2A9OA

Crystal structures of an activated yycf homologue, the essential response regulator from s.pneumoniae in complex with bef3 and the effect of ph on bef3 binding, possible phosphate in the active site
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
117
structure length
117
Chain Sequence
b'KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator
molecule tags Signaling protein
source organism Streptococcus pneumoniae
publication title Crystal structures of an activated YycF homologue, the essential response regulator from S.pneumoniae in complex with BeF3 and the effect of pH on BeF3 binding, possible phosphate in the active site.
rcsb
total genus 40
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a9oA00
3GRCA 2QW1A 2QZJA 4MPTA 4UHJA 4KNYA 1DBWA 4JB0A 3RVQA 4W5NA 3IPCA 4MQEB 1QMPA 1USKA 3SNKA 2FN9A 3NNSA 1BAPA 1D5WA 2DRIA 5C5CA 1H9CA 3HVRA 5IBQA 1GCGA 1ZN2A 1YMVA 1GUDA 2TMYA 2R25B 2AYXA 4MR7B 3Q15C 1T34A 3D02A 3CZCA 2WY2D 3SQNA 1AB6A 3RVNA 2JCGA 5FWXA 3Q7RA 3A3KA 4MQFA 5KC8A 3EGCA 1VRVA 4N41A 3DLHA 2CWDA 3N6VA 4QYMA 5CNIA 4YR7A 3FGZA 1QO0D 3SM9A 2F8SA 4MS4A 3SG0A 3N0XA 2JVKA 3GBVA 4RXMA 4XAQA 4KQCA 3B2NA 4W5OA 5KQGA 1HEYA 4WXEA 2L18A 4LDAA 2FQXA 2IDMA 2O20A 1Z13A 3UUGA 5F64A 4H60A 5B3JC 5EWLA 1QO0A 2MYTA 1PEAA 4LE2A 4CBVA 5HKOA 4G0XA 3OQNA 1QP0A 4MR7A 5GQSA 3NHZA 2GI4A 3MIZA 3TD9A 5KQPA 4JA2A 2WRZA 2HJ9A 3G1WA 4RK4A 3VNBA 4M88A 4EYOA 6ABPA 2NT4A 1QQAA 1LJUA 4IMIB 4G0YA 5EWMB 2PL1A 3N75A 5KI6A 1NATA 3BILA 4G0ZA 4Z9BA 3RVMA 3HK2A 1E6MA 3CRNA 4OBBA 1IIBA 1I3CA 5EWLB 5PNTA 1BDHA 2WJAA 4GPAA 2JVIA 3H1EA 3BBLA 5IEBA 4OATA 2X7XA 4MR9A 3IP7A 5FBKA 1DP4A 3C97A 1OXBB 2NUBA 4RK6A 1P6UA 2PMCA 1JYEA 4RXUA 3D8UA 3GL9A 3SAJA 1CEYA 3CHYA 1QPZA 4N76A 3EDCA 1Z18A 1D4ZA 5KWSA 4YS6A 1Z12A 1F4VA 3M6MD 1DC7A 3C3WA 3UKJA 2WJWA 2H0AA 1FFSA 5JNUA 1JYFA 2R48A 4ZMSA 1NXOA 2PUAA 3LFTA 2GKGA 4RXTA 3LUJA 3IP6A 4MLCA 5T7BA 2NZUG 1SXGA 3FFWA 2FSPA 3P9YA 3EQZA 3H5WA 3O2QB 3HZHA 1Y1LA 1C0EA 4LZLA 1DG9A 1SXHA 5GOTA 2IOYA 1YMUA 4NCBA 1NTRA 1W25A 4RK7A 5FWYA 1NXWA 1DC8A 2P9HA 1ISSA 4MRMB 3F6PA 4P98A 9ABPA 2NT3A 1ZHHA 1J56A 1PNTA 5HQJA 3O1HB 4HNQA 2QR3A 1NXTA 4O5AA 3QX9A 2ZWMA 3GT7A 4JOQA 4KK4A 4W5TA 4QPJC 5TQJA 4ZMRA 3QELA 4MR9B 1BDIA 2A9QA 3KTOA 3O74A 4LE0A 1YS7A 4TLLB 5IX8A 2BGGA 1TMYA 5JNVA 3F7NA 3EQ2A 4RK0A 1XHEA 3VNAA 1QQBA 4G86A 3LUCA 2B1JA 5T3YA 2R47A 3LUAA 2PUDA 1CYEA 3OLXA 1JF8A 5TQ2A 1YK1A 3T6KA 2E4YA 3JVDA 1RZRA 3T8YA 4E7OA 4OLAA 2JRLA 1DJMA 4RY8A 1GLGA 1JFTA 5IUNC 2QV0A 2ID9A 3H6GA 3SY8A 4HYEA 5JNRA 4RY0A 2E4UA 3OLZA 4F3TA 2GX6A 1ZDMA 3KS9A 2PL9A 1RPJA 3RVLA 4YCSA 3QELB 2RGYA 3KKEA 3KG2A 5DLEA 1JHZA 3LTEA 3TO5A 5EWJA 2LUOA 1YVUA 4Z0NA 3CTPA 2FVYA 3LUGA 2FEWB 3FMVA 3LUDA 4L4UA 3KCNA 3DGEC 4Q7EA 2PKXA 3C6QA 5KC9A 2PE5A 1KGSA 5CNKA 3GBPA 1F51E 2MSWA 2FQWA 2PUBA 1K66A 2R4QA 4G0QA 4EGSA 4Z4IA 4Z4GA 3LUFA 2FEKA 5TQ0A 5IUKC 3RVRA 1EWKA 4Q6WA 5TPZA 4JAVC 4ZJPA 5BR1A 4HNRA 5HSGA 3DLBA 1NY5A 3Q41A 1FFWA 3E61A 1RNLA 2JK1A 3S99A 2FMIA 2JBAB 1JFVA 1E6LA 1M2FA 5E3JA 4IMJB 3CU5A 3NNDA 4KRFA 5TPWA 2PLNA 4PYRA 4ETNA 5C5EA 1QKKA 5CNMA 4Z4FA 1WETA 3M9XA 3HV2A 4RDCA 4IRXA 1EWVA 5TQ0B 5TPWB 3EULA 2LIVA 1PNRA 4EYGA 4YP9A 4HNSA 1USIA 5BRJA 3KYJB 1P8AA 4TLMB 3ROTA 1D2AA 2IPNA 3CS3A 1L5ZA 1NXPA 2QVGA 3OO0A 4OG2A 1E6KA 3O1JC 4MS3A 1U04A 4W5RA 4XXHA 1SXIA 4O1HA 4KREA 1Z26A 3OM1A 1ABEA 4KPYA 4IGAA 1RZRD 2J48A 4EY3A 2B4AA 3H5TA 1ZH2A 1CHNA 3OQMA 3Q7TA 3CNBA 4KZKA 4EUKA 2PAFA 3CG0A 1B00A 8ABPA 3ILYA 2VK2A 3JTEA 1MVOA 1JH9A 4WT7A 3QEMB 4EYQA 1YIOA 1PEYA 4S04A 3RVSA 3CG4A 4RSMA 4ZPJA 3TMYA 5IUJC 2A9RA 3JS5A 3N0RA 4RY9A 3L49A 1TVMA 4B09A 4F11A 3O75A 3RVPA 1FQWA 3W9SA 2IKSA 1BDJA 5D2CA 2Q5CA 1QP4A 4RV5A 2ZAYA 5BRAA 3H1FA 1Z2DA 5B3JA 4OLBA 4GNRA 1E2BA 2W42A 4ETIA 1LJLA 2QVCA 5KQLA 1Z25A 2MYUA 4XFKA 3NHMA 3KYIB 5ED4A 5HM6A 3MM4A 4Z4HA 3OLYA 3H5VA 3IPAA 1Z15A 3L6UA 4G0PA 3RVJA 1YS6A 1NXXA 4PZ0A 5JNSA 4N03A 4O1IA 2HSGA 3IDOA 3JY6A 4RZSA 5IC5A 1M5UA 5DKFA 5EWMA 4ETMA 1ZY2A 5JNWA 5ABPA 2PUGA 3BRSA 1FFGA 3ILHA 3MMNA 4RU1A 1KMIY 4D6YA 1DBQA 4G0MA 3GWGA 3OMWA 3TB6A 3QEKA 3GYBA 1QNLA 1PUXA 2ID7A 1TM2A 3RVKA 3A0RB 5FBHA 1BVHA 4KMRA 4H3HB 1MB0A 3H1GA 2FTKE 2IYNA 3OLWA 2OQRA 2WMYA 4NQRA 1D1QA 3Q9SA 2M1ZA 3NBMA 1UDRA 2GWRA 3DZDA 2PUEA 4TN5A 3H6HA 3HUUA 4KFCA 4RK1A 1DCFA 4WUTA 4YV7A 2YHBA 1U0SY 1YTUA 5IULC 1BA2A 3UK0A 3HO1A 1GUBA 5DTEA 2L2QA 1NXSA 4OTZA 1DCKA 2N9UA 2JB9A 4FB4A 3F73A 2HPHA 2HQOA 2M98A 2RJNA 3CKMA 3RQIA 1URPA 1TLFA 1A04A 1VPWA 3H5OA 4MR8A 1DBPA 3OLVA 4NCAA 2E4VA 1DRKA 4LE1A 3HSYA 2E4WA 2QXYA 4XASA 4L85A 2RDMA 2H3HA 3G85A 2FKAA 3KLOA 3RVOA 4FE4A 5BQ3A 4MGEA 4MR8B 4H3KB 2JBAA 2FEPA 4MAAA 1RXIA 3DBIA 4FE7A 4E7PA 4Z9AA 1JLKA 3QEMA 3LUKA 3A10A 3H5IA 1EFAA 2FQYA 4MYRA 4RKQA 2FLKA 2MYNA 1R8JA 3M9WA 5JS2A 4D74A 3JPYA 3OM0A 2LP4Y 2L19A 1Z17A 2L17A 4G0OA 2AYZA 4JB2A 4ML3A 3A0UA 4WXMA 1DRJA 2FN8A 4F12A 1M2EA 3MF4A 2HQBA 3MYYA 2MYPA 3FFTA 2CHFA 4MRMA 1KRWA 1APBA 5CNJA 4YRZA 1LBHA 3EODA 4MQFB 3HDVA 2JVJA 5FWYB 4Q6BA 6CHYA 1A0OA 1ZITA 2F8TA 4PEVA 2HQRA 1K68A 4MLDA 4MS4B 4KK3A 3LMKA 4YO7A 1ZESA 3ROFA 2MSKA 3MQ4A 1MAVA 3LOPA 4MQEA 4DADA 4F8JA 2VYCA 4PICA 1S8NA 4WZZA 3T95A 1EHCA 2QU7A 1KRXA 1USGA 1YK0A 3LKVA 1RXEA 2FMHA 3N0WA 4Z4CA 1W9HA 1A2OA 4MS1A 2FMFA 4RK5A 3R0JA 4Z4EA 3K4HA 2I6FA 2E4ZA 4NV3A 4UHKA 1JFSA 5TE9A 1EAYA 3JVIA 1VLZA 3OQOA 4RWEA 4WWHA 3E3MA 3N8IA 1PHRA 3Q7SA 1ZAYA 2QSJA 4EVSA 2KYRA 3QX8A 4DQDA 1SRRA 4ZYLA 3LUHA 3QK7A 3QLUA 3I5AA 1U8TA 5DGCA 4KV7A 1JWLA 4W5QA 1JDNA 2IPMA 3N53A 2WWVD 1ABFA 4N0QA 3FFXA 3I45A 5CHYA 4Z99A 3EJWA 5KQMA 3EAFA 1FSPA 4XLTA 1JL3A 4LRQA 4RKRA 3KHTA 4QICA 4S05A 5JS1A 1C4WA 1JDPA 4F06A 3F6CA 4G97A 3KJXA 2FW0A 2FMKA 3QLTA 3KLNA 2CHEA 3C3MA 3QLVC 5EWJB 1P2FA 3URMA 5TPZD 1SD5A 3T38A 4JP1A 2WB4A 1TJYA 3KSMA 3O21A 7ABPA 1JX6A 1ZGGA 1D1PA 3O2SB 4RS3A 4EYKA 3GA5A 3BRQA 2OENG 3IP9A 3QLUC 1U2PA 4NICA 1Z16A 4KQ9A 4KVFA 3I09A 1JBEA 2FXIA 1L5YA 2IPAB 2V0NA 3HEBA 3NNNA 2VUHB 4YLEA 1M5TA 2XDYA 3HDGA 4DN6A 4QYWA 4N47A 1XHFA 1MIHA 3MA0A 4Y9TA 4YGXB 1AB5A 3QLVA 3GV0A 2A9OA 1P6QA 3HCWA 2LPMA 1EWTA 1ZGZA 4IF4A 1U2QA 3O1IC 3RH0A 1QP7A 3LKBA 2RJOA 4JASB 3HXMA 4IILA 3CZ5A 3HJFA 3O2JA 3C3KA 1GCAA 2PJUA 4EVRA 4PE5B 4TMYA 1Z2EA 3TX6A 2PUCA 2FLWA 1ISRA 2YHAA 1VKRA 2LBPA 3CLKA 4MS1B 2MSLA 4LX8A 3H5LA 3CFYA 4P1ZA 3OO1A 4N0PA 1LK0A 3HM9A 2P4UA 4LDZA 2GBPA 5JNTA 3IP5A 2E4XA 3I42A 1OXKB 5I4CA 3OMXA 3BREA 2A9PA 2CD7A 1NXVA 3H75A 4MS3B 4D6XA 1XWWA 1MB3A 3K9CA 3FDFA 5FWXB 2PUFA 1LBIA 2NZVG 3HUTA 1DCMA 3JPWA 1ZH4A 1DZ3A 2VUIB 5TQ2B 5IEJA 3DGFC 4XARA 2IPLA 3HS3A 5DCLA 1ZVVA 4EVQA 4YWHA
chains in the Genus database with same CATH superfamily
3BB3A 4EW6A 1T9GR 3JAKB 1Q77A 4UD6A 4KSCA 2UVPA 1G64A 1JYSA 3GCDA 3SNKA 4NV0A 1U99A 1HX7A 1TGVA 2NYVA 1SG9A 1NA5A 1YMVA 2HIGA 3REGA 2P6OA 2EP5A 2O3QA 3A36A 3ESAA 3JYQA 4US0R 3W6OA 1AS3A 4IMPA 5E4YA 4EO9A 1LV7A 1PW5A 2C9BA 2DKOA 3ZQJA 4CLOA 4Y18A 4I6JA 3N07A 1WVGA 2D1FA 5L3RA 3STWA 1LRJA 2JBWA 2PS9A 4N8SA 4DG8A 4Q1AA 3UIEA 4DDWA 1SIBE 5EKTA 1UCFA 4GX5A 3L0IB 5K6TA 5EKSA 1PUJA 2JGRA 1DLJA 3OF2A 2CNNA 4MO2A 3FZNA 2HW8A 2VRWA 2OFPA 2Y1FA 2YMPA 4JBLA 4OK3A 4PBTA 3NP7A 2O20A 4DIDA 5IFKA 1Z4QA 1NVFA 3MERA 3DC2A 1KZYC 2GETA 2WW8A 3IQZA 3AR5A 2W9XA 3M82A 2ZIZA 4WOCA 1WZUA 2NPFA 3TOSA 3IOEA 1DT3A 1JBQA 3SZOA 4GUAA 1AGNA 1BEZA 1K9VF 4ZOCA 5IJ9A 5C1OA 4YJHB 1R4NA 4OLJA 1YIDA 2XVXA 1RCUA 3T4XA 3WGKA 2Z5LA 3F8SA 3ROXA 3ZLTA 1KDOA 4D99A 3PD7A 2QRPA 2EERA 4W6ZA 3UTDA 1C9DB 2WU3A 1G4UR 2FSVA 2CVHA 4JY7A 4IV8A 4WK6A 4E5YA 4DR4B 621PA 4Z9BA 2I3BA 4TKZA 5TJHA 4CQMB 4A0QA 1RPAA 2Y6VA 1K4MA 1WSBA 2NTJA 3OHSX 4PHHA 4ALKA 1AN0A 1C1DA 3NCHA 4QDXA 3NGMA 3J81A 5EWLB 4EABA 2JVIA 3VTFA 4D5EA 1CV2A 2XT9A 3NJRA 4FWTA 2I3DA 1M73E 1N8SA 2WR8A 1DP4A 5KB3A 3C97A 5CPFA 1PLLA 3INTA 3DG9A 1Q21A 1E1QD 1P2VA 4MULA 3SSAA 5CT6A 3FR7A 2FUNB 2JAXA 4L3WA 4X93A 3OTOB 3M6VA 2Y99A 3SHVA 4KO8A 4Q4DA 1M0SA 3V8BA 5K4GA 2NQ2C 4M7PA 2WSIA 1XVLA 2P9JA 5I8WA 4D3XA 3GQBB 4KUEA 1YB5A 4N0MA 3K20A 4I9NA 5H59A 5EQDA 2YQZA 5MFPA 1SY7A 3HJNA 1MAUA 1R4MB 2PYIA 1DAEA 1BE6A 4O4IA 4RXTA 1P4GA 1RLJA 4M8LA 4RLHA 3IMGA 3ZE6A 1F8FA 3IBYA 3H2KA 1ISGA 1U7WA 1SXGA 1JKFA 3Q3JB 3UT5A 5BVHB 2II6A 2JGEA 5ALVA 4MRSA 2XZLA 4KE9A 2AD1A 3EN0A 4GC9A 3FDZB 4PLYA 1WO8A 3JXEA 1SQSA 5BN5A 4LVUA 3IJ5A 1QIMA 4PZEA 2DBRA 2GHTA 2LR0A 4L75A 5KAPA 2GZDA 2OXIA 2JPDA 5BR4A 1ISSA 1SBTA 1CQWA 3HYLA 4DV3B 3Q72A 5IT0A 1J56A 2VYNA 4BMYA 3L1IA 2H2IA 2QVZX 1H2AS 2C3MA 3OZUA 4GLBA 4QREA 3LQYA 3SZUA 5IJXA 1JJBA 3E1KA 5AXDA 5CVTA 4HDCA 1O5IA 2V5AA 4EQZA 4OB7A 5JNVA 3OA0A 5CW2A 1YGPA 1RYYA 2YZGA 4CCYB 1WW3A 1W1WA 2VHJA 3CNOA 3FCSB 1B0AA 2PYDA 4ON9A 2FGKA 1U9IC 3D59A 1I9GA 1YJQA 4G86A 4TS3A 3EGDB 2R47A 3HDHA 1DG1G 3LUAA 1ORVA 4Y6GB 2O3RA 5TGDA 2X0KA 1FNBA 2D2XA 2OUKA 3BSFA 5LZ9A 2C2XA 4OLAA 1N6NA 3PIIA 4Y2UA 5B53A 4OCZA 4LFCB 3HKBB 4IHQA 3CZQA 4R2HA 1P4JA 2VL7A 1FW6A 2X4DA 3FWPA 2OKCA 3IOYA 1V7PC 3CIOA 4EKNB 3KAPA 1IMOA 3JD1A 4BRUA 4CV3A 2ZB4A 3WK5A 4O3FA 1HZZA 4URZR 3RVLA 5KDDA 5J47A 3ONEA 2P78A 2Q4OA 3BE8A 3RFTA 2OCLA 3JQCA 4IIEA 1UXKA 3PE6A 4U2KA 3KQNA 1NJFA 4X20B 1NYQA 1LSOA 1UFRA 3A4MA 3MS7A 1QQTA 1I2CA 3G5MA 1QDUA 1L4UA 3PP8A 4J4BA 2YJ4A 1W5EA 4B7CA 1NRIA 4BY9E 4M1ZA 4TRMA 2P75A 5L7YA 3ZLBA 4INJA 4LS3A 3M0EA 5TMEA 4CUZA 4OIFA 4UZEA 2EKLA 4J76A 3ICPA 5A5FA 1OKKA 2PFKA 2VZ9A 3LWZA 4J7CA 2PL5A 4J03A 4KMMA 1GA6A 3CPHA 4C4PA 5F7OA 1V95A 1T6XA 5LMCA 2C2KA 5D3MB 3X1XA 1W48A 2FW9A 3PEFA 1A2KC 4M9RA 2QL6A 3F8TA 1E9DA 5GAJA 3VMFA 3D3WA 4A0SA 3UJ6A 2H9IA 3ESCA 4N3CA 1M1YA 1BROA 1SOWA 1ZGBA 4IMJB 5DNYB 3P71T 2BELA 4JYZA 3PHJA 3R44A 3UC9A 3IOMA 4KHPB 5AIAA 2CZQA 1Z4KA 3LYHA 1LQUA 2XV1A 5CNMA 5AQ1A 1DPFA 2YICA 5CFMA 4YP6A 1B6GA 2XMBA 1QOQB 2OCGA 1MO2A 3S8MA 1QU3A 1NIJA 2O23A 3ZIDA 2D7JA 5FL7D 1MAAA 3T7JA 1JT2A 4FSDA 4DG5A 1D2AA 1SVUA 1GRQA 1WU8A 2WF8A 3IILA 4Y2RA 3NHSA 4DCCA 1MNAA 1ZM7A 3NBAA 3OU6A 3ZHVA 1MW9X 2VAWA 3LI2A 1UINA 2V7QD 4OXKA 2HL6A 5L51A 3FYSA 1QJ4A 4PYNA 2LNDA 1CQIB 5JYDA 2R6JA 4JUCA 5AWFC 4DT1B 2HPZA 3D6MA 1WSAA 4M0CA 2H2HA 1FFHA 1UM9B 4MGHA 4W1QA 5FI0B 3N8DA 2AF3C 4O8CA 2QJTA 4BJHB 4ZYUA 1QS0A 5A04A 4BMNA 3S44A 3TRIA 3E8SA 4CN8A 2X5OA 3F98A 4BO7A 2DPYA 3I39X 4RELA 1TL7C 2Y0PA 1LDGA 5CXSA 4D02A 4EYQA 2B4QA 4S1OA 3F3MA 4HAUA 4EHLA 4ONEA 1CNFA 2A1UA 3PEWA 2AZXA 4XTRA 5KMGA 2QG6A 1JLLA 1IBRA 2BR3A 1IJBA 3UBMA 3D1JA 5FRDA 2WJPA 3L49A 1V9SA 1B16A 2OD9A 2Q1TA 4Q3NA 4QOIA 4RJTA 4MKXA 1IZ8A 3TDMA 1MABA 5CDYA 4LJ8A 2PG3A 1GVHA 2BCEA 2NZWA 3LCRA 5CLHA 5GTDA 3DBOB 5DM0A 1QP4A 5B3JA 2BLNA 4QUKA 4IWNA 1E2BA 3PFNA 3W05A 3EPLA 4IFBA 4L9RA 4YO8A 3K73O 5KYYB 2O1WA 2XNDD 2BFCB 3NHMA 2R6R1 5K45A 4LQLA 4AMUA 5IBCA 3JQ9C 3T61A 2A7XA 2BEVB 3O31A 4BX2A 3L6UA 1PK9A 4FILA 5AVZA 1U7HA 2ZUSA 1Q0SA 2C04A 3EFEA 3TKYA 4UHDA 4JDUA 3FUCA 4MNTA 3RYCA 3W6UA 3FDXA 3IESA 3K2IA 4DY4A 4P4NA 1A77A 2J31A 3MGGA 1KSGA 1HY3A 3F4LA 5EEHA 3WB0A 5BSKA 3K6JA 3MS2A 2ZJYA 5IAEA 5J43A 2HKIA 4J4TA 3DCIA 1QIDA 1QFYA 2F7SA 3CPSA 1OYOA 4B48A 4OHRA 1E20A 1GL6A 1RM4A 2Z8ZA 4CEJA 3EQ6A 4QODA 4EM6A 4LSGA 4IBOA 3GLGE 1YDFA 3QU4A 2FFQA 4M7OA 2GD0A 4GKAA 1QIJA 3BDVA 3K35A 3NAMA 4YRCA 3LF1A 2FTKE 2MSCB 2J3KA 3C3EA 4EKDA 1K4KA 4IDNA 3EXAA 4N12A 5IDXA 5LQDA 3Q9LA 1KSHA 121PA 1H3EA 1ZSVA 3BERA 1IBCA 1NLFA 1R4ZA 1Z35A 1YZVA 5D51S 3REQB 4I1RA 1YBVA 5IH7A 4D8YA 2A6PA 3BXHA 2WVJA 2BGIA 3LWBA 3EHDA 3EHEA 2E9SA 3GEMA 3KT8A 4ZOBA 1XAIA 1RAEA 4PTZA 4BN4A 3R9KA 1M1NB 2V98A 2QTHA 3AB3A 3ANYB 4EGAA 4AKSA 3K1YA 4X61A 3UFXB 5ENDA 4PVCA 3ZLJA 3BQNB 5HF6A 4DM3A 2QN3A 4Z2YA 3NHJA 2PTGA 3JVEA 2H3HA 3DYBA 2FPUA 3O91A 3BD7A 1AV6A 4TXMA 2IIPA 5AHKA 1JS1X 4JI5B 1T2NA 3MMSA 3FOCA 1X7XA 3ZU4A 2FEPA 5G0WA 1XT6A 4AJ9A 2BHRA 1L5NA 4U3JA 2AQKA 2ZSKA 1WU7A 2Z2ZA 3HNRA 1FRZA 1XDZA 2G9ZA 2NV6A 4GVPA 2A0FA 4UJ3A 1SEPA 3LPDA 4XX0A 4JI1B 3SHTA 4BVJA 4AQYB 2YUIA 4WASA 1K6JA 2EW1A 5C9ZA 4DR6B 2AGVA 1EK5A 2Z9DA 5I8PA 1FP1D 2B69A 3RD5A 1UBLS 2WM8A 4D74A 2XTZA 4P92A 4EY6A 3S2ZA 3A27A 3OM0A 3W3AA 1L7PA 4Y7DA 2CXTA 3ITDA 4ML3A 3EYAA 4U7WA 2E85A 4MRMA 1TVEA 2MT9A 3RSGA 4CIDA 1SCAA 2QMYA 3CRQA 3I28A 3WK8A 1CJVC 1SVIA 3ASZA 3INYA 3OLQA 1L3IA 2JVJA 2CNKA 2O1EA 4EK9A 1KK3A 5KYXA 4KMSA 3WOVA 1A0OA 5KZMB 3GU3A 3HKCA 4CNBA 1NMYA 2AOUA 2P27A 1NSTA 4JJAA 3PTLA 1KP3A 3S68A 4B4KA 3M5PA 1O08A 1ZAKA 2XWQA 4QGFA 3CUWA 4X3OA 1ND6A 1ZMXA 3AR8A 4YT2A 1O87A 1EHCA 5JCJA 4QQ8A 1USGA 3A6DA 2AOUB 5EIWA 5L3VA 1MQ8B 3MJCA 5AM3A 2H1RA 2XLBA 5LFAA 3D2CA 3G17A 3NTRA 4I1OA 4EUFA 2P7HA 2P0AA 1JFSA 1T9KA 1DRVA 3K0AA 1BW9A 2FPLA 1FYDA 2DUNA 4HNHA 2JFYA 1JZTA 2EARA 1SRRA 3GLHA 3TI9A 3ZHYA 1SRQA 2QYTA 3DA8A 3D6UA 2JJ2A 5EAIA 3SBXA 3WB9A 5KOJB 1GU1A 2O5CA 2B94A 3D6VA 1JWLA 1C1XB 1KYYA 3NYWA 1PZHA 5KSYA 2XI4A 3B20A 3E58A 4GOKA 4D9MA 2F3UA 3IMCA 2EF1A 4TZ0A 3L40A 5AUQA 2GLTA 3F6CA 3FI0A 3TW8B 3E3AA 2RH4A 1ULSA 1Z4PX 2HLNA 1G20A 1ULAA 5EQFA 3R76A 3M9LA 1EFHA 2FFJA 5EJ9A 3OY2A 4JBGA 3UC5A 4A16A 1NVKA 5CEEA 2P4EA 4TXJA 5LA6F 2P90A 2RGRA 3I4CA 4ZVQA 4PS1A 4TTVA 2IZ1A 3OJ0A 1NG1A 1PSDA 3OP4A 3QENA 4IVNA 4MW1A 3V1LA 1NNUA 1AQNA 1YQWA 3CVVA 2C5BA 4MRAA 2G25A 2ZUEA 1JI3A 3H83A 1RIIA 4UPVA 4YCNA 2IPAB 4GM0A 1NUTA 4M76B 2B8NA 2GDJA 1U1DA 4DLTA 4QOGA 2Z8YM 1TM4E 5BO5A 4N47A 3FUUA 3VNSA 3KJQA 4D4IA 1ML3A 3HFRA 3O3NB 3E9NA 3MJVA 4JITA 2F4NA 3ECSA 4NZOA 1XDDA 1GA4A 4MW0A 4XIIA 5EKUA 2LPMA 4CTJA 1MVLA 3L92A 4ZYYA 1NONA 2X2PA 1DE0A 2DFTA 2WJHA 2X0FA 1C9EA 2WSLA 3JYPA 5EZ6B 4DCOA 3KSBC 3O2JA 4NG4A 3DLCA 1EXNA 2X4IA 5IVIA 5J4KA 1F7UA 1OPXA 1ZK3A 2RAPA 4NYJQ 2GHQA 3FETA 2BKLA 3PEUA 3UCEA 2GK3A 4YUWA 1Y3AA 2QTVB 3AF6A 5CFZA 2VJAA 1S01A 4BFVA 4UMEA 1EUYA 2RGNC 3U7RA 2V58A 2OP0A 4R0MA 4PQGA 3AOGA 1GP2A 5EJ5A 4HGQA 1E2DA 2F3PA 2TMKA 2YVUA 3AK4A 3ZGYA 4RM3A 2AG6A 2PA0A 2UU9B 4NQZA 1YIAA 3T5DA 3HM9A 5CX1A 3FHTA 2IS4A 2XAUA 3QHQA 5BUSA 4XJVA 5P21A 1H1DA 2J08A 2YY6A 2FX3A 3PR2B 4X92A 4R2MA 5FWXB 3FCYA 4BFWA 1VJRA 1VXOA 1WMEA 4WL0A 3M1YA 4LBWA 5JBNA 3AVVA 1BHSA 2VUIB 4NPHA 4MB0A 3SZRA 1W36D 1UFKA 4ZU3A 3KQKA 4WERA 4BAUA 4GC5A 5IVDA 5AW8A 2UZ1A 3GDWA 2CNWA 2X8JB 3EVGA 5SZJA 8GPBA 1IHDA 2BZSA 1O97C 5LXTF 2QW1A 2XUQA 1ZCFA 1NF3A 3GFOA 1JTVA 3WWCA 1DV1A 4KV9A 3AVUA 3WLIA 1DB3A 3T9EA 4HEQA 1AUVA 3P96A 2I4LA 2R25B 1KH2A 2XDWA 3CH4B 1XFDA 4OQNA 5CIYA 3G0OA 3RAEC 4G9BA 4QGGA 2XMQA 2O2XA 2JEZA 5DMXA 1O8CA 4WA8A 1QS0B 2GJKA 4IQGA 4Z49A 1EJ2A 2Q29A 5LU8A 1IEQA 1GCIA 1GGMA 3CN7A 3RKRA 1Y6RA 2QRUA 4HFMA 1ZMOA 5B3AA 3SYKA 2AFIB 3D6NB 3B8EA 5AM0A 1JJAA 2ZR9A 2C5LA 1G21E 4GGMX 1O4WA 4Q24A 5CT5A 2L18A 2RGGA 3NDIA 4CU5A 5CJ2A 1MABB 2W6OA 5GM1A 3GFBA 4EF5A 1CLEA 4ZCSA 3IALA 4F4FA 2FK8A 3WGIA 1QO0A 2ZYTX 5FV4A 4E5DA 4IDBA 2GEUA 3DL7A 1U1CA 3ETEA 3ICCA 1CUJA 3WIDA 5IJZA 1OY1A 2YMMA 4D46A 3VKGA 3TIIA 4LX0A 3UKOA 1V8FA 1U0OC 2F00A 3MIZA 4RTLA 1OV4A 5C3MA 1CUAA 1TGYA 1BWRA 5HMLA 2R97A 3IL2A 4HH4A 2JK0A 4GSYA 1ZI9A 4LGCA 4FQ7A 4J0HA 2PNJA 3TIFA 2IYFA 1WOYA 4K2AA 2MCFA 3TLJA 1F0YA 1YZHA 3AM4A 3BMCA 3E22B 2QTNA 2XZTA 3H7AA 4GVLA 1SHTX 4MV3A 4OHFA 4QTYA 3DP7A 1IIBA 5EZ5A 2ACKA 1RI4A 4XFJA 4BNUA 2HFKA 4FFWA 3H4MA 3KQSA 2XEDA 3UGTA 5MDHA 1VTKA 1Z4JA 3QH4A 1SBZA 4NDNE 1YBHA 4XGRA 1I4TD 4QEDA 4U7TB 3VGPA 1J7KA 1ZCJA 2WM9B 3TLGA 3ZHQA 1H1LA 4AK9A 5CVDA 3F78A 3AHEA 2F1KA 3FHLA 2X8AA 3ORYA 3P1JA 3NOQA 4GZ3A 2AE1A 1CF2O 3C5VA 1W96A 2X5XA 3CUSA 1HE5A 2WD7B 2G5CA 3O9MA 4FIZA 4YS6A 5J58A 4LGMA 3K9WA 3UATA 1TVCA 3WBJA 1J0DA 3OTIA 5YASA 2WJWA 2ODPA 3LQKA 3S2IA 4B6FA 1E7MA 2XWSA 4DBLE 3CW2A 1RQ2A 3ZWXA 4PM4A 5FF9A 4UHBA 4NOMA 1AURA 2Q27A 2GN4A 3E3LA 4C20A 2NZUG 1BRMA 4US2R 1QQ5A 3DF9A 4MPRA 3PC3A 2OXRA 3F0TA 2CKDA 2WYHA 1VHWA 4X1YB 2NPOA 3RTAA 4XDGA 2DTXA 5HUQA 1VHTA 2F48A 3G2NA 3LCUA 4AUNA 4HUQB 1HDCA 3EGDA 4MW5A 1KJ8A 3Q87B 3ZBTA 2XNSA 1I3KA 1JQDA 3N8KA 1W4RA 4NCKA 3RS5A 1PR9A 1VI6A 3OEWA 4G4IA 1EXWA 1SM4A 2A30A 3L0SA 2NT3A 1BD4A 1DBRA 4H08A 1EG7A 2W00A 1NN3A 3C45A 3KV3O 3VDNB 4PYMA 5CM9C 1G2OA 3CXUA 3N6XA 4OQDA 5CDUA 3HB7A 1RXVA 4LRTB 4F85A 2EBWA 4BO2A 1MLDA 4FZRA 4CMKA 2HLPA 1UEJA 4HVTA 2W48A 2ZXEA 3GAFA 3N7TA 2HADA 2VLIA 2WM2A 3D7SA 5EVCA 2C2WA 3VZDA 3BA1A 1YGYA 1R27A 4NENB 4TT3A 2ES4A 4X64B 1U0JA 4WE3A 3AB7A 2JG3A 4JELA 1Y4AE 3KTAB 1R0SA 5ICSA 4GWKA 3GXOA 4JT8A 4MINA 5FOTA 3A25A 3BZBA 3GZJA 3OHMA 6PFKA 5IXSA 5F98A 3O83A 1TT5A 1XOIA 2V59A 5KYWB 5LQJA 1NR5A 1TUEA 2E4UA 1OFTA 2DHRA 1DXOA 1UJNA 1RPJA 4FYPA 4TMXA 2D1TA 4BB9A 3TO5A 3B85A 3FSJX 2LUOA 4HRAA 5A4KA 4B33A 1F38A 4A9AA 2ISSD 3LUDA 5JJCA 5JTUA 2UZ1B 2QDXA 2CYAA 1GNRA 2RBGA 4QHSA 2MSWA 5AVXA 4Y9SA 2PUBA 4TVOA 2PRKA 3DVAB 1VIYA 5FPSA 1N9ZA 4H3SA 5KNCD 3RJ5A 1Z2NX 2NP6A 2DCMA 1I0LA 1V2GA 1TT5B 4HAIA 5KYWA 3SJUA 2QUHA 2GN9A 1J9ZA 5FBVB 3DXXA 2Q2VA 3ZKWB 3SHOA 1NOIA 1XR3A 3G2IA 4RZQA 4AZTA 5ETJA 3BJMA 4RD3A 2JK1A 2OYSA 3F3SA 5E8RA 3CUTA 4EG7A 2RGNA 1H2XA 2ZB7A 4JU9A 1CZOA 3N6RA 3PXEA 5D5HA 1FBTA 4BFZA 3OPNA 1QHHA 1P2GA 3VHXA 5BORA 1K5HA 4EHNA 4A0RA 4F2WA 5H9WA 3VC3A 4WJKB 1KF0A 1LVUA 2O7SA 3N2NA 2BP7B 3PENA 2J30A 4DYHA 1OTYA 5ISMA 3Q8MA 2K7FA 2V9PA 3TYXA 1EFRA 1UEXC 2LIVA 4F5EA 5CA1B 1JB9A 1NBOA 1IYZA 1KBQA 2BFDB 5BRJA 1WB9A 1PT6A 3KE9A 4RFSB 2OUIA 3COZA 3SK0A 4V24A 1L5ZA 1JLLB 1UBSB 2OZLB 2QVGA 1QF7A 2X3FA 3DCNA 4MWZA 4Q9DA 2XYHA 3Q5GA 2JKVA 2AUTA 4J2OA 3HVKA 1RQNA 2CB0A 4UM7A 4ZO6A 2HMVA 4UU8A 5TRTA 4QYTA 3RS0A 1HT0A 2GEVA 5E95A 4D9JA 5DNCA 2I29A 5IS2A 1U90A 2QRHA 2ZULA 2H4XA 1ABEA 2J9GA 2I5PO 1OAKA 2YHIA 3F1LA 2B4AA 2QI9C 4O2RA 1JKIA 4DILA 1G41A 3AWIA 5FA8A 3B1YA 1R4AA 2F3TA 3FTPA 5ENVA 1B00A 3BGDA 3GEGA 4ZO8A 1Z5ZA 2AVNA 5CB4F 2AW5A 3HNOA 3MT7A 1OZ0A 2GM5A 2H2AA 5LB4A 4I66A 4UQPA 4U9IS 3VR2D 1JEYA 3FTQA 2HUNA 4LZNA 4NF2A 4OQYA 2JEYA 3KT3A 1KI1A 4MRNA 2R1VB 1AQUA 1YL5A 4MWTA 4PQEA 1N5IA 4Q16A 4YR9A 5B7NA 3AR4A 3MJHA 3J7TA 1QHXA 1R8XA 1Z6ZA 2IS6A 1YHNA 1TTQB 3G0DA 4G6ZA 3NUGA 1KYIA 2NZ2A 4DV4B 4OHWA 1A9ZA 1HEUA 2R1VA 4PAGA 4RV5A 1CZKA 5C34B 3SSMA 3U0BA 3JAKA 3G0IA 1A4UA 4AP5A 4E70A 5IKMA 1HLFA 2W42A 4OLBA 1T10A 3ZS9A 5I51A 1JMYA 2H4HA 3EDRA 4KR6A 3S2GA 3NM6B 3VR4H 2A3RA 2O59A 4ENRA 1TT7A 3AQIA 1J7JA 3BDIA 3N7AA 4G0PA 3JQ7A 1Z39A 1JJFA 5IJ0A 1PT7A 4CLOB 3C5EA 1PGQA 4PNEA 5JNSA 2CDRA 1MH9A 2HSGA 1LTQA 2XNHA 3LHKA 3LQRA 1WXQA 2JGDB 1U11A 5IC5A 3V9PA 1M5UA 5EWMA 4D9NA 1N78A 4JNKA 2WKQA 4KRXA 3QJYA 4URHA 5JAPA 2B4TO 1L7EA 2WU0A 4LY9A 2PWPA 4NCJA 1L8OA 2AOVA 2BUAA 4TMTA 3ZH2A 2ZBQA 4UMFA 4Q4LA 1KU0A 1RYEA 2FMXA 1U5AA 3L4SO 4EI2A 1CDDA 2I34A 3FW1A 4KYTA 4CKYA 5C4GB 2IBMA 3EH1A 2ORYA 4EPWA 4EY5A 1VDMA 3ACCA 3CR3C 3NKLA 4N7RA 1OYYA 2OQRA 4E5UA 4MITA 1SCIA 3RSFA 1JUDA 4A8JB 2OHHA 1UZNA 1HE3A 2Z1MA 3BQMB 1V45E 2EHJA 2WNHA 3RGGA 2IS2A 1ZGCA 2DQ4A 2YHIB 4KWEA 5COQA 3ABOB 1Q0HA 1TZMA 1W87A 1Y42X 4MWGA 4CM1A 3UGKA 3Q3EA 4WVLA 2W6JD 5ARDA 1GARA 1V5IA 2I7DA 4DVGA 3ZDBA 3KVNA 4KBFA 4XWGA 3PFIA 4JSYA 4MDHA 2I8LA 2XGMA 3L8CA 4BQSA 1N0IA 1A04A 3KPJA 3LCVB 4TWRA 1JIJA 1SD1A 4ARIA 3SC2A 3WWZA 1A3CA 2VUUA 2ZYHA 3CE9A 4MVWA 4MUXA 4NCHA 4ZYZA 2PUJA 3MEQA 1M0EA 1DKRA 4KWHA 2H85A 1CY6A 4B87A 5BQ3A 3IV7A 2BN4A 2DQKA 5JJBA 4OQMA 1ZP6A 3NVKI 3UH1A 4EQ6B 4YREA 1FEZA 4H4DA 1K5PA 4FZ5A 3RBZA 5CK5A 4MAAA 3RBVA 5AW9A 1Y9JA 5BVGA 1KEZA 2GFHA 1EFAA 3B5JA 1F2DA 4UOEA 5ED0A 3DW3X 1ZD5A 3I6MA 4MR8A 4WDQA 1ZI6A 3LYLA 4JU8A 3UTCA 3FDZA 3RYCB 2MIIA 3OKPA 3ZKWA 4ACAA 5KTRA 3R0QA 3SDZA 1RHJA 4NCIA 4PGAA 4YLYA 4HNVA 4PZPA 2QT0A 3IB3A 3UAOA 3RSQA 3Q5EA 1M7BA 1VGVA 2OGSA 2WPDD 2HQBA 1V11A 2QI9F 4LJLA 5F5XA 2ECKA 5CH5A 4B3JA 5KNCH 1YNSA 2R1UA 2VHTA 4ZC8A 2VDRB 1WXXA 2VQ3A 4W1SA 3K0KA 3Q4GA 3SR4A 1CB0A 3WMRA 3ZQUA 1M9NA 1Z0IA 4Q3OA 1VSVA 1XI2A 4POAA 2PLRA 1NY6A 1PVVA 3PNYA 3V4PB 5SZHB 5T6MA 2GF0A 3DMDA 5E6RA 2QTWB 1HH4A 3W9UA 3LT0A 1S7GA 1YRBA 3U1VA 4ZEMA 3IIKA 4FR2A 5I9NA 1MW8X 2Z3ZA 4UFNA 2PX2A 1AKTA 4NV3A 2DBYA 3RKSA 2VDWA 4PO1A 1PFGA 3OJXA 2QUIA 2W2TA 4AJKA 2AI2A 5AK0A 5ALRA 1RRGA 1NVWQ 2D59A 2PWAA 2VCYA 1OWPA 3GBSA 1Z06A 5ECWA 2IK8A 3AOEC 2GUGA 1TCAA 2OD2A 1DWPA 2GSWA 4KFSA 1NW7A 1U8TA 1SKMA 3BMXA 4TWIA 1V48A 4RJ2A 2ORVA 3RSHA 1GGFA 2IPMA 2V4ZA 3C5HA 4FFOA 3TR5A 3W78A 4XUCA 3C7KA 3I45A 1VL8A 3O8DA 1S4MA 1XBTA 1FSPA 5FYDA 3R6DA 4MYCA 1M2GA 3IUMA 1Y1PA 5HQ3A 5I01A 4F06A 3Q7IA 2W11A 1K0FA 2J07A 3ZU2A 3EPRA 3T3DA 3FZQA 2WNSA 2C4VA 3O8BA 4I08A 3H11B 4LA4A 3UEOA 3ZE9A 3B9QA 3H9JA 1E7WA 3IUQA 4CMBA 2VJQA 4R68A 4ZALA 4RY2A 1XMOB 7ABPA 2G17A 1O77A 5DM2A 2QW0X 3TS1A 1B0UA 2H51A 2VNJA 4XIJA 1EEXB 5DNWA 1D1TA 3VUEA 3ZIAD 3BA6A 4YAFA 1IULA 1SR8A 1Z4NA 4JCOA 1EESA 3O3MB 4X24A 4Y2TA 3TQSA 2C77A 2Z9CA 2XUFA 3KLMX 2ATEA 2V0CA 3KDSE 3NWPA 1Z88A 4Q03A 5B12A 1VHLA 2VPTA 2B8EA 3VYUB 2HSEA 3BKXA 4I1VA 1BCSB 2H6EA 3WQHA 4AMVA 3P9CA 5I4BA 4MKGA 1T1SA 3KDPA 5DLQC 3BE4A 4Y9TA 2AJ8A 3TJMA 2WP0A 5FR1A 4MVJD 3X0DA 4UEOA 3IXMA 4M38A 1VCIA 1DUSA 4QFDA 3N59A 2ZRLA 3B51X 1H2FA 1W4AA 1UPTA 2YV1A 4M0FA 3TTTA 2HO5A 2RGDA 3TOVA 4M7RA 4YI3A 1KDVA 3VSDA 4RQTA 4DMLA 4EMSA 1T2DA 3NUZA 3PE3A 1ZWKA 2YJ5A 2ASVA 2AFIE 3N58A 3KRTA 1EXVA 2LBPA 1Z47A 3HUDA 4MVJE 3ZD6A 3K15A 1GG9A 2FZVA 1SB9A 1X7ZB 2H2GA 4JIMA 4BZQA 2H5IA 1BE1A 3C70A 3IVGA 2CCGA 3E9RA 3NHYA 4RPGA 4LV6A 1EVQA 2PUVA 2X58A 2ZKIA 5G0SA 1CRLA 2ZIAA 1OLSB 3L3BA 4O0LA 2XF2A 1UZMA 4HXEB 4DLSA 4FYYA 4ER0A 3S1SA 3WBBA 4NS1A 2A9PA 3VRHA 1P1KA 1PK7A 5J2UB 3S1LA 4ECAA 1OPRA 3ITKA 3ZQKA 7ADHA 4FJ1A 4ENPA 1UKZA 1SIUA 7REQA 2B2XA 2XOKA 1Y98A 3EE6A 2FPWA 3QVVA 4JT4A 3RRJA 5JARA 1AZLA 1T8YA 3MWFA 3ZK9A 3RADC 4S1VA 3DPIA 5JISA 5A4FS 3HWWA 4HDAA 1MF7A 5H70A 1ZVVA 4YWHA 2Q49A 3VPSA 3R75A 4LXQA 1T8TA 4UHJA 3GLTA 4LJRA 1NQOA 2GARA 2Y71A 2WKWA 3BH6A 3I2JA 3NX4A 4KN6A 4MQEB 3ZDZB 3ID6C 1RRVA 2OHOA 3VYRB 4QARA 5JZSA 7MDHA 2ZKLA 4P7JA 4O3MA 1M1NA 4ID3A 2OP1A 1Y8ZA 3NCTA 2CLCX 3K5PA 2VDWB 3PFBA 1ILWA 4KI0A 4UAJA 1UMDB 3U62A 2R96A 1PFUA 3KUUA 5HZMA 5A0TA 4MQFA 2I2CA 1MVNA 1SC3A 3AT1A 3FSEA 3QP9A 3PKIA 3HZOA 3FKJA 4ZI7A 3GNQA 4M0LA 4BLQA 4FLEA 1Y1KE 2H00A 4E30A 2NVUA 2XYPA 2ZI3A 3GNLA 1Y89A 1FTSA 5DW0A 4RXMA 3GGJA 4KQCA 4PSVA 1ZNXA 4KO2S 1RWQA 4BWVA 3IPRA 3FYTA 4Q4JB 3IA2A 2FQXA 2GVZC 2JCSA 3AKCA 4GGPA 4P3XA 1PWEA 2WHYA 4LAFA 2IL1A 4IUDS 5HKOA 1JIKA 2H4ZA 2Q3HA 1N25A 3W3ZB 5H83A 2J0UB 3N8NA 2DT5A 1RM0A 4BNTA 4BRZA 1QP0A 4D56A 3OJEA 4J49A 1UDWA 2Y92A 3BWYA 3MINA 3NHZA 4ALNA 5FIUA 1VA5A 2HJ9A 5B6JA 4FHGA 4FWBA 3WRXC 1L7BA 3CF2A 5DCUA 4C3ZA 1WCIB 4ZODA 2WB2A 2PSSA 3LPMA 4AXBA 1HT2E 1KIFA 2J5XA 5IM4A 5B57C 1GT91 2OGTA 3BILA 3FB1A 1BGXT 1XDSA 1TQ8A 3GJ0A 3P9ZA 4RMJA 1E1KA 4HH3C 1ZK2A 4W4TA 3LTNC 4A82A 1Y80A 1EVJA 2NAPA 4KNWA 4PLTA 3T94A 4AF7A 2I71A 1U94A 1GXSB 1ZL2A 1X8XA 5IEBA 4EHBA 5LWQA 1ZHOA 4ASUA 1I2DA 5EHQA 4HDSB 2JI9A 3OX1A 4MR9A 721PA 4LNUB 4GQIA 3DOEA 4ZI2A 2XOKD 3P9KA 4ME6A 2P9EA 1KTIA 3KXLA 5CX4A 5GGYA 2ZE8A 4QDOA 2E18A 4OHVA 1G3QA 3BXFA 4I36A 3OZEA 3ULKA 1CJKC 1L1EA 3BWDD 1J0XO 5JJKA 1QVAA 3EDCA 1FFDA 1FL9A 3AM5A 1HKUA 2FW6A 3AIIA 3DL0A 3TLAA 4D8WA 2A1UB 1P5FA 4KLNA 4I14A 1RZVA 4KQIA 1FU8A 4HAOA 4BRWA 2W43A 1MT3A 2ZYVX 3DHEA 4HEA6 2R8OA 4AX8A 1UWKA 1JDJA 1AZSC 1ZG3A 2OSBA 2WE7A 2XGSA 2YC2C 2CUKA 1NNI1 4G4SO 1GGJA 1YAJA 3HZRA 3OCZA 5HIIA 4FGWA 2VRCA 1GD1O 5A7HA 5KVQA 2NUTB 5KOIA 2DULA 4HLDA 5JR3A 3EEYA 3L82B 3X1WA 4R7TA 5EYPB 2IOYA 1W25A 2NZJA 2ODTX 1YRLA 3VDQA 4N18A 1NXWA 3T3IA 2B98A 3O4IA 2P6MA 2PV0A 1MGOA 1CUFA 2VAMA 1OVMA 2I62A 2VQ6A 4GNKA 4LRUA 4O02B 1JP7A 4YRQA 1UKBA 3NZEA 1RC1A 4LTMA 3RREA 821PA 3HY3A 4IZHA 3UW1A 4DWJA 4JYPA 3BE5A 5H82A 4B43A 4X66B 5ALUA 3CEMA 3WLQA 1NU8A 3ZN2A 3O4HA 1YU6A 1QGAA 4Y2QA 1M8KA 4N4AA 4Y2VA 4TV9B 5LMUB 3F7NA 3K9FC 1W75A 4EZBA 3QKTA 2QM3A 1POXA 5HFAA 2AFHA 4XCVA 5JI3E 2X0IA 4A7PA 4ZTZB 1VSBA 2O0HA 4WZBB 4R1MA 4DQXA 4DQ0A 1RZRA 1JJIA 4G81A 4C0JA 2PH3A 3TJRA 3DWEX 5TQVA 3SU8A 3CKLA 2ZPAA 3PXCX 2J5QA 2AX3A 2BAGA 1M2VB 1RLTA 2KI5A 2Q5EA 2VJNA 3T7EA 3TJZA 3K0CA 5BWOA 1SIWA 4Y1RB 3TLYA 1WHTB 4PYLA 3DJFA 4Q4HA 2MINB 3UMBA 2JJ8A 5L3SB 4WNCA 3Q3HA 4YX9A 3QG5A 4P80A 4DEYA 2CXUA 4EY7A 5BW8A 4TTQA 2PKXA 1I14A 1NQUA 1P77A 4X45A 1AMUA 1E7QA 3DZBA 4WTOA 4EHKA 1A98A 3GYGA 1K66A 4GXRA 5BN1A 5WRFA 3QUSA 4ARZA 2BMVA 1UMKA 4M1YA 1GTG1 1MXHA 2VK4A 3HLTA 4LECA 1W35A 2TRSB 3UQYS 2MSNA 1GPYA 1UWCA 2OZPA 3NETA 3MAJA 4IAOA 5DHPA 2JIRA 4KPUA 1E79D 1STOA 1EP1B 1FC0A 2G1KA 1NY5A 4UUNA 5TS3A 3VA7A 2IIBA 2O50A 3KK0A 5DX1A 1IU9A 2GHIA 3LX4A 2WWHA 4OP1A 1LLFA 4LOLA 5HVNA 2XB4A 4EUSA 3JARB 4IO1A 3DDSA 3W2IA 4UXIA 1RJWA 1O96B 1OROA 3W1WA 2DMRA 2KPOA 2F43B 4RPHA 4ZCRA 3EIWA 1TU3A 1QYVA 1U0FA 2J0EA 2Q0HA 2A14A 3GLGB 1FDRA 4DNPA 2BKVA 4LF6B 2BTQB 5B1SA 3ADBA 4YAOA 1VZ3A 4Y2PA 1MIOA 1WD7A 2OMKA 1LFDB 5KYUA 3U4CA 3VPFA 1FTNA 1QKIA 2XGJA 4H0CA 3A58B 3DKRA 3JD2A 3HLKA 4XUGB 3ZWMA 1QYDA 3BF8A 4A4DA 2HXGA 3M7IA 3VPXA 3RYIB 1E0AA 1KOLA 4YAWA 4UXJA 4UNIA 4YMIA 1L9XA 3UWKA 4FYXA 3UJAA 4UUQA 2PIDA 3IS3A 3LZCA 3WZ2A 3FLEA 3RYTC 5I7VA 3C3DA 3USCS 4XX1A 1GZ6A 3Q9UA 1C8VB 5CX1B 3RRYA 1Z26A 2WHXA 4V03A 3RG8A 4YYZA 2NYAA 3ZU3A 4C4AA 5BNWA 5JO0A 3H5TA 3W0LB 3ZWBA 4UNRA 3EXIA 1CHNA 3GUZA 5JYEA 2QB5A 4D0LB 1R10A 1TF5A 2DG2A 5K4AA 4EUKA 2HDOA 3B3QA 2B25A 4MUMA 5A9TA 1XCJA 1E3DA 3ODGA 5ALTA 1KKMA 3UHAA 3JTEA 1J8FA 2XQJA 4U6NA 1O6FA 3I04M 1XZFA 1QDEA 3QEMB 3BMOB 2FETA 3TMYA 3S40A 4S35A 3P52A 4EEKA 3GK3A 1X7YB 3WL7A 3NOXA 3N8GA 4RTPA 4B0PA 3NHFA 3EEIA 4B09A 4YMLA 2VOEA 4OI4A 4P35A 4JLDA 2O8BA 3MNFA 1ZVMA 1U4OA 3GDHA 4CL8A 5L4LA 2AI1A 3HYNA 5J5AA 3AWDA 1IZ0A 2V6BA 1Z2DA 4KP7A 5EE3A 5HF9A 2FOIA 1RIFA 2BI7A 4IIJB 4JH0A 1VOTA 4M0KA 4U02A 4YJFA 5JAOA 5KU1A 3U4QB 1FRFS 1C1DB 3ANNA 4R40A 4B3IA 3UWMA 1Y3CE 2ONKA 3X44A 3ZX5A 4ZRDA 3ITNA 4HI0E 1NZDA 5FI3A 4YP5A 3TZEA 5KJFA 4DFDA 2OA0A 1ZH0A 1TZCA 1XTIA 1YCFA 4COOA 5LQMA 3DW1X 3DMYA 3F5FA 3KJHA 2AVDA 1I2ZA 3NIFB 2O6HA 4I9FA 1QVZA 4P4TA 3IAXA 4L76A 1RMYA 2JFZA 1Z8DA 3MMNA 5CW1A 4AD8A 2JI4A 4BMVA 5E4TA 2H18A 1B6RA 3WSTA 4PVDA 1JIXA 1OWOA 3I5YA 1U3VA 1R4NB 4Z3DA 2Z5VA 2ZVPX 5CXQA 3RRBA 3OIWA 5DDIP 3DQQA 1T0UA 3RC1A 2COEA 1JSXA 1ZK1A 1GR1A 1PUXA 3SLKA 5FFFA 3A0RB 1KMNA 4R1TA 2ZTSA 3K1TA 5T4EA 4WK4B 1GKIA 1LVGA 4L22A 4CMEA 1JXOA 5D3QA 3U40A 1EX1A 3WRYC 5IHPA 3ZJ4A 3AVXA 1SBHA 3T0IA 2IEZA 2M1ZA 4JQCA 3AJDA 1OXUA 3UG6A 2GN1A 3DZDA 1CXZA 2OBNA 1D2MA 1LNSA 1QC5B 5DT2A 4EDFA 5KYKA 3J80A 1TTPB 1OI4A 2PWBA 5ANRB 4EKIA 1T5TA 3UJ8A 2X0JA 3PYMA 1O03A 3LKZA 3N05A 4L5CA 1UJ2A 4MJ7A 3HKEA 4F45A 1A9SA 4OTZA 3AU8A 2POQX 1H1LB 3JQAD 3PITA 2X23A 2W2KB 2JGJA 2F62A 4C04A 3KKNA 2C00A 5AICA 1O9GA 1OXMA 4FT4A 4LE1A 1T9DA 2HB6A 1IWPB 2JRCA 4H7HA 3V7NA 3VQTA 2JFVA 2BE7A 1HSZA 3AM1A 4PX5A 3FUXA 3L0YA 2QTLA 1XYVA 3GGDA 3H8WA 4JT9A 3HZZA 2DR3A 3CCFA 3KR2A 2PQ2A 2QTMA 2WJGA 1ORRA 1UXOA 4P2GA 5DSTA 1GQFA 4DMRA 4Z9AA 1JLKA 2GLXA 5EUBA 1DQSA 1KEWA 2VWQA 4B3MB 1BU5A 2C8JA 3L02A 1W5AA 3H8JA 4GWGA 2QD3A 5FLYA 2NTYC 4DLXA 3DZGA 4HAWA 2LVBA 4DR2B 2GFIA 4KBGA 5AOVA 3HABA 3IJEB 1Z17A 2L17A 1QHGA 4PYKA 4RPLA 5C8ZA 4KE8A 5JWRA 4QO8A 1Z5UA 3ZIAA 1W30A 2ETVA 4IGEA 1KNXA 3HVJA 2XZOA 1ODLA 4U2BA 3ZI7A 1KFKB 3E35A 4H6XA 3MJFA 1LK7A 1V6SA 5HK8A 4YT8A 1AUXA 4Z7NB 3FFAA 3M34A 3NBUA 1OYVA 5FX2A 1GZVA 3IMFA 2BGMA 4PFJA 1CEQA 5DBFA 1T3LA 5CPBA 5JDIA 2P68A 4YEDA 3K4QA 4NJMA 2GAIA 3ISVA 4JI3B 3L7CA 2GN0A 2VI5A 2AFIA 4LC1A 2EKZA 5KTYA 2GBLC 2MSKA 3I76A 4S0ZA 4UMVA 1G0OA 2CVFA 3I58A 3VHXB 3DD5A 5CDGA 1RXEA 2DKNA 1RQRA 2FMHA 1AOXA 1W29A 1Y5RA 2R11A 2ZIXB 2ZVQX 3GPDG 3JCZA 3IBGA 1AMOA 3NTOA 4JHXA 1AJEA 2J09A 2J4CA 1GAWA 1UMCA 3ZHZA 5T4FA 3BT7A 5F5NA 4IJ5A 3DBRB 4NJEB 3RS3A 4RWEA 3VR5D 3D8BA 3KDAA 5BSEA 1CE8A 1YL7A 1ZR2A 2G4CA 6YASA 3RRNA 2HBZA 2VK8A 1WXGA 4IFEA 4X8OA 2C94A 3LRXA 4NPAA 5T3UA 4X3PA 2VJMA 1M83A 3AERB 5TNXA 3BBPA 4QEZA 2GO7A 4BO3A 3DTYA 4GLLA 3TIGA 5C8DA 3DDWA 3ZW9A 1Z6TA 1WMAA 3BMOA 4FDMA 3LPNA 1QP8A 4MUBA 3QLTA 1MX1A 3FUWA 4NFSA 3KLNA 3QLVC 3UPTA 4MCHA 4EAQA 3PNMA 1G16A 1L4EA 1MO5A 3P0EA 3JASA 4JP1A 2WB4A 1M6NA 5TEWA 4UD2A 1E2EA 3KSMA 3HA7A 1M6HA 3QEOA 1H0SA 2ZSUA 3HP4A 2ZQZA 1JQEA 5KHAA 3FYCA 4MV1A 1D1PA 1XZAA 5JC8A 1OBCA 2ZUWA 3P5SA 4QUBA 4UBJA 3SN6A 1SK8A 4B6QA 4C0QC 2WUFA 2VJLA 3NWEA 1T9CA 1CJMA 4K9DA 1JNXX 4NICA 4MZDA 1I7LA 2F9FA 4R9RA 1X8KA 1Y8RB 2RFLA 3DMNA 3H9UA 4ATNA 1MOSA 2P2LA 3UK2A 4JVMA 3C39A 4F2GA 3G9QA 5I7HA 2GVNA 3HDGA 5HBGA 4XCXA 2W8ZA 3CC8A 3R1IA 3VNAA 4NDZA 2JLXA 5K99A 3NKFA 1E5DA 3WGQA 4DUGD 3TXXA 5B37A 4LYYA 5J40A 3ACDA 5BR7A 4QEKA 4R05A 5TMDA 1C7IA 3OPVA 3FG9A 4IGFA 5EEGA 2NUAB 1M74A 2JANA 3DTVB 4S1NA 5H68A 1C9KA 1GYRA 1W1UA 3I9MA 4K9KA 3V32A 3U31A 1S5PA 3R2JA 5BNFA 1VL1A 3UJ3X 5KX5B 3PQ7A 3QMPA 5F23A 4B3SB 2F3SA 2WMOB 3WJ2A 5FI1B 4CPDA 1P31A 5K4HA 3FZEA 4K2HA 1W19A 1TK9A 1FUYB 4YJ3F 1KI8A 2VPZA 4H15A 4O59O 2Z5GA 1ISRA 1CJUC 3K8YA 4IEEA 1AQ6A 4XZ3A 3FRJA 3BWBA 3CLKA 3TH5A 4A26A 5K01A 4HX5A 3LDFA 1WW2A 3C3AA 1E7YA 3M6AA 4V3CA 5HJ2A 4JI6B 3U9LA 5EI5A 2XX3A 4UVHA 5DSXA 2OC4A 4GS5A 4BGUA 2QN8A 1D7AA 3QIVA 2Y8EA 3BYZA 3E84A 4BNJA 1U98A 1SZDA 3A1EA 4MKIA 1N2CB 4LN1A 4MWDA 3PNVA 4UNPA 1YZFA 2ADFA 1G9SA 1LBIA 3CURA 1VG9B 4XA8A 3HUTA 4L27A 1JR6A 4G24A 2HA4A 3WLOA 4DIUA 1QHEA 3UJNA 2OV2A 4FGKA 1JDZA 3L46A 1PLKA 1NQTA 3QXHA 1XRLA 2XUZA 1RWWA 3WKCA 3IE1A 1JKJA 1XYYA 2CVOA 4XIGS 2QP4A 4JVNA 4ZT7A 4OHYA 3FBGA 1TQDA 2RHCA 4U39A 3EF3A 1Y9EA 4PG8A 4KNYA 4W5NA 4QFMA 3SNHA 3MPUA 1AE1A 2W22A 1H9CA 1OFGA 5AESA 4LMAA 5G0TA 1C1XA 4AJOA 2FDXA 2OL4A 2O0MA 4EOGA 2HF9A 1FDSA 2QLNA 1UJ6A 3CJQA 3HFSA 1YWGO 3NM4A 4MUIA 1AQJA 2OVFA 1RD4A 4G8CA 3NVMB 3ZWWA 3LXXA 1X87A 2WTEA 2B1RA 4HY3A 1QAOA 3ELUA 2EEPA 1T43A 2DUJA 2XWPA 5CFRA 2Y66A 1QSGA 1L4KA 1G21A 1HORA 1VRVA 2DY0A 3A1DA 3EGCA 1XL1A 1GNVA 3PICA 5FHQA 3RAGA 1YRQA 4V0NA 1DAOA 3DV0A 3VX3A 1E1NA 4WXPA 1L5HB 3I01A 1GDDA 2BFBA 4BO8A 4XGKA 4WXEA 1P5ZB 2A78A 3U6BA 1X7XB 4AKTA 1OA0A 1W5TA 3NONA 3U7QB 1GDTA 4JMLA 1KKLA 4H1VA 4P33A 2PYZA 1NBHA 2WJJA 1LB1B 1N2GA 1NWHA 3VSAA 1H6CA 5FUVA 5LDDC 1Z0JA 3C24A 2BD0A 3QIAA 3S1AA 1XRQA 1IZ9A 1E2QA 2GZMA 3K0CC 4NECA 4C7KA 2WRZA 1VIMA 2BI4A 2OY0A 1ZL0A 3NORA 5A3RA 5JZMA 3PR3A 4F91B 1WOMA 3C8DA 3TMKA 5B1EA 2JHCA 4WOPA 4D45A 3W5DA 1OAOC 1PR2A 1ESCA 2BMFA 2BHTA 1E92A 1K8ZB 3G9ZA 4FKZA 4G0ZA 5EIEA 1T2EA 2IXEA 2KM1A 1P4SA 3BHNA 3A1NA 3TE7A 1IQPA 5PNTA 4DCSA 2L82A 1DEKA 1DAIA 4RC9A 2Y4OA 5DOVA 4Z1OA 1IN8A 2G07A 3SS8A 4P0PB 5I7OA 4AS1A 2W0SA 1X2BA 1E1LA 3A70A 4C4ZA 2LCQA 1FMTA 1YZGA 2HNKA 3A37A 1ECCA 2O54A 1N2EA 1ND5A 3EMVA 3IHKA 3LLUA 5BSTA 4DDMA 5HE9A 1YJ5A 4BMXA 4KR0A 5GMOA 4KN9S 3QPAA 2IYXA 2FQ1A 3GG2A 4L73A 3ZCUA 1JDUA 4N76A 4WEQA 3KX2A 1V3QE 1T2UA 1F4VA 3PHCA 1G19A 5LP6F 3C3WA 2PCJA 2R6ZA 1I6WA 3ELWA 3BH7A 4UTVA 5L3QB 2CDNA 3ER8A 3GLFE 1LF0A 5CVVA 4ZMSA 3IT3A 2CZCA 1EBBA 1OTHA 1W85B 3UHOA 3LFTA 4JODA 1WPXA 5BN4A 3PHBE 4MQ5A 4IMRA 4ZVOA 4TS9A 2C7RA 1KOGA 5JSUA 1PDWA 3A6FA 3HI4A 1L4MA 1XV5A 3NKVA 3O2QB 3SHQA 3WLRA 5A1TA 4K9NA 1K8RA 2B8TA 4D96A 1TADA 1ODJA 5I4KA 5IKEA 1A9QA 2HEGA 1JH8A 4UEWA 1ZOOA 2J7PD 3BJEA 3B6EA 3BRCA 5JQWA 1BJRE 1DWQA 3UAZA 1X80B 1Z3CA 2RBKA 3OECA 4H18A 2Q2NA 4BQPA 1V11B 2CFCA 5D87A 2OV8A 1F0KA 4RABA 4LIPD 3T3GA 4HDRA 1DMSA 1V47A 1YC2A 2EQBA 2DWOA 4I4TB 4IUYA 4JLKA 5BMVA 3EXIB 5IM5A 3MUFA 1I33A 3TG2A 3QELA 1IUOA 1KKUA 1F14A 1KERA 2IV3A 3WLNA 3LC2O 2X22A 1JR3E 4I50A 1GAQA 1ZKMA 3BTSA 1QRRA 4DSZA 3R9XB 1SBQA 3C6XA 3DBRA 4UE3S 1F6WA 1G4AE 1G0NA 1OI7A 3D0OA 3EQ7A 4GVXA 2O4UX 1XYGA 5AKJA 2GVDC 4ZXPA 4BAZA 2I2DA 3TIXB 3PUHA 1L5GB 3LZDA 3IYLW 1N33B 4OHCA 2IOFK 4ZOAA 1IEVA 1GV1A 3H6GA 4JBNA 2H5JA 4OIMA 1AGXA 4HYEA 1WF6A 4RVGA 1SHZA 4ZAWA 1T9HA 2IYUA 4BP1A 2Y2UA 3DF7A 4YRKA 3MOIA 4YJHA 5MGNA 2XHEA 1WDWB 4YWJA 3ONVA 5C3UA 1CB7A 4AJ1A 4HRXA 4UAUA 4YCJA 5SYNA 2O2ZA 1JILA 1YASA 3KUKA 2ROQA 1LI5A 2VDKB 3MWKA 5EWJA 3SZMA 4YQZA 1NDHA 4B80A 3IGFA 4KLRA 3TDKA 1CW2B 1EFRD 2DFPA 1D7OA 1XALA 1P6XA 4ZT6A 3A04A 3DV2A 1G3RA 1L5KA 3X1MA 4CKXA 2YZNA 3OC0A 5CB0A 4GH5A 4MMZB 1EFVB 1UJBA 5LQNA 1J23A 3FNIA 1KAHA 1MAWA 3OUUA 3BL6A 1WPRA 3FRIA 1PR5A 4X8MA 3LLMA 1YT5A 5TQ0A 2IBTA 4KTVE 3I8SA 4NARA 2CNBA 4QSHA 1SXJD 2HQSA 1YCGA 1GQ2A 1E6CA 1JPVA 3O38A 4IH1A 1N4AA 1IY1A 5HXAA 3QWAA 1LSSA 1JG7A 4YJ3A 3LSTA 3RC8A 5IXJA 5F7JA 3GX1A 1JFVA 4Q12A 3TW0A 5H3CA 4BAGA 5E3JA 1K7YA 1O0SA 4D43A 1PVDA 2Z57A 1RXSA 3ZWDA 1MJHA 3MGBA 3N2EA 4FTWA 1LTHR 1SOUA 2GJ8A 4NMHA 3RVDA 3IUSA 4BLSA 4MHSA 5FOXA 1PSWA 1A27A 5DGHA 1EA7A 1ZOIA 1J8MF 3WTCA 4BQIA 1VM6A 2W2KA 1IHOA 4DKXA 3F96A 1BCRA 3AHGA 3WGUA 3RIEA 1V96A 3I37X 3BGIA 5AUOB 3I34X 4IIDA 4P9NA 1G21B 2A5LA 3E9YA 1USIA 3BMQB 4UAGA 4XD7A 1WCYA 2QXTA 3VH1A 5LMNB 3O92A 3Q0EA 1OA1A 1PQUA 4PLVA 4GX2A 1P73A 1TJ5A 1ENYA 1CR6A 2JH3A 1U04A 2P2ZA 4FFRA 4XXHA 3BMQA 4DWOA 5G40A 4DUYB 2N0SA 3CBQA 3AFNA 4EG8A 5HZGA 2Y67A 3AW9A 3KZKA 2VP9A 1NOKA 1OIVA 3INGA 4IGAA 3AF1A 4WOJA 3VV2A 1WXHA 3ZNNA 3AYZB 1SCUA 3A06A 4EY3A 3DPUA 1ZH2A 3A6ZA 4IXMA 3R8CA 3Q7TA 1AHHA 3CNBA 2MSEB 4L9WA 4KZKA 2ESRA 3WNVA 2PAFA 1U3GA 2H17A 4IXDA 1B2LA 4GICA 4LMPA 4C5BA 2Q8QA 2WUEA 2C07A 2GM9A 2CW5A 2BF7A 3WL8A 1EZ1A 4GR5A 1YIOA 3GJSA 1THZA 1Q50A 3I9LA 3RVSA 3SGLA 5A02A 4BGDA 4AWBA 4I6EA 2RC6A 3IP3A 3LT2A 4LGVA 1W36C 3UMCA 4DGQA 1JBKA 2BJVA 2I1LA 4E6EA 2IKSA 3V1NA 1PEDA 5I9TA 4ENQA 2XYVA 5E6SB 2D8AA 1P1RA 1NN5A 1SH7A 2G1JA 5BRAA 1X8JA 5EMJA 2PU7A 4OJTA 3ZE8A 3NWOA 4ETIA 4EKEA 1FYEA 1NHGA 4Q34A 4B82A 3AKZA 1FY2A 3BXPA 2MYUA 1X19A 2D13A 2QVYX 3GP5A 1RR6A 4R8VA 1PL0A 5FHRA 3PYLA 1X3SA 1Z15A 3W1VA 4JQYA 4Q47A 1BOOA 2XMDA 4EPTA 3PDCA 1JHDA 4DLAA 2Q2OA 2WT4A 4LJ7A 3X2SA 1QXSA 4J4HA 5KYVA 3ZTYA 3MWEB 3DSRA 1J1IA 5I5GA 1RBYA 2BJHA 1CY8A 1EK1A 1KAEA 3B2QA 3IBFA 1F5NA 1W73A 2QNBA 4RVOA 3ZCVA 2BEUB 3JAWA 3OCVA 1UXJA 4AS2A 2C0PA 3JQAB 1P1HA 3OMWA 3QYAA 1K4YA 5H7XA 1UZAA 2NXNA 3EVEA 3R77A 4XEUA 5HRUA 3FDJA 4ZZ1A 5I7FA 1H4VB 1FDWA 3GCWA 3K6RA 2C5GA 5DF1A 4O4JA 2P9CA 4G89A 3SJAA 5AM5A 4B3XA 1RADA 3NDJA 3AUUA 2HFJA 3PDHA 3H1GA 4KLCA 4Y6RA 3L7DA 3U0VA 2WMYA 2OCAA 1QH9A 4DPMA 5BN5B 3V7UA 3WQRA 4G85A 5BVHA 2PJZA 4I1UA 3IAM1 4BGEA 4XDZA 1VYUA 1XU9A 2OV4A 4KIFA 2QOEA 4HMQA 3DE2X 3H4TA 2DZDA 2ZPUA 3STVA 1WLYA 2WHPA 3BKWA 4B4VA 5B3KA 3KQOA 1T6BY 3G5TA 4XYLA 2QGFA 3DO6A 2HGSA 5DFAA 5UKDA 3PVZA 2I1VB 3W2HA 4JGGA 1VSQA 3GT3A 1COWA 4MGIR 3TMAA 4WNAB 3RHTA 3V6MA 1K27A 3JQ8B 2QW8A 3LXRA 2WTBA 2OQIA 3A11A 3B78A 2CD9A 1ZQ1A 5CP8A 2UUCB 4UXHA 1N2ZA 5M29A 3FBWA 3VVCA 3CA8A 1DBPA 1Y34E 2O7VA 3ETLA 4EKGA 2VTBA 4R1NA 1K2VN 1FSZA 4YRAA 2HEIA 2JD1A 1FSFA 4YRIA 5ALOA 4OGFA 1O95A 3N2LA 3GVPA 1I6KA 5JOQA 5LYJF 1KWGA 1LVHA 2HAEA 4RZ3A 5THQA 1XD9A 4JYBA 1EJ0A 4BE9A 2ADOA 2E7ZA 2AFHE 1JHPA 5LQSA 3MTJA 3O8CA 3A32A 4RZUA 1BO6A 4LWQA 1KI2A 3M6UA 4M1KA 3RLFA 4E5PA 2XE4A 1S0UA 1QHIA 2FWRA 1R0XA 1A9PA 2PY6A 3SQOA 2IVZA 4ALJA 5GVRA 1DINA 2PGXA 5AKGA 3ZOZA 3BXEA 3DAPA 2UZ0A 1KJJA 3FF1A 3L7AA 1IUNA 2I0FA 2QAGB 3SYNA 1P3JA 1E9CA 4N5NA 1O96A 2JASA 1IK6A 2EWVA 3RS7A 2QSZA 3D3EA 5B58T 3TGLA 4B73A 2CL5A 3WDLA 2VH5R 2R6FA 2D0PB 2PKEA 3K5HA 5COAA 4AICA 4PEVA 2A88A 4MWCA 4O4IF 3RYFA 1M76A 2EFYA 2C5FA 3BFXA 1EVEA 3LMKA 2ZI4A 1D8TA 1VYTA 1DJPA 3ESRA 4IDOA 1KYVA 3NEAA 4G36A 1SC1A 5DEOA 4ZVVA 4CHGA 2WWIA 1HYHA 1I0IA 1NL3A 4GPBA 4YJ2A 1CS4C 1EFLA 1TI7A 2C88A 3LBIA 4E08A 4KLZA 2YMLA 1XC7A 2H4FA 1T6YA 5K2OA 3M70A 5MGBA 2VRBA 1H5NA 1VLZA 2D2FA 2HX1A 2JJYA 3F9RA 3B7WA 2WSBA 3JVIA 4F3NA 3OQOA 1DZIA 1PHRA 2BFNA 1CWUA 3A31A 2VF4X 3LBHA 4J1TA 4JP8A 4EWLA 4DYDA 3H42B 3HCOA 4PQFA 2PU5A 3CVXA 4HFRA 3RIGA 2AQ8A 4EB8A 1LWOA 1J00A 2GPAA 5FQOA 1NMZA 3EAFA 5BSUA 2Q3FA 3UVEA 3S55A 1Z2CA 4BNMA 2IXBA 3QBEA 5EIXA 4Q9KA 1R6DA 4RGBA 5GJVC 1TU0A 2F1IA 1SCNE 3A9SA 5CXXA 3O21A 1ONSA 2GILA 1BXGA 3QWBA 2PMWB 4GKVA 5A5DA 2G6BA 2ZATA 1U2PA 4HDKA 2G9QA 3WRVA 3S2UA 3LY8A 4YCMA 2WUVA 1WULS 1UC9A 3E5HA 3HFJA 4JP2A 1X0VA 2FK7A 4UASA 3MXOA 1NBAA 4DXAA 5BOVA 4YLEA 3RVBA 4PAWA 1GPMA 1EGAA 1QRAA 1T4BA 2GD6A 2YY5A 1XEAA 3NQ41 3CLRC 4HD8A 1XJWA 1MIHA 1NFQA 4D42A 1UK9A 2JIDA 4RHEA 4YGXB 1JFFB 2IE0A 5CIQA 4YB8A 3CZ9A 1QORA 2R66A 4YY3B 1ZGZA 1I7NA 1U2QA 2H65A 4Z86A 2C3OA 1KY3A 2FP4B 3KHUA 1L6RA 5JHHB 3HJFA 4G5XA 2JLUA 2QMQA 1ZIYA 4KCGA 2XIJA 4WLEA 4N8EA 3WGJA 2OO3A 4CF7A 2PJUA 4QGAA 4EVRA 4TLCA 5F21A 1B42A 4Q4AB 3S5UA 4F72A 5BR8B 3AEQB 4RV4A 2FLWA 2OO5A 1E3LA 2XMCA 3U4IA 1HYBA 1EK6A 2R7MA 2RAUA 4QNMA 1TOAA 4TT8A 5AQEA 2E5LB 3DKKA 1DAFA 3KJFA 1KK1A 4GYJA 5BUZA 1MNQA 3NBYC 4IIGA 1VE7A 5U4XA 5GPBA 4A5OA 5A5GA 4KHZA 3GLIA 4H16A 1VHQA 2WIBA 4NI5A 2FSUA 4X62B 2EIHA 2QYOA 4HB3A 3IRUA 2Z30A 2IA5A 1K92A 1RHQA 3SWWA 4YJGB 1ENOA 4GRDA 1BEUB 4JQSA 1O0CA 3ZDQA 4LFBB 1U7PA 3OE5A 2CD7A 3DVAA 4WADA 5DHAA 4D6XA 1ECBA 1UBKS 3WSVA 1YJ8A 4GKKB 3NBKA 4M3NA 2PUFA 2X5KO 2VP4A 2XD9A 2EAUA 3EW7A 4CODB 4UQLA 5CXUA 5KYTA 4X44A 1IVSA 1QG2A 1IDOA 3MRXA 4PPGA 1NAIA 2YS7A 4IIBA 1UANA 1CUSA 2OZEA 3DUFA 5D6OA 4LXHA 2QZJA 1FTYA 2FPKA 2A9FA 3PC6A 4FZJA 3TDNA 4OH7A 1FRNA 1ZRSA 5K3AA 4D8VA 4G5OA 4Q3DA 4L78A 3IV6A 2D54A 3VSBA 2ZS8A 4YECA 1YF3A 3PBKA 5ESRA 5FOVA 3SBEA 3ROKA 2QP9X 3SQNA 2HV8A 1GPH1 2BEVA 2I55A 1XTBA 3I62A 1VPLA 2ZSBA 3ROMA 1AKEA 1T4DA 3IHWA 1FRVA 5TR9A 3PFWO 3A3KA 1US8B 3WMXA 4BWFB 3HJRA 1LRKA 2HA3A 4CM8A 5GADl 1YJXA 1N2SA 5E0OA 3ANMA 2JGIA 5ILGA 1J4AA 2CNLA 3I5XA 4OREX 1K75A 1O6BA 5KEIA 5FEMA 3PUWA 4DIFA 4MS4A 1DFIA 4B31A 1J09A 2RKBA 1HDGO 1PF7E 2HU8A 5D8DA 3DMRA 4RMHA 4JEUA 4ZGWA 5LWHA 1DIRA 3FPLA 4LDAA 1W0KA 1JPUA 3JQFA 3TQCA 4EL5A 3EPKA 4FGZA 4RGVA 2QN7A 2IHVA 3TW8A 4M21A 4P53A 3MWGA 5GJBA 4EECA 2YXBA 4ZOEA 1XAJA 2G0NA 3IDSA 3KD3A 3PUYA 2CFIA 2B34A 4IO0A 3E1GA 421PA 3IAM6 5IRCD 2DLNA 2X8WA 2D7DA 1XU7A 4WFQA 1G60A 2P5UA 3K53A 3JYLA 2GI4A 4KW7A 3TD9A 4H9GA 3NYIA 5ELXA 1QTQA 2ENUA 2RGUA 2WOOA 3KSRA 3IHLA 1KL7A 3OT5A 1K1EA 2NT4A 2GXUA 1D0SA 2XTAA 4GL2A 4WCFB 1W88A 3G8YA 3W34A 4X94A 2PL1A 1C29B 3HK2A 1NATA 1UBMS 1E7SA 4TYQA 4OH1A 2EQAA 5FTLA 1LZLA 3NEJA 1XQYA 3PRYA 3CT6A 5AW7A 1BDHA 2D1RA 2JAPA 2AIRA 4Q48A 1TRKA 2J59A 2PX6A 2XJ9A 1KJIA 4YXFA 1ZRMA 2FOLA 3B6KA 4WESA 5BWCA 3O47A 4A8JC 3WLFA 2PTHA 3MCZA 1JXQA 2QRKA 4ZCQA 5HDBB 2M6SA 3MFQA 1ZN7A 2I8AA 3GIDA 3VDRA 2DLCX 3DEKA 4CL0A 1KO5A 2ECPA 4DHEA 4IDHA 4EJ6A 3AVYA 3GMDA 2QTRA 1RMQA 4GKBA 1YA4A 4AAYA 3CKYA 4E31A 1J2UA 4DLBA 5I6DA 3RU7A 3TUZC 3L8ZA 4WZAE 1CP2A 2FRDA 1QPZA 2PSEA 2A9VA 5KWSA 4EAAA 3L8FA 1K63A 2HGZA 3HKDA 3AV3A 1VMIA 3R5TA 1WR8A 3O4FA 1JYFA 2AMJA 3O73A 4KE6A 3R5FA 1NXOA 2F9MA 3TSAA 3GAMA 3VSCA 2OAP1 4WZAB 2VTKA 1MGPA 3AUXA 1PQ4A 3OZAA 2J87A 3IR6A 5HEKA 1XD8A 1SWVA 3DP9A 4XWAA 3PFHA 4R9NA 1SUEA 2BKAA 4N3AA 4TMKA 1Q1QA 3RBXA 1RKUA 2WG1A 2VK1A 3M6WA 1KXZA 1YMUA 2RCYA 4N5LA 3WGOA 1XDUA 3HA3A 3ZWNA 4RMNA 4PWYA 3UXEA 4UUBA 1NR1A 3FCOA 4RTKA 4EPRA 2W71A 3PX7A 1EB8A 1PNTA 3A4VA 4TMWA 1F3OA 5JWHA 3ECCA 2CE7A 1CPYA 4EEZA 2ZWMA 4M60A 3ZPXA 4DCGA 4R81A 4WKGA 3NWBA 4BJ3A 4ZMRA 2YRWA 3I6YA 3GRVA 2ISCA 4GUDA 1EXMA 2I2XB 3GDGA 2ZJ1A 3LX5A 1XHEA 2W6MA 2EKPA 3W8EA 4DJ5X 1U0NA 4GR4A 3B36A 13PKA 4BASA 6NULA 1XTTA 3ZZMA 3EIHA 3O8QA 4BPRA 2DBVO 3OBBA 3BH0A 1JF8A 4J1SA 3KETA 1NVEA 1XRPA 1O58A 3DZKA 3F6BX 3JALB 2Q8NA 3KVOA 4PNHA 3T8YA 1SBIA 2PKQP 4CDNA 4BO0A 1GGNA 3RUIA 4HYQA 4GG1A 1E61A 1NP3A 4HQKA 2QIOA 1B3RA 1DI0A 2C59A 2XQFA 2ZS9A 3E5RA 3I2GA 5EIOA 2A59A 3WVNA 2IU4A 1N1DA 4JLPA 3PZBA 1Y9DA 2RH5A 3MTGA 4FOOA 4Z3KA 3X1KA 3PGVA 4F5YA 1EUCA 5EXXA 3DXFA 1FDTA 1NP7A 1C8BA 1LS1A 4JJ4A 3ZGLA 4EJSB 2I66A 3EK2A 2OFWA 3MCVA 3FYUB 2YFHA 3EOAI 2CSUA 3WMFA 1CJBA 2W58A 3DC7A 4KWIA 1KGSA 5D01A 2FPRA 3IT1A 3GBPA 5DLYA 1RJGA 2J4DA 2F17A 4HOYA 4G0QA 4QD3A 2J5KA 1J0EA 4OQQA 1GKYA 4M98A 4CI0B 2WJVA 3SIPA 4DLPA 3ZW7A 3A2NA 4L4ZA 2OM2A 3WYFA 2YWHA 5FFMA 3AX6A 4EZIA 1XTQA 2PKCA 4PAQA 3ESYA 3ABRB 3AYXB 5CTAA 1N34B 3EY9A 4ZRNA 5BURA 3BUSA 2HU7A 4ITVA 1YZTA 1E6LA 2C78A 5E1MA 1X80A 3ZR4B 3JQDA 2QAJA 3H0EA 3SS7X 1CETA 3C14C 4ANFA 2Q4RA 4WN3A 4MLPA 3F2VA 3FAZA 2VDNB 2YZMA 3PHHA 2BR5A 3JD4A 5BSGA 5LIPA 5IKXA 2PLNA 5B7GA 3C3BA 3C48A 4CIYA 5F1PA 5HE8A 1H23A 3KUCA 1K2WA 4D98A 1LLDA 3TW4A 1A8QA 5EJ6A 3AC0A 3FGOA 1U5BA 1U3TA 2IIVA 2NNWB 4BYGA 5HA5A 3QVTA 2OQ2A 3I3OA 4J0CA 1P5JA 4O4HA 4QPDA 4HNSA 3UM9A 3V4FA 1OH7A 2VHWA 4EG1A 2R4UA 1I30A 3KQPA 3WXMA 1RM3A 2XSZA 3AZQA 4AG3A 2FSFA 3OO0A 3FHJA 4GKJB 2XGGA 3B5IA 1YS2X 4NENA 5ICEA 1UM9A 4DWWA 2DXIA 1IHXA 2IXGA 4KB5A 2XWJI 4O1HA 4OHUA 2OGZA 3TVTA 3OM1A 2AR0A 2JGKA 2VAXA 3V1UA 4CFZA 4Q66C 5AW0A 2ZJ7A 1UKAA 1K9SA 2Q4EA 2W93A 1GTZA 1G2PA 3AFGA 1HYEA 4FK8A 1HNXB 1E2MA 2ZI6A 2DBZA 2W6NA 1M2KA 2PBLA 2Z4TA 3AZOA 3AR6A 4J0KA 4X6UA 1PSZA 1U7UA 2EV9A 2Q21A 3NGXA 3U17A 4P36A 3IUYA 4UATA 4YRNA 4Y9UA 1KC3A 1KH3A 3QVMA 4Y6QA 3DKIA 2ATCA 4NJEA 1Z0DA 7REQB 1GN8A 2H1HA 2RKWA 3D5TA 2YJ3A 3HO8A 3O8QB 3SZLA 2V0GA 3QKWA 1AIPA 1JVSA 3QE0A 1FQOA 2WIAA 2XXBA 3MSCA 2JFXA 4M9UA 1R64A 1YCDA 2X8BA 1OIXA 1FFXB 4RE6A 5F2NA 3IAAA 1Z2OX 4RLQA 3ZK7A 5KOYA 3T06B 2B9EA 2QUAA 4GOMD 4ZOLB 1DRWA 1YSCA 3OJOA 1PLJA 1S8FA 4HDNB 1CR1A 2C8VA 3K72B 2PT7A 3AJAA 5IABA 2QM0A 3RHSA 1L7DA 3HB0A 1RHRA 3TB4A 1ECPA 1U7ZA 1ULHA 3BIJA 3FSGD 3ZHUA 4DBLC 4GSLA 1QAMA 3NHWA 4UBNA 1VBNA 3EWIA 3JY6A 2PZ8A 3O1LA 5JNWA 1W36B 4DLVA 4OU4A 3ILHA 3UHFA 3VU3A 2GXQA 1P44A 1VG8A 3CSUA 3EXHA 1IN6A 4GRIA 4EELA 4C7JA 3GWGA 2VPIA 4LDJA 4HLUC 3TB6A 5FAKA 1YKFA 5K09A 5FTWA 1C7RA 3NIDB 4FXOA 5CYGA 4WJLA 5KS2A 2VDJA 2WABA 1GJRA 5EZYB 1C8KA 1AV7A 3AESA 2VDQB 3CF6R 4NBRA 4WKNA 1QPGA 4Z9FA 2H4WA 3OJFA 3NXSA 4N65A 1WXDA 2O06A 3ENQA 1TEHA 1XKLA 5JI2E 4H7KA 2QMUA 2WM3A 4RHTA 1GZ5A 3F97A 4KIGA 3AUSA 4EFKA 2GZAA 3PQCA 1YACA 2AG0A 3IUEA 3OE4A 1THGA 4Z1MD 8ATCA 4BUJA 5K8TA 4MVJP 2XQVA 2Q6KA