQA 2DPMA 3WGYA 4ZCTA 3NIGB 4BO4A 2IVZA 3MJVA 1GFWA 1F5NA 1P9LA 3BFKA 3CKLA 3WOHA 2J67A 4F6CA 2VAPA 4RD6A 1L5NA 1QRSA 4G3XA 5KAPA 4WW0A 3HMQA 1I30A 3K2BA 3LV8A 2AD1A 3LZ6A 4CL3A 2PH1A 1RQLA 4L0MA 4LRYA 3CH5A 1DC5A 3MVEA 1DRUA 4UEJA 2AG8A 4B71A 4L7VA 4X1OA 1GCIA 3UEOA 3NRBA 2PAAA 4OQDA 3MUOA 2BELA 1E2MA 4KRGA 3HHEA 4HD8A 3R75A 4DIFA 3KL2A 3N6XA 2ZIZA 3DMPA 2XT6A 3PFFA 2DEUA 1S8AA 1JKFA 5GIPE 3LTNC 3QKSB 4LE0A 2GAAA 4WZAA 3REQB 1TU4A 4QJ3A 1GOTA 3NIWA 3AETA 1UEIA 1JFFA 3PPWA 5GY7A 4FFSA 3SC3A 1T3LA 1Y4SA 2F8MA 1LSSA 4WVFA 1TMOA 3DDUA 3L7DA 3OQVA 2WT8A 3M6LA 4WK6A 5EKUA 1FS5A 1OFIA 5JZ9A 3VKHA 3G2JA 4OQQA 3D2CA 1XDGA 3VR2D 3PNSA 3TPCA 2Y2UA 3TTVA 3T7AA 2GGSA 3L92A 5GGXA 4GXRA 5C8VA 4IKOA 5AP9A 1NAHA 1NY5A 2RJOA 4H7HA 4ZVMA 5JS8A 2XRZA 2EF0A 1J00A 2NO4A 2VSNA 3I6ZA 4IZIA 2UXBB 2QXTA 3BGOS 3LHSA 1ZGZA 3K0FB 3DBLB 2H06A 4QOSA 3KJXA 3LT1A 3PUIA 3X1ZA 3ER9A 2EGGA 2Q1TA 3FTFA 3JALA 4F8JA 5LQRA 4D2IA 2GVZC 2NYRA 1WTAA 2VQ6A 4MR9B 4XWWA 2CT8A 2NVWA 3VISA 2L17A 3SBXA 1YKSA 2CLDX 1X7DA 3IAUA 2VRCD 2Z1MA 3WTCA 3DWGA 2YQ5A 4QXQA 2O2DA 4PICA 4X90A 2I80A 3ND9A 4CV1A 4D0NA 2VHYA 1HH4A 4HUQB 2DU8A 1PFGA 1FFHA 4A7PA 1RIFA 2JCBA 1RMQA 2OO5A 2AS0A 4RENA 4LV8B 4P4GA 1E3JA 3QM1A 2XUIA 3A1VA 4BVGA 1SEPA 2IEGA 3ECAA 1OC4A 3V55A 5THXA 5BN3B 1QUEA 4DXAA 4S1OA 1P5JA 4J1TC 2FUKA 2WM2A 3WRYA 4EDHA 1N6IA 3H2IA 3FAZA 4ITVA 1YIAA 1N9GA 5CFNA 4GOKA 3CEPB 2ORIA 3EUEA 3QBDA 2GZHA 3BCRA 3TIFA 4W8OA 3RAGA 5ICSA 1KEUA 3L6CA 1YFJA 3VNUA 2NZWA 1VC2A 4ZGWA 2B21A 3REGA 3VOBA 4FEYA 4KK4A 3I9NA 1PGJA 5EP3A 2V7QA 1UBEA 3HS3A 4I5DA 3UMGA 5IWCA 3ICQB 2C9MA 1Z83A 4PBSA 4MAAA 2BEKA 5EJ7A 5HDQA 2BL4A 1S2LA 5I9NA 3IP3A 2GWHA 1QYWA 3ODPA 4NNJA 1QCYA 4KUEA 4RK1A 1M0EA 1WKVA 4OK3A 1L1QA 1H0RA 2GNAA 3OKCA 3OM8A 4BX2A 4IHJF 1V8OA 4JKIA 5GJWC 4NHEA 3KQLA 4QECA 4FW8A 1FCJA 4RD0A 1P19A 1P18A 1NT4A 3QVGA 4MHSA 2VUHB 1JVBA 1GV0A 2F43A 2QMEA 2K4MA 4LY9A 3DW1X 3O91A 3RODA 1PR3A 2P6NA 1CK4A 3A4MA 2DH6A 3BQNB 1JA1A 1E0KA 3N2NA 3O8DA 1QLHA 2VC2B 4KODA 3FW1A 1AF7A 1JB1A 1DS6A 3E5NA 3GR6A 1T2UA 3QX8A 4JH0A 2WAYA 4H7KA 2IX9A 3HLKA 2YWHA 1Z5ZA 4N6GA 1U2GA 1SPBS 1P0CA 3S8MA 1NATA 3BT7A 1D6JA 1Y4UA 2WLTA 3OFNA 4GGMX 4J0DA 3ICEA 1T4MA 3KB6A 1XFAA 1TCAA 3F7NA 1YZHA 1XTTA 1Z39A 1HTWA 1QGYA 2IPAB 4GE0A 2Q21A 4WDRA 1AZWA 5EHIA 4RSHA 4B75A 1IONA 2JLAA 3K9GA 1EHIA 2Z08A 1SFRA 3QXJA 2HF9A 4J03A 5JCOA 1KFKB 2IXEA 1DAPA 2H0AA 4KL8S 4QC2A 1DKRA 3CRRA 5EFOA 3UKDA 3N05A 1DX9A 2VDKB 4KO4S 4E12A 1BZYA 2PH3A 4TSFA 3UT6A 2R1ZA 4RYLA 1RSZA 3EZYA 1V3VA 1XO1A 1A82A 4N8DA 2D3TA 3GLHA 2WR8A 5BUZA 2IH2A 1BROA 3ZY6A 1SUAA 2O3UA 4DGSA 1Q74A 4ZGBA 2RDMA 1DHRA 5J40A 3SKXA 1K6EA 2ZJ4A 2AR0A 2P2ZA 5THKA 1T0BA 2MU1A 3GLRA 1YACA 3Q6MA 1EESA 4AJ1A 3KTFA 5L53A 3UJ9A 1Z3CA 4X44A 5K45A 1V26A 3ZD6A 4N7RA 1RAHA 1E9CA 1N7JA 2IW1A 4PE5B 4WZAB 5BMVA 5C5IA 4Y6LA 5F33A 5B3AA 3ZG6A 4ENRA 2FTKE 1ISSA 1ENPA 1YJ5A 4DDVA 1QQ6A 3EYAA 3MWLA 2E48A 2OYRA 1V16A 1QH9A 2OQVA 3ZE1B 1RC0A 1B16A 2RC5A 4MIYA 4NWIA 3Q0EA 2J5BA 2ACKA 3ZHTA 1E9FA 4RNCA 5CXQA 3M4YA 1ZVMA 4IDGA 4OBWA 3VDNB 2DB3A 1XCGB 4JSYA 1UAGA 1BYIA 4KR3A 3VSAA 4R2MA 2UYOA 4N76A 2E4AA 2YWJA 3FD8A 1ZEMA 5AM4A 2HK6A 5NLLA 1XPUA 1KI1A 4BKMA 2GM3A 2A9VA 1EU1A 2Y93A 3EXIA 1T1EA 4JASB 3K0KA 4G1FA 5AJVB 3KSUA 5EJMA 3WIDA 1RBZA 3ZHVA 4D3ZA 1XEXA 2XDAA 3EXHB 4FSXA 3KQVA 3T0IA 3BWXA 5FPYA 1EFPA 2R2AA 2VYQA 4M0EA 1KP9A 3QEJA 1BE0A 2P2YA 3N5CA 4WLVA 3HGMA 3INNA 5IKPA 4RLFA 5CRIA 5KUTA 3S8EA 3ER6A 4YAEA 1UZMA 1RW4A 3LPAA 4KIFA 5JC8A 3AM5A 2R5FA 5CW1A 1J0AA 2PSHA 4FGUA 4UU1A 3HCEA 1QYVA 5ALSA 3G79A 5KTTA 2WM3A 1V9CA 1Z56C 1AKRA 2ATCA 1U9JA 3ZKWA 4MVJA 4RAOA 1P2GA 2XUDA 1MA0A 1M2VB 2OV1A 4D8XA 4UU7A 1II8B 1QHEA 2JIZA 5JPCA 3RPEA 2ANCA 2PS9A 1A8IA 3NWBA 3VO9A 2WWXA 3TOVA 4E46A 1UQUA 2CFSA 1ZM9A 2CJFA 5D51S 2RHJA 3QEMB 1T3TA 1ZH6A 4TKMA 3DEFA 4BN0A 4KMMA 4F06A 3IDAA 3IE1A 2Y3IA 3OTIA 1KL7A 1KY5A 3C3XA 3ZW9A 1ND5A 1OIWA 2ILVA 2W4IA 3ECCA 3V4FA 2QSYA 1LDGA 1FA9A 3HB1A 3TR0A 1IPEA 1PNVA 2E6KA 4MCJA 3KE8A 1FTNA 1KAEA 2BFEB 3AF2A 2RJ3A 4QJBA 4DV0B 4Q7JB 1IM5A 1K08A 4US2R 4H6XA 3SSNA 3LKBA 3C1AA 2Y0EA 2HF8A 2YINC 2PU7A 3UGTA 1CR4A 2Q3FA 4RC9A 1M8KA 2RONA 3NNNA 1QIHA 5C80A 4D81A 4OP1A 2A5DA 4H27A 5IJWA 2I6SA 3BBLA 3BWEA 2NUTB 3QKRB 1PTKA 1FS4A 2WFAA 5IM4F 2QTTA 4X8OA 4DIMA 4NJEA 5LXTA 2C9YA 4H1TA 4E5KA 2CHGA 1UXOA 2GRJA 3G2KA 1A7KA 3RJZA 3H5AA 4EYOA 1QV6A 1S02A 4M76B 2ZYGA 5E4FA 3LBIA 4EKYA 2P2GA 2F7SA 2XV1A 1O9BA 1NUPA 4ZVVA 2YMLA 3NS7A 3OCZA 3RWOA 2J6CA 5IYZB 1DTEA 4C30A 2HO4A 3JVUA 2FVXA 4ZHSA 1L0BA 4JBXA 1GD1O 4KP7A 3O5AA 1GLGA 1W35A 4KDCA 3UG7A 4UOEA 2CSUA 4OSEA 2UVDA 4YCSA 5IWAB 1Z6XA 5DTMA 5EXEA 5KWEA 3CRQA 1UAYA 2ONKA 3M4XA 4AN1A 1NLUA 2FZGA 3OECA 3QSGA 3TW0A 5JRZA 2VL7A 3SEAA 3I1JA 4DWOA 2WLSA 3KSBC 1PEAA 5GZ6A 4K46A 3BH6A 3O4GA 3Q9NA 4NU6A 1ONNA 4GMXA 4JCOA 1G2OA 4I99A 4N0MA 3DVQX 5JAPA 1MPXA 3CUEF 2HADA 2FQWA 3K8ZA 1SVOA 2LVBA 3OQIB 5ARCA 1PF7E 1NV8A 1ZKDA 3GRZA 4OCZA 3UMCA 3DAFA 1O0BA 2PQ2A 1A71A 4D02A 4GLOA 1NKVA 4LDPA 3VPGA 5EE1A 2XMPA 4UBJA 3FTEA 1ZOLA 4KQ1A 1Z36A 3EZXA 4LHWA 3Q0IA 4B4KA 4DYDA 1HOTA 4TS3A 5CJ2A 1CF9A 1J56A 4OGWA 2I7DA 5C4GB 1AM4D 4B7AA 1LDMA 3AW9A 3AEZA 3BXPA 3G2QA 3GZNA 4QYMA 1OB2A 1G20B 3CCFA 3AUSA 3C97A 5BW4A 3JWHA 2C1XA 3SMQA 3PC6A 1U8AA 3A2NA 3KKQA 4BMCA 1MTOA 4B73A 4CTNA 1POWA 1W87A 2XUZA 5BV0A 2VP4A 2A8YA 1M2EA 1L5QA 4YONB 1K7FB 2GD0A 1ND6A 3TW4A 4DV7B 1WHTB 1AGRA 3EOZA 4FMPA 1CV2A 2CEKA 3LA8A 3B5EA 3NDRA 5C3MA 4EL0A 3K9WA 5CA1B 3F3YA 3BREA 1TD1A 1RC1A 1Y42X 3W3AD 1ODJA 5JJ5A 1JG6A 3M1IA 4BNTA 4ZCRA 2EIXA 2VVTA 3MGGA 5JMTA 1DKOA 1CUWA 2WF8A 1GVHA 4CF4A 3KCQA 1YTUA 1IVSA 1QGED 4HLQB 4EFLA 1OROA 4MKFA 2LPMA 1GUAA 4BTLA 3ZJUA 1GAWA 4OJQA 1MHTA 1B8VA 1ZK0A 3KR2A 5B1HA 1T13A 5ALLA 2IZ0A 5K3CA 3NASA 2RGUA 1KYVA 1L1RA 4B40A 4DG9A 1G9TA 1Q1NA 2AE1A 2P9BA 3DE4X 1OLXA 2WNIA 4UTXA 2FZ4A 2HSEA 1AS0A 3BZWA 5H4HA 2NSYA 4Q15A 3P19A 4HDNB 2W4QA 4JCCA 2FZKA 2J0SA 4O2AB 3B1WA 2C4NA 1I1HA 2M1ZA 3GCXA 3CPHA 1P3DA 4CU5A 5M7EA 3AFNA 1JL3A 4N18A 2R4TA 4LV5B 4ES6A 3K5PA 2WHQA 1Y37A 2OOKA 3DZCA 3ZWQA 3C41J 3WKDA 5JIBA 4CLOB 3NHFA 4BATA 4D56A 4OM7A 1WHSA 4L0CA 4ZVOA 2IZ6A 4JVLA 4PC7A 4Z2AA 4RTLA 2B37A 1MO5A 4QUKA 1VBMA 5J23A 1GDTA 4LSZA 4MPRA 4DNPA 4F4UA 3QYJA 2J6IA 3Q5DA 4MWOA 5AVTA 4PGHA 5KSOA 4GF5A 1POXA 1ST2A 2FP4B 4UULA 4NJMB 2YNMC 1KJYA 2FQXA 4DV6B 4X7BA 4ZC1A 2B3TA 4MWDA 5K51A 2PKRA 3ILYA 4LOAA 3SYKA 4B82A 4MO2A 3CG0A 1BXGA 3DKPA 3GAFA 3MZ0A 3KK0A 1FNNA 3S1AA 1HQKA 2W4MA 2XKKA 3QEAZ 2W2QA 1T0PA 4BO0A 4Z1MD 3FE2A 4IGIA 1BD3A 2P5SA 2E5WA 1CXZA 2Y4OA 3P1JA 2R2GA 4Y1RB 4NX2A 4GVXA 1A8SA 4YREA 2C9BA 3FUVA 4EG1A 4XEHA 1SXJA 1YBFA 4P4SA 3RYIA 1Z5PA 1WOYA 2WWIA 5K8LA 1NRIA 1U28A 4HNUA 4B76A 1WUTA 1R0CA 2P4EA 3LECA 3OTGA 1J5XA 1ISPA 3EN0A 2OAQ1 1JHZA 3D81A 3ISTA 1XMVA 3VHRA 3W8DA 2HV8A 1X7WA 1FFXB 3VMMA 1NXOA 2BJWA 4PAOA 4AS1A 1DGQA 1T4DA 5CT6A 1PDOA 4RLHA 4H7PA 4TKLA 2FSGA 2IKSA 3GIWA 3EA4A 2YJ5A 1Y1QA 3E82A 4ER0A 4QDOA 4BTVA 3TSAA 1Y3AA 1KTVA 3VX4A 1G8HA 1N2JA 4L8GA 3QWHA 2D2FA 4JXXA 1LK7A 1FQJA 2B9EA 3NHPA 2AFIA 3BMOA 1QF9A 4LBWA 3BFXA 2GKOA 3NHWA 1RAFA 2AFHB 4A6DA 721PA 1SKMA 5IK2A 2RHMA 2C4MA 1WXXA 3A9UA 4Q9KA 4LC0A 4OM8A 4KV9A 5DHAA 1X7GA 1THZA 4BNYA 4BGDA 1XA4A 2Q6IA 3M33A 3O75A 1FUEA 2DTXA 2R97A 3C6KA 4O59O 2P90A 5BNTA 4NH0A 1K7XB 4L9RA 2XB4A 4YJGA 5DU2A 4MV9A 4Q7QA 1E6EA 4G9GA 4AVYA 3EZNA 5PGMA 3UJCA 4PM4A 3P2OA 4RPCA 1SZPA 3L9XA 4NBNA 5J2TA 1RKVA 3KQPA 4AL4A 3P0JA 3IEXA 2QNBA 4M4SA 1VDZA 2XGGA 4NP6A 3UV6A 3EVBA 1L7NA 2FE4A 3OZSA 2ETXA 1UPTA 3LOPA 1F1BA 2MHCA 2WNSA 4FWBA 3OO1A 1E1YA 4MWZA 5LQKA 4LY0A 4XGNA 2WSSD 5C0OE 3ZXYA 4QU0A 3N8IA 3IIJA 3DEZA 4HZUB 5BSTA 5BVGB 3EUAA 5JXWA 3Q7IA 3R9XB 1WY5A 4I8DA 2PH7A 3O38A 1OYVA 3QVXA 2V3WA 2PBZA 3O6VA 5FTMA 3UAOA 5BOSB 1VMIA 4J76A 2G9VA 4CKBA 2QTVB 3NGLA 1R0ZA 5B2FA 2C0QA 2WINI 3CNHA 4MGKR 1MB0A 4NABA 3WLAA 1FUUA 3D7MA 5CB4B 1NONA 1W85B 1A9OA 3CWCA 2PL3A 4E70A 3FDIA 4LXHA 3PA6A 3QU4A 5C37A 3H9QA 1IG0A 2P5YA 4KO8A 3AP2A 3D54D 4PX5A 4Y7DA 4H3SA 3SZGA 4IIJF 2C2KA 3V42A 3QE9Y 3ELYA 3MJRA 1M73E 4JX9A 3P9KA 3HN2A 2ZJOA 4K6KA 4UPDA 3RANA 2EKDA 1CFZA 4L75A 2HY7A 1NI4B 2C96A 2ZRCA 1J1ZA 2QI9F 4MS4A 2BN4A 3A6LA 3AW8A 5MGBA 3NYWA 5EHZA 4UHCA 2GKGA 3OEWA 2ZAYA 1QH1A 2A9PA 1NQVA 2IY8A 3A6FA 3EARA 4I5IA 1SCUB 1OB5A 1G60A 2FV8A 2X4DA 2ZJ5A 4KBGA 3FTDA 1Y98A 4CLOA 2C8VA 3IOYA 3GLQA 3UXMA 2KI5A 2R5WA 2CF6A 3L8GA 5E9AA 3U7QA 3DZGA 4YP0A 4DSNA 5GTDA 1F0PA 1GPH1 3LRPA 2A0WA 1U63A 2H2HA 2PFGA 4K88A 1Z7WA 3BK2A 3STVA 4MS3B 3IPYA 5KSZA 2BHTA 3U3JA 1YI1A 4BVHA 5LD2B 1QONA 1K8QA 3GGPA 4HDMA 5DM0A 1HETA 1FTGA 3F67A 3E3NA 3THXB 1F5SA 2GBLA 2JFFA 3DFZA 1KJ8A 5E0KB 2FH5B 3U0BA 4GWKA 3WDMA 1JUDA 1EUYA 3ELBA 1N6NA 2IIBA 3HUDA 2CXRA 3DAGA 3EGDB 2B69A 3HP4A 1VLMA 3NAGA 4PXAA 3DR3A 1UDAA 4JL5A 4OL9A 2FX3A 4WZBA 3SP1A 1WNFA 1NVXQ 1Z2EA 4C4ZA 3HWX1 3B60A 1NU8A 1Z8HA 2F3RA 2CL6X 2JJ1A 3HUUA 2JASA 3GOQA 3IMCA 1H9BA 3LP6A 2L69A 3SEFA 3FSJX 4EUHA 2OLKA 3AIIA 1W2GA 2BMAA 2Z3WA 1K6IA 3OPYA 4EZBA 3W5AA 4CLRB 4UDOA 2J0VA 4MQ5A 3C6YA 3IX7A 4G4IA 4N5DA 1H2XA 1XQXA 4I9HA 3DWFA 3K9FC 2UUPA 3EWAA 4JP3A 4RHEA 4U0JA 4ZREA 2JJ8A 1T3GA 3AYZB 2VP2A 4PW0A 2QNRA 3NDIA 3O1LA 2OEPA 2Q8NA 5D1HA 4YAJA 3QELA 4LNUB 4YCAA 4KX3A 3ZU6A 1CRPA 1CPYA 3KYCB 2R8PA 1V8DA 4M83A 4XUDA 4YQYA 3WL4A 4DA0A 5IBPA 2ZT7A 4FYPA 5ALGA 5GV7A 3D4OA 3GRVA 5FOSA 4BV9A 3TECE 4NXMB 2WP0A 1CYEA 3EEOA 3ZI4A 1M34B 1NNLA 1GZ3A 4YDHB 4BUJA 2MSWA 4K6MA 4ZEOA 3UB4A 3ZHOA 5HXAA 5K0FA 4LMBA 1E8NA 2ZSAA 4KVAA 3QVUA 1I7LA 1P1BA 1NOKA 1B6SA 1D9ZA 1V8FA 5FA6A 2WF6A 2PZEA 1YQGA 3HI4A 3IMFA 2IYRA 1W59A 1TQDA 1ZM4A 3AVXA 4A8JC 4NPCA 4RIHA 2AJCA 4Q4JA 1WY7A 3QENA 5A6SB 5F12A 4CIXA 5HGXA 1M5TA 1WX1A 1FX0A 3OUTA 4UD6A 2JFVA 5IEJA 3BFJA 3WK5A 2J7KA 3JPYA 4RZUA 2NXEA 1Q7CA 1UJ5A 4MYHA 4PG4A 3B6JA 1WVIA 4FN5A 4X6LA 4AY2A 3AVQA 4DMCA 1HLDA 3AQIA 3WGJA 2OMKA 4NPHA 2F3QA 4Q3AA 2H5EA 2IT1A 3QPBA 4UTOA 1L7OA 2EG9A 4IOMA 4WX2B 2FSVA 3WA6A 1XFDA 1Y1SA 2JGFA 1CP3A 2YV4A 2V7UA 5G3ZA 1JI3A 1M0SA 5E3IA 1OREA 2GI4A 3L7AA 4XRGA 4N3GA 5D84A 4ZYWA 5ESXA 4FKZA 3RBZA 3WK6A 3ZLJA 1L4BA 3UMMA 2UUCB 1EK5A 2FEMA 2WF9A 2WEKA 5I4IA 4PRYA 1DO2A 1VGVA 5A7GA 2IC5A 1L5WA 5AK5A 4B74A 1YRYE 3NTLA 3TZ6A 2EJVA 5CB4F 1UXIA 4CHTA 1E3DA 1AF4A 2WU8A 2BGIA 3BRQA 3E1KA 3ZJ5A 4IXWA 2OBXA 3A4LA 2JZNA 3UY4A 2D2VA 3Q5EA 2H7YA 2AKYA 2WVGA 4IV0A 2IX3A 1PT6A 2ZATA 4RV4A 3IT0A 1XTZA 3AEQB 1JR4A 3BE5A 5K3BA 1JAZA 2WKWA 2VK8A 2AX3A 1KKUA 1MGOA 1E2EA 2FMXA 2WAAA 3DFKA 4HEQA 4JT9A 4WTOA 1BG6A 3W2HA 5JYBA 4ZI3A 4OQYA 2BI8A 1Z34A 3QITA 4DAEA 3T9CA 1TOAA 3KDPA 4G9BA 5TV2A 3V7FA 4EKNB 3BFPA 3N0RA 3I3OA 1SVLA 4BFCA 4RD1A 2DRIA 3CN9A 3R9KA 4BKPA 2HBYA 2GN8A 2IXAA 4JJ8A 3TQCA 4ZZ1A 4KUGA 4G0PA 2P8SA 2LKCA 1NYLA 2CK3A 3I32A 1M1YB 1MVNA 3H1GA 4MA0A 4TKZA 4AIRA 5BYKA 5KNCD 5LB4A 3W9SA 5TIIA 1T5TA 3ZGVA 3F4LA 1WPGA 1F6BA 1IY8A 3LL7A 3VYVA 5FIUA 4J0HA 1XRLA 2NPIA 3AM1A 4JUBA 1M34A 2CLOB 3ONVA 1NVTA 1F8GA 1Z6TA 1V9SA 4KDRA 5I7SA 2OK8A 4V0KA 3ORRA 2BSQA 4R8SA 1I80A 2VJDA 4JB8A 4R51A 1FFCA 5E7QA 5LWHA 1JIUA 2JLQA 4ZOCA 5FI5A 1E6WA 1KDPA 1OLSA 1E1RD 1VE1A 3AETB 2OR3A 4LPKA 2ZM5A 3IEVA 2MYPA 3MUNA 1P1HA 2N47A 2O3RA 3DGFC 4RANA 3NTUA 2F4VB 2G3YA 4TYYA 3FNBA 3QI2A 4IOJA 4NZOA 1Z5UA 3KZ1E 1G7TA 5IASA 3MOIA 3S6JA 4N9WA 1X86B 2XUOA 3VNSA 3DLHA 1B42A 1V45E 4YXWD 3LBNA 2XWPA 2Q3CA 5DGCA 1KI3A 5JY6A 1D3AA 2RBGA 3QZUA 3KUUA 1LI4A 1SJ9A 3TMKA 4DLVA 1V5EA 4XFJA 4ZI7F 1QK3A 4AKIA 2QXYA 4QDXA 1QBKC 1IIBA 1ZRNA 5BPHA 4CLRA 4KFTA 3ZGYA 4EBBA 1LLFA 4BVAA 2DQKA 1C4OA 1T2NA 4MPPA 3FN4A 2MINA 2QRJA 2CLEB 1FFEA 2FU5C 2C88A 4INOA 4KQWA 4I9NA 1SQGA 3C1TA 4EZIA 3KFXA 5F98A 1WMBA 3PGJA 4Q3KA 1ATZA 4E22A 1T5LA 4MW2A 4NFLA 1C29B 4RVNA 3G89A 1PJ8A 2XF8A 4P2GA 4CGYA 2CMGA 5ERGB 3RUEA 1TTHA 3KR0A 3UCFA 3PQ5A 1BOFA 4HZIA 4M36A 1RYDA 1XDUA 2OCIA 2XAAA 1UFKA 2QTZA 2XIJA 4TT8A 3DUFB 5GONF 2H3HA 3S68A 3ZE0B 3SOPA 2QTGA 4WI1A 1EH5A 4J3FA 4IYJA 3JQDA 4TL8A 2ZTVA 3PC2A 1G0NA 4CU2A 1E96A 4F4IA 1M5RA 1TM7E 1YJBA 2Q3JA 4PGMA 4ZOLA 1CUFA 2HDNB 1NBMD 2RB5A 1RQNA 3D8BA 5CG2A 3L0OA 4HNHA 4P3XA 3EWIA 5AW0A 3OSZA 1SZJG 3LOQA 5KS2A 2Q4RA 3BKWA 5CFOA 1WKCA 2V1XA 2Z2ZA 4HB0A 2VJMB 4J0EA 2XMGA 4DLUA 5E0OA 3PT5A 1UOPA 4GPAA 3MTBA 4LOIA 3WZ2A 1X92A 4HC4A 2OCPA 2I8LA 1AQLA 3DEKA 2PD3A 3F7MA 2R7AA 4O4IA 1ZM2A 1LW7A 2FF5A 2RHTA 2BMVA 4GICA 4XARA 3VDXA 3PVCA 3JARA 2PK3A 2VYCA 1F60A 3RW9A 1J9GA 3GLKA 4I8IA 4C6TA 3VTFA 2CSXA 2A88A 4PEVA 3GB9A 2QGZA 2JGLA 4IXDA 3N2KB 2H18A 2XUQA 3I53A 1XVLA 4D9JA 3ETNA 3BE8A 3OWOA 1SUFA 3GFVA 4MQLA 4Y1GA 3TDNA 2F43B 1RNLA 1AKMA 5EERA 2ZXFA 3OUZA 1ZJZA 3UMYA 5I4BA 2X8LA 4HH4A 2XBMA 4G2TA 2HNKA 3L02A 3L4BC 4MJXA 4N4AA 1YB5A 3K1JA 4QGBA 1QZTA 3LLVA 1WUJS 3E8XA 2Y1XA 4LXTA 1RCTE 3CLTD 3SN6A 1EP3B 1K5PA 1VG1A 4AMUA 4XWYA 5DASA 5EP1A 4D46A 5A1JA 2XSZD 3QFHA 2BFNA 2J7PD 3QU5A 2BM9A 3AI2A 1K7CA 2M32A 4BY9E 3GH1A 4MJLA 3IKVA 4EELA 2VK1A 5ADUS 3A6KA 5D7BA 1XVTA 3NVAA 4DIEA 5C1OA 1KVSA 5JXIA 3ZGNA 2NU8B 2BONA 3L1HA 4YBZA 1COZA 4U7DA 2VDNB 2QUHA 4RCYA 1IN1A 3CINA 4YGYA 1U2GC 2OHJA 4DMGA 2ASVA 2AWNA 4OHOA 5EKSA 2BTOA 3DP7A 1VYTA 4LI0A 4QDUA 2ZIEA 1PFUA 1TTQB 3KEFA 1B1AA 2CXTA 3IELA 1HSOA 2R4QA 2V6MA 4N01A 1VE7A 1K7SN 2I55A 2Q49A 2TRSB 3KJQA 3OPNA 3P8ZA 2ZANA 4MW4A 1XPRA 2WUEA 4BO3A 3OQNA 3RRNA 4H7JA 2J8ZA 3FTQA 1G291 1U3WA 3H1FA 4ZQBA 2WVAA 3LX8A 2BFDB 2PKQP 2PSJA 4JDUA 4MR7A 4DA9A 3ZCUA 2MTBA 3IKLA 3TIIA 1DRWA 2JKYA 5JATA 2QMZA 2IS6A 4CM5A 4YQFA 1HNWB 2EFEB 3VBEA 3ZQKA 3F6PA 3DKRA 1Q7TA 3EFOA 3Q8MA 3L0BA 4YRZA 5BR8B 1NMEA 3AJ9A 1UZAA 2DERA 1YL7A 2FE1A 2GMWA 1FYEA 1GZ7A 2XZPA 3K8OE 1KZHA 2OPHA 4JJ4A 3V8RA 4F6RA 2RH8A 1TAGA 2HBZA 1HFWA 3KM0A 4FDLA 4NZ9A 3SS8A 3HO1A 3D3QA 1YUBA 4B33A 2OZLB 4K8OA 2X8WA 4HNAA 1R6AA 3S1SA 1UC5B 2GTIA 4GZMA 4HRYA 5KJEA 1V41E 3C7TA 1VG9B 1S1CA 4GG1A 4XJSA 2FQQA 1O03A 3ZVKA 1YV9A 3P9CA 2PLFA 4CFZA 4CKWB 4K03A 4RVSA 1NGSA 2W6ID 4L4RA 5DCYA 4IM7A 1H23A 2OO5C 3AESA 2MOKA 4Q21A 4OQXA 4W5WA 2XNKA 4YJFA 2V9CA 1NXQA 2GH1A 3R0JA 1YJ8A 2GARA 2OENG 4IQ8A 2NU9B 5BV1A 2QX7A 4ZMBA 1JA0A 4O6VA 1R2QA 3PQDA 4O02B 5ISMA 4HEHA 1D4ZA 2XCUA 4KFUA 3ZY4A 1RABA 3VNBA 4CLHA 2ECQA 4CCWA 4WBNA 1T8PA 4F92B 1C4XA 2FRXA 2OB1A 2EEPA 4M1QA 3A7DA 4EMUA 3LWNA 3SIWA 3V7WA 1AOXA 5TARA 3A1DA 1LTHR 4YVFA 5AKZA 1NRWA 4BC0A 4O2BF 3CLVA 2ZUSA 5EHXA 4WH0A 1W8DA 3E2PA 1QFSA 3B53X 3TI9A 3ZHZA 4FLEA 1S0UA 5A2QA 3P2YA 1KMMA 1H0KA 2I6XA 3DF9A 3O74A 1N32B 2QX9A 2V6GA 2ZDGA 3B7PA 3MFQA 1S1MA 4OG2A 1ZGGA 2QRVA 3AF5A 3BXHA 4JZYA 4ENSA 5AM3A 3KL4A 1W4LA 3IAM6 3T3OA 4CLEA 2QN6A 2V7BA 5C1PA 4FMCF 2G4LA 4M1KA 4LVUA 4AG3A 4RF4A 4YRSA 3FWNA 1OU4A 5I7FA 4OHYA 3T9AA 1T9AA 5JNVA 1LQ2A 1ZL0A 1PTJC 4MRVA 4NI5A 3LQ2A 3EQ9A 4P92A 1HDRA 5F1KA 3J7AC 5TRTA 2VJCA 2B4AA 5IKOA 1N33B 3CRNA 4EPXA 3T3DA 1CS4C 2O3JA 3U4QB 3KUDA 4NCAA 2ECPA 1PR5A 4FX5A 3U3XA 1KJQA 3DEJA 4GOOD 4KYUA 5DCUA 1ESNA 4ZYYA 4CQMB 1S3IA 1E2NA 2A7QA 4BEJA 3H97A 4QJIA 1AKTA 4WEOA 4UXHA 2X0IA 4B3MB 4F60A 2ZBEA 1PJBA 1XJCA 4DA4A 2IIVA 1NURA 4Y6PA 1KMHB 4I4TA 4NDAA 3QHPA 1Y8RA 4XX1A 1LF0A 1ZDMA 2H31A 3BG5A 4G81A 1X74A 4N3NA 4WV3A 3LDAA 5H3LA 4ZCSA 1R74A 3TAHA 4BECA 5B7GA 2BUCA 4RELA 2B99A 4D80A 1G0OA 2CXQA 1R4NA 2DQSA 1KH3A 3DZHA 4RZIA 5FL3A 2COKA 5CXUA 3SFVA 1T5OA 5MHTA 3JASB 5BN1A 5J2UF 4H1HA 1Y9AA 1ULSA 2GXQA 3LCUA 3LMKA 3T5MA 1O8BA 4HQLA 5ERXA 5TVGA 1IZ8A 3VR1A 1HTBA 5EJ9A 5FPSA 4RE5A 2JD0A 3DCNA 3HA7A 3T1VA 4KYIB 5EZYB 1FSZA 2BF4A 1NT2A 4EOGA 2P5TB 1JJFA 4WLOA 3KQYA 4JODA 1E62A 1RRPA 3QLVC 5E1OA 1JXQA 1FOEB 5L7YA 1JHXA 3UAWA 5JSHA 5BOSA 3FOZA 1ODKA 4G9EA 3JVDA 4ECEA 3UPDA 4KQ2A 3WBBA 3PF8A 1SIBE 4EY4A 2UUOA 2FRDC 3NGMA 1X0VA 1SU6A 4YRTA 5CFZA 1VDMA 1XEWY 3CJQA 3VAZA 5EWLB 4OFXA 3NBZC 4WK4B 2G8NA 8MHTA 4H0FA 4ZVPA 1ESMA 4FPXA 4KYVA 5ARDA 4MITA 3AV3A 1X7YB 3GRRA 4FCCA 4KXNA 3JQPA 4LYJA 2G77B 4X1YB 5EUCA 1R4AA 2C3OA 5C1DA 2G9RA 2EFJA 4U3JB 1Z4PX 3EFBA 4OHMA 2RD2A 1EGVB 3H04A 5M3BA 1Z4KA 1OAOC 4B7CA 4PR0A 1ZR4A 1G9SA 1OBOA 5I8WA 2Y0PA 2WTEA 4GR4A 3HACA 1SCAA 1RR6A 3R4VA 1V8PA 2O6LA 2QZ9A 1E9AA 1VKRA 3HK2A 1NP6A 1XTIA 2ZYIA 3DEYX 3DSRA 1DC7A 1MW9X 1UDWA 2PQMA 3AQ4A 2RCYA 3L8EA 5TF0A 4DCPA 1FFDA 3W3AA 2G25A 4C05A 4ZCLA 2ZUCA 3OP4A 1YCHA 1ZBQA 3C16C 3KJHA 4FHEA 3UV3A 4A5SA 4TTAA 3VOSA 1KMCA 1NL3A 2DUMA 2F9MA 4IICA 2JS7A 4KRYA 3R5KA 4XR9A 5JH7F 4Z5XA 2GZMA 3PRKE 3GMDA 1LX7A 2VCYA 4IHJA 1MMFB 1EGQA 1V1MB 1XWFA 4KQGA 4D8TA 1KI7A 3R3JA 5DULA 4BGEA 4ZCQA 1SA0B 1PV1A 5FULA 2B2NA 1QDEA 2GPJA 3CEMA 3R5FA 5GPBA 4IEFB 4MV5A 2C8JA 4CMHA 4FYHA 4NYMQ 4TX1A 1RKXA 5KOJB 4WKGA 2JFPA 4PVCA 1DHTA 3IOMA 3R44A 4JGGA 4BMVA 4LTMA 1P0IA 1VKJA 1DCKA 3EGXA 2CXXA 2J48A 4K6OA 4M7OA 4OB7A 5AKYA 2X22A 3AM4A 3AY0A 1V4NA 3G88A 4B7XA 4HXGA 2XECA 3I12A 2E9SA 6AT1A 1O96B 3BDAA 2BZGA 3A0UA 3FFWA 4HFRA 1H8HD 4PHCA 3UUEA 3RSHA 2A58A 4BCCA 4BU1A 2CFRA 2FEWB 2YWEA 4U7JA 1F4PA 4NR0A 1A7AA 5FWYA 1E89A 4LWQA 3NDJA 4PYIA 4E15A 3HZZA 2BSAA 2CMDA 2YWDA 3NEYA 2XXBA 4KR9A 4KE7A 1NC3A 4A2WA 3H5WA 1BXGB 1UMCA 1O9GA 2GUGA 2M1XA 1P80A 2GBIA 2XWSA 3BX1A 2YFHA 3PHIA 4HX5A 4M9QA 4B43A 1ZOIA 2R8OA 2BTEA 2OBNA 1EFPB 4Q37A 4Z7NB 1WXEA 5I7WA 1GCAA 2JI4A 2XA1A 1J20A 4KG7A 3QY9A 5AIAA 4DCNA 2BLNA 2LR0A 2BGGA 2WTMA 1HF3A 1S2OA 5CVUA 4TLBA 3ZDXB 2IOQA 1RIIA 2DWCA 1JKMA 3GCWA 5K3EA 3OFKA 5BVHB 3WDSA 1JPNA 3V9PA 3F96A 3J81A 2CVQA 5D6NA 3WFIA 5DBHX 1CEYA 3DXXA 4QXRA 2GM9A 4RDIA 1PFVA 2NAFA 5ER9A 4ID3A 1AQ6A 1XTJA 4FK8A 4JJGA 5IJ0B 4Z4IA 1FB5A 4LGYA 4HQOA 4RA9A 3ZJ4A 5M5BA 4J0GA 3L46A 4NU5A 4IIVA 1T8YA 1U8XX 4R9VA 1D8AA 1Q84A 3C98A 1JBKA 3DEIA 3GPDG 2VSFA 4W9NA 2J3KA 1ZSNA 4KAJA 4C3VA 1NN5A 1U7HA 2YOHA 5C53B 5LMNB 2VTKA 5EJ5A 3OTHA 4HV4A 2OBLA 3ZDDA 2Y2VA 3JWGA 2J32A 4JXZA 2QI9C 2XBLA 4F3CA 2F2TA 3GVCA 5I47A 4ZDWA 4ZU1X 2FPIB 4FS3A 1TTPB 2RKOA 2I3AA 4IZOA 5CNJA 5LC1A 3ZWOA 2XOEA 3JD0A 4Z51A 1PRYA 4YCMA 3RHZA 2ERCA 4QFCA 1BS1A 1GTRA 3KSMA 1IBKB 4PSUA 3WBFA 4IHKA 3EF3A 5DSZA 3NC4A 1C9KA 1PDVA 2DZDA 2PV0A 2XA2A 4G5GA 1O7JA 3TUJC 1QCZA 3VPFA 5KHLB 2QN9A 1BH2A 1A2OA 4TL9A 1L8LA 4TWIA 1IATA 4HNSA 4B0PA 4RMJA 3KVOA 5J5AA 4EG6A 2QT9A 2FMKA 1K3UB 4NBWA 4NV0A 5DVZA 4BQQA 4OF4A 4TTTS 2PMFA 3JWJA 4X41A 3WS7A 5KTYA 4DLRA 5JAIA 2B2XA 5IN5A 2B78A 3ROQA 1X7XB 4G37A 1FFGA 1QH1B 1Y8QA 2DT5A 3SLGA 3UXYA 3X1JA 3ZDEA 4PXSA 1XMOB 3H87A 1CLUA 5SZKB 2QTCA 2AH5A 2O14A 4GYJA 3VA7A 1UQTA 1PV2A 2QTMA 1CRZA 3IFSA 2X41A 4G5YA 1CDEA 4WGGA 3T5CA 3WLKX 1W5AA 2X77A 3MILA 4XGQA 4KHPB 4JX8A 2L0XA 4EUEA 2Z8YM 3FNGA 4D9FA 4EKDA 3NHZA 2XXAB 1LV8A 2AN1A 2BBSA 2QJTA 1F9EA 4YAGA 4YIKA 4URHA 3W6OA 3B6EA 3M2TA 1U2RA 2H1CA 2HKIA 3HJHA 1PJLA 3WNDA 3PLAE 4IOLA 4F2GA 1TB4A 2P78A 3QV1A 4YDSA 4GBJA 4GUDA 2PRKA 3MQFA 2ID9A 5EIBD 5FOXA 3ZUGA 4EY3A 5FBZA 3LXRA 4LZPA 5CLFA 1LC3A 4CKZA 1FFSA 5TXGA 4CODB 5B3LA 2I7TA 2V1UA 1GR0A 2G80A 3CYFA 3UGQA 3G0DA 3L4EA 2AEFA 3EK2A 4LWOA 2PWAA 3K53A 4JGBA 4BVJA 5KOYA 5EMJA 5CFMA 1J2RA 2HDWA 5BSGA 2XY4A 4F3NA 1BW9A 2JCYA 2B2CA 4O2AF 2V7GA 1BMFA 3ZVLA 3ZI0A 5TNXA 3VDMA 4J91A 3LX5A 3Q4GA 2LDXA 3TEJA 5A3SA 3TKLA 4BQRA 3FG9A 4GIBA 4PG6A 2QR3A 2WDPA 3BHMA 4MMXB 5FI3A 2DHCA 1N8SA 3P5SA 2ZBUA 4C03A 3HY3A 5EJ8A 2AC4A 5KU1A 3FTNA 3GYBA 1EP9A 1XTBA 3NKLA 4TL7A 5HPYB 4XOIA 3KUKA 1IJFA 2DT8A 4LYAA 1Y7HA 4I9FA 4I5EA 1ZA1A 2Q6VA 3OZBA 2OORC 3M0EA 3ADPA 2WFLB 3PT9A 4B3DA 4D42A 5JXHA 1NV9A 1KOGA 2VDQB 3HRIA 4GWGA 1G1AA 2G9QA 2E4ZA 2IGBA 3QVWA 1KJ9A 3D6AA 5HM8A 3ERCA 1E66A 2QY9A 3NTRA 4CF3A 4I50B 5CDFE 2NLOA 1M10A 2J5QA 2OFXA 3BYZA 3I64A 4ZPJA 4YJ3A 3WK8A 3OOEA 2Q5FA 5LQDA 1QU3A 3H4VA 4MMZB 2ENWA 2PJDA 3G8BA 1D09A 1FYXA 3L4SO 1P4SA 1OFTA 1T6BY 3RJ5A 3TGWA 3GJ6A 1XDBA 2ZI3A 4Q82A 2WRZA 4AICA 1VKHA 2IUSA 2O0MA 4NG5A 5HNKA 5ENVA 3QIAA 4RZ3A 3VV2A 3WWZA 1XAJA 1ESEA 3GRAA 2WTBA 4Q9IA 2HWXA 5EJ4A 4MVJI 1AD2A 4JOQA 3TWOA 2FPLA 3GLVA 4EF6A 4Z4CA 4GKVA 5BQFA 1QV7A 1D2MA 4R8KA 4ZQHA 1MD9A 4XIJA 1EJ2A 4JT2A 2RGYA 1GCOA 4JIMA 4OXKA 3VOAA 4ZOQI 1TZMA 4EEZA 3KTOA 1TGYA 3CONA 2OZVA 3GNSA 1CJKC 2AJDA 2LXNA 4ZU6X 3BBPA 2BKLA 4MAFA 4UOQA 3OM0A 4XRRA 5I5EA 4UREA 4EITA 2C5FA 1DCFA 3ZK9A 1XLTC 1GN8A 1YRBA 1MEJA 4AO8A 4OHKA 3WE7A 4ZI5A 4KXVA 2XTNA 3QH4A 1V1RB 2FDRA 2HQ1A 3MYRA 2ID4A 1ZINA 1RLTA 4PAQA 5ELXA 2AXPA 4W6ZA 3UJ8A 4DCTA 4YUAA 3S2UA 2Q5HA 3TRHA 1NFRA 1SU8A 2HXYA 5JZOA 4ZO4A 2DY0A 1J8VA 2G5GX 3DE1X 4FIDA 1OXVA 4F85A 4S3MA 1KI2A 3HU3A 3UMSA 3JSAA 2JGKA 1CUHA 1Z25A 5EE5B 1G8SA 5FKJA 1J25A 1MNQA 2YJ3A 4GLLA 5BUCA 2SECE 1QQBA 4U8GA 3VI4B 3E15A 5K0BA 1E9SA 2DR3A 1EFHA 1OC2A 2J3EA 4EX7A 1MNAA 5C1BA 3MEQA 3GDGA 3MQ2A 2PT5A 4MPTA 1P1KA 1UK9A 1MB2A 1KOJA 2EAUA 1Y1TA 1IBMB 4IHQA 4BVEA 1KZ4A 3M6UA 1W29A 1VIAA 3RQSA 4S24A 4E4YA 1HYBA 5L3QA 4J2TA 2ARKA 1B74A 4ENTA 4ESHA 4CBVA 5FV7A 1X1CA 1I6KA 2HCJB 4R81A 4DT1B 1UBOS 1PL0A 2P3QA 3HJAA 4CKCA 1HLFA 2ZTMA 1QTIA 2WG1A 1C3XA 5AQ1A 2Z8ZA 4ZXFA 1FRNA 2XQGA 1PSWA 1OIXA 3GGSA 1LBIA 4DAOA 1YBVA 4GM4A 3D1LA 4L4ZA 5I7AA 1EFVB 5CDYA 1KQ3A 1D0SA 5B3JA 3K73O 2PBRA 1VFPA 1Z0FA 3LUHA 4D3DA 1NKSA 3HDVA 3HKCA 4FHDA 4C4AA 1RRCA 3I0NA 3VUEA 2WUVA 2XXJA 4J6EA 4RK0A 4RGVA 3W4IA 1ADYA 1GVNB 1HDZA 5LYYA 3S2IA 3ZD9A 1DWOA 4OO3A 1U4OA 1TA0A 2Y1EA 3HCCA 4DXHA 3HB5X 1F2UB 2R8BA 4M87A 4R05A 1LD3A 1HYGA 3BD9A 2AUMA 3MGAA 2YFYA 5H5JA 5IC5A 3CA8A