2A9PA

Medium resolution bef3 bound rr02-rec
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an activated YycF homologue, the essential response regulator from S.pneumoniae in complex with BeF3 and the effect of pH on BeF3 binding, possible phosphate in the active site.
rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
molecule keywords Response regulator
total genus 42
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a9pA00
4MLCA 1YVUA 2LBPA 2PMCA 8ABPA 3UUGA 3KS9A 4HNRA 4IILA 2PUAA 2O20A 4MLDA 2PUDA 2H3HA 3DGFC 1U0SY 1A0OA 5EWJA 5JNTA 3A0UA 3T6KA 3DBIA 3MQ4A 1FFWA 3R0JA 3C6QA 3GV0A 3RVOA 2M1ZA 3HK2A 1USKA 3O1HB 3CG4A 4KVFA 5T7BA 2PUCA 5DLEA 3CZCA 5FWXA 5IEJA 4G0QA 2LP4Y 1L5YA 3I5AA 4QICA 2V0NA 2PKXA 3SAJA 2GI4A 1VRVA 1C4WA 3IPCA 2R48A 5E3JA 3D02A 1D1PA 3EULA 2E4VA 3KSMA 4LDAA 2F8SA 1DBQA 3LMKA 3O1IC 1ABFA 2IPMA 5CHYA 5JS2A 4CBVA 3DLBA 3E61A 4YLEA 4G0ZA 4S05A 4Z4IA 3KJXA 1AB6A 3H75A 2E4XA 1QNLA 2FTKE 3IDOA 3N0RA 3RH0A 1FFGA 3KTOA 4G97A 1MVOA 4EY3A 3SNKA 2W42A 5IUKC 3RVSA 1MB3A 3M9WA 4PICA 1CYEA 2HQOA 2WMYA 1YIOA 3LUHA 4NQRA 5TE9A 2A9RA 5KI6A 2ID7A 4HNQA 1NXOA 3KKEA 1JWLA 2FQWA 1SD5A 3TO5A 2MSLA 3BBLA 3BILA 4YGXB 1PNTA 4EVQA 2FSPA 2FEPA 3JPYA 3GL9A 5JNRA 4LX8A 3MMNA 2JBAB 3EDCA 2MYNA 5KWSA 2JVIA 2L19A 3HZHA 3NBMA 5HKOA 1ZN2A 4TN5A 2LPMA 3HEBA 3HJFA 2A9QA 3GT7A 3UK0A 4E7PA 2PE5A 4RK1A 5KQMA 3RVKA 1QKKA 4JP1A 4MR7A 2A9OA 2QVGA 2WWVD 3VNBA 4EUKA 5IUNC 4KREA 1ZESA 1DG9A 1JH9A 5TQ0A 2FKAA 3IP9A 1M5TA 2YHAA 3OLVA 2IKSA 5EWLA 2JVJA 1JBEA 3C3WA 2R25B 3KYIB 2RJOA 3D8UA 3GYBA 1GCGA 5KQLA 1NXTA 4S04A 3MA0A 2P4UA 1TMYA 3I45A 4FE4A 3TMYA 5GOTA 3QLUA 3C3MA 3I42A 1Y1LA 1M5UA 4GNRA 3LFTA 4WXMA 4N47A 2RJNA 3H5IA 2WB4A 4RKRA 1CEYA 3TB6A 1DCFA 3N53A 4KQ9A 2E4YA 1U8TA 3DGEC 3N0XA 1DC7A 4KPYA 2OQRA 4WWHA 3BRQA 4N0QA 4WXEA 2MSKA 3CG0A 4JAVC 5TPZA 4Z4CA 1M2FA 3A3KA 4RXTA 3HDGA 1I3CA 2X7XA 1PUXA 2QSJA 3HS3A 4RS3A 2M98A 1DCMA 3N6VA 4O1IA 1W25A 4RK4A 4Z0NA 4Q6BA 3ROFA 3F6PA 4RZSA 2H0AA 2B1JA 4PEVA 5FBHA 4F06A 4Z4HA 5IUJC 2F8TA 3Q7SA 3N8IA 3O2JA 4LE1A 4YO7A 3SY8A 2FLKA 1QP4A 1QO0D 3EGCA 3ROTA 3H6HA 4HYEA 3Q41A 1BDJA 4KK4A 1RNLA 4M88A 4N76A 5BRAA 2L2QA 4UHKA 1YS7A 4XLTA 1E6MA 3CRNA 3HDVA 2PAFA 3OO1A 2HQRA 1BDIA 1ZH2A 3LUKA 5DKFA 2RGYA 1QPZA 3QELA 2FMHA 2QZJA 4NV3A 4RSMA 3O75A 4YP9A 4XASA 9ABPA 4IRXA 3NHZA 3N75A 2E4ZA 2JVKA 1KGSA 4MQEA 1JDPA 5FWYB 4ZJPA 1YMVA 3LTEA 3OM0A 3OQMA 5HM6A 4NICA 3QLVC 4RV5A 1LBIA 3O2SB 4MRMA 3ILYA 1F4VA 5JNWA 1USGA 5KC9A 2OENG 1Z26A 2IYNA 5C5EA 1BVHA 4L4UA 3HSYA 4W5TA 1ZAYA 3EJWA 4RU1A 4KNYA 3LKVA 4KRFA 3QLVA 4O5AA 4Z9AA 1RPJA 4ZYLA 5CNMA 1ZY2A 5FBKA 3IP5A 1CHNA 1GUBA 4MRMB 3I09A 4RK7A 1T34A 1SXIA 1MB0A 1JFTA 1XHEA 4KQCA 4YWHA 2WRZA 1Z25A 4NCAA 4Z9BA 5JS1A 4IF4A 3JY6A 2FMFA 4PZ0A 4TLLB 1PNRA 1HEYA 1JDNA 2QVCA 3JPWA 3CTPA 3M6MD 3M9XA 5TQ2A 3URMA 4G0YA 2QW1A 2FQYA 3Q7RA 2MYPA 3H5LA 4YRZA 1FFSA 4Z4EA 3OMXA 2FMKA 3KLNA 3B2NA 5IULC 1ISRA 1ISSA 4KZKA 4ETIA 5GQSA 4F11A 3EAFA 2IDMA 3OLWA 3H5VA 3C3KA 5TQJA 4XAQA 2AYZA 4F12A 5BQ3A 3QEMA 1AB5A 1DRJA 3MIZA 3OLYA 2BGGA 1VKRA 4ZMRA 2VUIB 2GWRA 1JFVA 2FVYA 3H1GA 4JA2A 2FEKA 4XFKA 4KMRA 1C0EA 1NXVA 1QP0A 1P6UA 1QP7A 4EYQA 2FMIA 1U04A 4PYRA 3OO0A 4MQEB 5FWYA 4ETMA 1D5WA 2XDYA 2PL1A 5CNKA 3IP6A 4KV7A 3QELB 4F8JA 1KRWA 2IPLA 1NXXA 2VUHB 4N41A 5IC5A 4MAAA 2DRIA 3IPAA 4IGAA 3CU5A 5HSGA 1EWVA 4WUTA 1PEAA 1U2QA 3GWGA 1Z2DA 2JB9A 4FE7A 2FEWB 4EYOA 3Q15C 2NUBA 4MR8A 2NT3A 3CLKA 1DP4A 2RDMA 1A2OA 1Z13A 3HVRA 1YMUA 2WY2D 5JNSA 1SRRA 2L18A 5T3YA 1ABEA 4RY8A 1ZGGA 2MSWA 4G0OA 1VPWA 4H60A 4JOQA 1JX6A 4MS3A 1TLFA 3ILHA 2J48A 2PUBA 1QO0A 1UDRA 3KHTA 1F51E 3QEKA 4OLBA 4G0XA 1MAVA 3MYYA 3HUTA 3CHYA 3F7NA 5FWXB 4RKQA 2GX6A 4Q7EA 4WZZA 3CNBA 4D6YA 4YV7A 4W5NA 1L5ZA 3QX9A 4Z99A 5DTEA 4E7OA 1NXWA 6ABPA 3LUDA 3LUGA 5BR1A 1EAYA 5KC8A 2ZWMA 4RXUA 1LJUA 1NXPA 2HJ9A 3F6CA 1SXGA 3T8YA 4EVRA 2Q5CA 1EWTA 1VLZA 3FGZA 2LIVA 3W9SA 3F73A 4LZLA 4W5QA 3H5WA 1KRXA 5EWLB 2JK1A 2TMYA 3HV2A 1JYEA 3G1WA 3SG0A 5TPZD 1S8NA 1URPA 3OM1A 2PJUA 3SQNA 4OTZA 1P2FA 7ABPA 3IP7A 1D2AA 2GBPA 3N0WA 3HCWA 1Z2EA 1EFAA 5TPWB 1P8AA 1LK0A 1EHCA 4RK5A 3G85A 3O74A 4QYMA 1DRKA 1BAPA 1RXIA 1E6KA 2ID9A 2NT4A 4OBBA 4PE5B 1A04A 4Z4GA 2IPNA 5JNVA 1Z17A 3A0RB 2L17A 3H6GA 2FN9A 4XXHA 3FFTA 3RVQA 5B3JA 1ZVVA 1P6QA 3LUCA 3QLUC 1NTRA 2E4UA 3P9YA 3Q7TA 4MS4A 5C5CA 4RWEA 3GA5A 3KYJB 2IPAB 3H5OA 4JB0A 1TJYA 2VK2A 3GBVA 5ABPA 1RZRD 4OLAA 3DLHA 1E2BA 1Z15A 3EQ2A 4MR7B 3OMWA 1JYFA 5CNJA 5TQ2B 4MR8B 5BRJA 3O1JC 2HPHA 4N03A 1R8JA 1Z12A 3L6UA 3MF4A 1EWKA 3EQZA 3QK7A 3FMVA 4Y9TA 1DBWA 1YK1A 4ETNA 2ZAYA 1RZRA 1GUDA 1DC8A 4MGEA 5PNTA 4XARA 4UHJA 3HO1A 2FN8A 3CKMA 1XWWA 4QYWA 4TLMB 3MM4A 3RVNA 1ZH4A 1ZDMA 3NNNA 5DGCA 2PUEA 1QMPA 2NZVG 1NATA 2AYXA 4MS1B 4D6XA 4B09A 3RQIA 2CHFA 3QEMB 5IBQA 4DADA 4KK3A 3O2QB 3JVDA 1TM2A 4G86A 4MQFA 4RY9A 4DQDA 5IX8A 1LBHA 1USIA 4KFCA 4N0PA 3H5TA 5D2CA 1JLKA 1QQAA 5I4CA 3OQNA 1GLGA 1K68A 3KCNA 3BRSA 5IEBA 5EWMA 2PLNA 2P9HA 4MYRA 5KQPA 2CD7A 3K9CA 4HNSA 5CNIA 3RVPA 2CHEA 3BREA 3A10A 1RXEA 4MS1A 5EWJB 3FFWA 1YTUA 1B00A 4RY0A 1JL3A 4ML3A 1D1QA 5HQJA 2JCGA 3JVIA 3NNDA 1OXBB 2B4AA 4WT7A 2FQXA 3GBPA 3H1FA 3JS5A 3TD9A 1YK0A 4YCSA 1BA2A 1KMIY 2IOYA 3CFYA 2R47A 4DN6A 3O21A 2PL9A 4D74A 6CHYA 1MIHA 3T95A 1FQWA 4Z4FA 4OATA 1ZGZA 1QQBA 2QU7A 5KQGA 4ZPJA 4IMJB 4RDCA 4P98A 1ZHHA 2LUOA 4RK0A 2QXYA 2WJAA 4YR7A 4LE0A 2VYCA 4RXMA 2NZUG 4MPTA 1Z16A 3JTEA 4L85A 4OG2A 3S99A 1APBA 1NXSA 3OQOA 4EYGA 2KYRA 3NHMA 5ED4A 3OLZA 2CWDA 3H1EA 3HM9A 1JHZA 4TMYA 1K66A 2JRLA 4EVSA 3OLXA 1DCKA 1JF8A 1NY5A 4NCBA 4LRQA 3Q9SA 4EGSA 1JFSA 1LJLA 4MS4B 1DZ3A 3FFXA 3QLTA 5F64A 3C97A 1W9HA 3EODA 5JNUA 2PUFA 3KG2A 4JASB 2QR3A 4MR9A 4JB2A 5DCLA 3T38A 3UKJA 5B3JC 1DJMA 1PHRA 4Q6WA 2MYTA 4G0MA 4QPJC 2HQBA 3LKBA 1WETA 4W5OA 2HSGA 3HXMA 3LUJA 4H3KB 4GPAA 3GRCA 1XHFA 4MR9B 1D4ZA 3QX8A 4F3TA 3KLOA 3SM9A 4LE2A 3CZ5A 2FXIA 4EYKA 1SXHA 1FSPA 2GKGA 1DBPA 1OXKB 5EWMB 1M2EA 3HUUA 1IIBA 2JBAA 4G0PA 3RVLA 1YS6A 2FLWA 1J56A 3NNSA 3L49A 4H3HB 4RK6A 5TQ0B 2YHBA 3DZDA 4P1ZA 3RVRA 1GCAA 3RVMA 4MQFB 3RVJA 4FB4A 2A9PA 1E6LA 3LOPA 3VNAA 1ZITA 3K4HA 2MYUA 2FW0A 3LUFA 4IMIB 1TVMA 3LUAA 2E4WA 2WJWA 3E3MA 3FDFA 5TPWA 2PUGA 1H9CA 1U2PA 1BDHA 3CS3A 2I6FA 2R4QA 4MS3B 2N9UA 4O1HA 4YS6A 1PEYA 4ZMSA 2QV0A 4W5RA 4LDZA 1Z18A 3TX6A
chains in the Genus database with same CATH superfamily
2X7JA 3KELA 1F7VA 2W43A 4MEJA 4OQPA 1BJKA 2J3LA 4DM3A 1L5MA 2BD0A 1US8A 2FPUA 2WVJA 3T3MB 1T4CA 4YO8A 5JPCA 4GKKB 1QZ3A 4IEEA 2OM2A 1ZCAA 1HLFA 2QN8A 3C3CA 3IEKA 1WZCA 1TGYA 2YJTD 5G4KB 5L95A 4FFDA 3L4BC 1GFSA 1QQ5A 2M1ZA 2J0QA 1JMKC 1FFEA 3AIKA 1KDVA 4RZUA 4OL9A 3DDHA 4Q4JB 3GPDG 4RVSA 2W6ZA 2WV7A 5E38A 5BURA 3VZBA 3ZVNA 3RANA 5NULA 2CVHA 1XF9A 2OSVA 2IWRA 2JAWA 1U0LA 3OZ7A 4PLZA 5BSWA 3OEHD 2P67A 5KVVA 4PZ9A 3RBVA 1EP3B 1KI6A 3EDQA 3HBLA 4E31A 4B9EA 3OJLA 1UEXC 2COKA 3ZDBA 1ECCA 2BZSA 3MQFA 1NF9A 1R0LA 4ND8B 1EWYA 1NVAA 1VGRA 2HHLA 4YRMA 5FLXA 3CJQA 3E9NA 3U60B 5DWQA 4Q66C 2UAGA 4D45A 3S2YA 3VAAA 3KKQA 2NO9A 2G9NA 4H7EA 2PRIA 3FPEA 4UTXA 4R9NA 2DWUA 4DCUA 2Z04A 2C9OA 3SN6A 3JTMA 1ULSA 3KQVA 4HPJB 3SEFA 1MTOA 3VR4A 2R751 5KSPA 3QFSA 1QH8B 2WABA 3KC2A 3RVSA 3DUFB 1EM8B 4X85A 2IV3A 1WMFA 5J43A 3ZLBA 1S02A 1XVTA 5BRNA 2ODWA 3KZKA 3UJ3X 5JZMA 4AKGA 1F2TB 1SVNA 5HUHA 1YRWA 2X19A 4P35A 2ID7A 3ZWPA 2AEEA 2ZBEA 3U4CA 1XA0A 1VB3A 1XZGA 5CM8B 3JALB 3F4KA 1Z2OX 4X1KB 3CV3A 4GZMA 2FPPA 3X0DA 5EXPA 2OBLA 4EO4A 4M7WA 2CK3A 3U0BA 3AUJB 1E77A 1XRSB 5LQNA 3FPAA 4KNVA 4XQ0A 1NZFA 3ZE9A 1ZN2A 2GSWA 3DEJA 3ANTA 1BX1A 4BXOA 1JMVA 1BHSA 4MJ3A 1GV1A 3ZZNA 1HOXA 4DYDA 4F9FA 2FXVA 3RVKA 2VNIA 4EUKA 5I9TA 1OLSB 2WKWA 3PFKA 1A9XA 1JH9A 5BYBA 1D2EA 2IDZA 1T26A 4UU8A 1MRSA 2WNHA 2XVZA 4ZVNA 3E9EA 1YV9A 4LJ4A 2HRQA 3R75A 4DQXA 3KV1A 3N7AA 4JBYA 3GCWA 1U3CA 3GYBA 3HO8A 1GCGA 1VG9B 4LV6A 4QU5A 3EPKA 3V1KA 4DLBA 4MROA 3MLBA 1Z8DA 3WLPA 4OM7A 4BMVA 3D81A 1JSLA 3H97A 1C0PA 1UADA 4RHUA 4NXMB 5AM1A 5JAMA 3NM6B 1WJGA 1IZ7A 4WNCA 1PBTA 2R5NA 1T36A 1O95D 4GZ3A 1CU1A 3GX1A 4EGAA 2BM0A 4NCKA 1FTGA 2JHAA 5A4DA 1W36C 4BFLA 5BSGA 3RRJA 4LSGA 2BGNA 2OXCA 1HUQA 3UAXA 2X1LA 1VHTA 1X80B 3QY0A 3W7VA 3SVTA 3ZKWA 3P5SA 4BVKA 4FXOA 1QF7A 5A4MS 4OPMA 1Q7BA 4B33A 1O97D 3AP3A 4B3DA 4PC6A 4DC9A 3LY5A 1SOWA 2Z6VA 4C78A 1G3UA 2VXYA 3AXTA 1Y4ZA 2ZRMA 5AI5A 1RBQA 2KE5A 5K1ZA 3Q7SA 5L6LB 3ONDA 1N5KA 6PFKA 1I5RA 1DEAA 2R7NA 4YDQA 1VGQA 1YKSA 2QG9A 3TQCA 4BC0A 2EGHA 1ZG3A 4OHPA 3WIUA 1J8VA 1RNLA 4GPZA 2QDKA 5C7YA 1X3SA 3GI1A 1EX9A 1XDZA 4K6MA 2XUJA 1Z73A 1G8HA 2FB9A 3I2GA 3PPIA 3R7WA 4CT0A 4NFHA 4MX8A 1QPZA 3H6KA 3HCFA 4NCJA 4CMEC 2FMHA 2Q5OA 1UT8A 4OKIA 2V9PA 1KZ6A 1VCOA 2BKXA 4YHBA 1CUGA 4GZ6A 2WWYA 4J0IA 3BRCA 4BMCA 2VWQA 3RREA 4ATNA 1NFFA 4ZJPA 3E70C 2ZJOA 1WRBA 2XMCA 3IT0A 2OO5C 3D2LA 2C8LA 1ADCA 4RIGA 4RV5A 3AF0A 4YRRA 3JX9A 4ZOLF 3UWKA 4A1FA 4PANA 5KC9A 4FIDA 2FWBA 3VMFA 3EJWA 1BVRA 3PQ6A 3FPFA 3L6RA 4OGWA 1EZZA 1NT2A 2H11A 2BFBA 3BB3A 3NOQA 3IP5A 2FI1A 3UK1A 1U2ZA 3IR7A 2FPGB 3SNHA 1YJ5A 2R5FA 2VA8A 2GUWA 1XU4A 3PGLA 5FIUA 2VRWA 4RPHA 2A57A 4TYMA 4DXHA 3H2KA 3JY6A 5LBIA 2FMFA 2ZRLA 4UXHA 4Y98A 4JCOA 2BEVA 1VKZA 1KI3A 4UQOA 4EMBA 4YCLA 4V0RA 1OJLA 2QVCA 3LK7A 4P4TA 3FAKA 4TTJA 2Q3DA 2ROQA 1ZD2P 1G8AA 1IWOA 1ZCJA 2DBVO 2FQYA 3D4PA 1A4XA 3FCYA 5DJ5A 3ZQ4A 1AGNA 2Z2IA 2EERA 4M0FA 4PLTA 1L7NA 2R1TA 2E37A 4Y2HA 3KQLA 4LJKA 1DAKA 3W4JA 2B8JA 1GPBA 4QUEA 3RRYA 2OCKA 1QAOA 3MC1A 4FTWA 3G6KA 3ZI4A 3EA5A 3CRRA 3FDZB 4Q4HB 2QD3A 3DB2A 3BE8A 1F8FA 4BVLA 3KEQA 4GPEA 4B73A 4YRSA 2UXBB 5BPHA 2VPIA 3M5DA 3PQ7A 5G1OA 3G5MA 1J1IA 1XPUA 1O4VA 4NTZA 4AJEA 4PHTA 4CCWA 4YX9A 1A1VA 2C9YA 4XFKA 1DAPA 5CW2A 4PBSA 3S70A 1AGPA 3T9AA 1CW2B 4E1BA 2FMIA 5FHQA 3WL5A 4B5KA 3ETEA 4BQSA 1L4LA 3EZ6A 2XDYA 2YUTA 1TQ4A 2A58A 4MRSA 2DFPA 3I9V6 4XB1A 5JPIA 1BMQA 1FFBA 1QYIA 3GJ7A 4WLVA 3LC2O 2SHKA 3PQ3A 1EUDB 1ZKMA 3V8NA 1DDGA 1P4SA 3W6PA 1ZSYA 2GN8A 2R8EA 3ZV5A 4ZK6A 2PZLA 3D3WA 4N41A 3WLFA 4B46A 1PHPA 1UKZA 4HUQB 2IHUA 2N0SA 2X4GA 2J85A 3CU5A 2WTMA 3QVUA 4LTNA 4HPXB 4L95C 3UAVA 3WGKA 4B7AA 4WADA 1SXQA 1CD5A 3TZBA 1P74A 1U2QA 4E6EA 2QMZA 1MIOA 2J32A 5AW4A 5CTJA 3THOA 3LWBA 2IZ7A 2NUBA 4MR8A 3X1ZA 3K16A 5BSHA 5B3KA 4EB3A 3D2CA 1OLUB 4QNRA 1MG5A 1QGAA 3T7AA 5AFSA 1P1JA 2JHPA 3ZBUA 3ZWQA 1P2UA 2LTAA 4D3FA 4HB0A 5JC1A 2VBFA 3BMCA 4NYMQ 2P2CA 3HMKA 5IMSA 1FX0A 4ZT7A 5LZ4A 2WU4A 4UTPA 1B23P 3AU9A 5DP2A 2YN4A 5DXFA 4C6TA 2HBYA 2QTVB 3QVOA 3I92A 4C4TA 3IHTA 3F7NA 1XFAA 4RVDA 1MHTA 1SKYE 5C8VA 4DR4B 4XLLA 2VDMB 4CG3A 1L5ZA 4M53A 5AXDA 1KEEB 4QYSA 1QTNA 4Y2XA 3C8MA 1TT7A 2J0UA 4NECA 4EG6A 3I53A 5C3MA 4YIKA 1M67A 4NZZA 2FN4A 3AKYA 3H42B 4W9RA 2C7RA 3U3ZA 1M2WA 4IDDA 4RMJA 1NNSA 4H16A 4JVOA 4IHJF 5SZJA 1GKIA 1DRWA 3CLRC 5EJIA 2EGGA 3IDAA 4XM1A 1X7YA 3FKSA 1Z6AA 5CPBA 4CNBA 5A3QA 2CHUA 2JLBA 2HSJA 1O6CA 2A0UA 1GZ3A 2OBNA 2YHSA 3LGAA 4KXXA 3W5HA 4BRUA 5JJBA 1KY3A 1P4RA 2OYSA 1G2OA 5TPWB 4C2AA 4WOKA 1OXTA 2NWQA 3O74A 4KPUB 2R8RA 4NYJR 4ZZ2A 4C1BA 1JKJB 1KI8A 2QSYA 1Z2PX 3BGSA 1BEUB 4HH3C 3U7GA 3WGTA 3GG2A 1G7RA 3L82B 4RYLA 4P32A 4BS9A 2ZCJA 1Z17A 1UZNA 3BDAA 3P9XA 4PPYA 2GZDA 2JGKA 3KQMA 1L8OA 1JLRA 3JQ8A 3M6VA 4KSBA 4RWEA 3Q85A 5HCUA 3T3OA 2ZYWX 3K5WA 3VYVA 3GDWA 1SA0A 1H42A 3P2KA 3N74A 1DTWB 1R9JA 2B4KA 2HLDD 1C9KA 5AKIA 1QGOA 1OVMA 3ABSB 4WSOA 5IF9A 4JGIA 3SXUB 1FFYA 1E2BA 2P30A 3K4QA 3EF3A 1EUDA 3O1JC 4TS9A 3BIXA 3C6MA 1AO0A 4JFRA 1IZ9A 4Y9TA 3DE7X 3JQEA 3K1AB 1SUSA 1EGQA 2GDJA 4XTRA 2HLNA 5D7NA 5K0LA 4CKYA 4ENRA 1QVWA 2WG0A 4ND1A 5ECGC 3NTQA 5ICFA 4R2XA 3SC6A 3U3XA 1BN7A 4L7QA 2BTQA 3EFEA 1XCBA 3B6ZA 3BCSA 3M8KA 4XKJA 3H2SA 2Y76A 2E85A 2GN6A 1FF9A 1H2AS 2EX4A 4KK3A 1GEEA 4ND4A 4BWFB 3M5WA 3FNEA 4G86A 3ZXIA 3C24A 3DLTA 5IX8A 3N7UA 3AESB 5CXXA 4CI9A 5F2KA 1U31A 1PRYA 1TEZA 4XGIA 1Z7GA 4M1MA 1MO4A 2WWIA 1I3NA 4YT5A 1PZXA 1C9YA 4CFYA 2P9HA 1AF4A 3CT4A 1YR8A 3CZAA 3NBUA 2HTEA 1OV4A 4F9GA 2BI7A 1DPFA 3K9CA 1JA0A 1Z5PA 1B4DA 4HNSA 1FY2A 4J9VA 4MCJA 4DANA 1Q1BA 1MUUA 1H6AA 1UZUA 3ZJTA 3BAZA 3TQSA 2JFUA 3BE6A 1WMAA 2BTOA 4L2IB 4HB3A 5C81A 4HNAB 5HQTA 3KP1A 4O8ZA 3DO5A 3IAUA 3DMHA 1FP2A 4O5OA 3NOOA 1BZYA 2P3OA 1T5LA 2R47A 2O54A 1JSZA 3DVQX 3LX4A 3Q40A 1SO8A 2BUCA 5M2QA 2YZKA 2PX6A 3EGWA 1F4PA 2DWQA 3CE6A 4OV6B 5L4SA 2QJOA 1V96A 4B71A 3EBPA 1K7SN 3AG5A 4AYXA 2XQKA 5F5NA 1L1RA 2W4QA 2X6RA 2X8JA 4DNFA 2JFOA 3S99A 2IF0A 3LG2A 1IOZA 3FCXA 1ORRA 3R1IA 2FP4A 4IZHA 4BAUA 2YV4A 4LF4B 2WPDD 5H5JA 1R6VA 2EKDA 2ZRCA 4CEJA 3OG9A 3GROA 3F1LA 1ULAA 2F9MA 2W2KB 3QM1A 1NY5A 1HDZA 3BK1A 1RWNA 3VR4H 5AVKA 4H4CA 4RBNA 3R5XA 2EW1A 3ITEA 3KT6A 3GEIA 3IE2A 1XK6A 1FIUA 1CQZA 3E18A 5DCLA 1KEVA 4ES6A 4Q6WA 1DI0A 4QPJC 4WNYA 2PH1A 1DAOA 2AN9A 2QNRA 3L79A 3NXKA 3GEMA 4MYSA 5E95A 3RYCA 2VAXA 4QD3A 3HJHA 1TA0A 4YI3A 1JEQB 5EIBD 1X0VA 2QPTA 1UP6A 4KLRA 1GTRA 1KI1A 3KQNA 1TA4A 1R5BA 1YE5A 2Q8QA 4PSKA 1DUVG 3WSWA 4HHEA 1MAUA 3L4JA 3HP1A 1TK9A 1QS0A 1D2HA 2NO7A 2D74A 4AY3A 2UUOA 1XEXB 3Q11A 1NGSA 1EQ2A 3WL3A 4WBNA 4A8JB 5DHAA 2B9EA 2JGDB 1CRZA 2V8BA 3KKZA 4G5YA 2PO7A 4G0PA 3RVLA 1V8BA 1BHQ1 3EOAI 5CTAA 3RVMA 1SULA 1SUFA 1PX0A 2QTZA 1E6LA 1MRZA 2OK7A 5K99A 4RFSB 2CJXA 1HT0A 2UYQA 3EGOA 2CCJA 2OOSA 5M29A 4OP2A 2R60A 2PUGA 2OHGA 2ZR8A 2P2ZA 1PKXA 4KITB 3NHLA 1NLFA 2D8MA 5JVDA 1LVHA 1VHWA 3JQCA 2JATA 1Q44A 1Z6TA 5BY2A 3CNEA 4W5RA 1FYXA 4V38A 2HCTA 4OFZA 2J46A 4LDZA 4RF4A 3KVNA 4M9UA 1Y5IA 4QOIA 1S4MA 3WGIA 3TKYA 1SRQA 3D8BA 3AR9A 4IFTA 4MV7A 6LDHA 3R6LA 1GTJ1 3CZ9A 3DKRA 1DXHA 4R1UA 4F56A 2H54A 2Y27A 1QNFA 5F3DA 1XBTA 2B34A 2ZJ5A 3WB2A 1OKKA 1E7QA 5KMGA 2VVTA 1FP6A 3NANA 4PYKA 1JXQA 1TCCA 2XE8A 1HRKA 4B7XA 4AS2A 4DDHA 4EFKA 5IEJA 3C5WP 4G0QA 1YL7A 1I1HA 2HCRA 4KEAA 3WFJA 1P0IA 3CR8A 5HGJA 3COJA 4IJKA 4IV0A 1T4CB 3N39C 1Q21A 5JYDA 1JVNA 1ODJA 2XMDA 3C5VA 1MA0A 5H9WA 2HU8A 4URUR 4GMXA 3KYDA 4XPZA 1U3TA 1I3LA 1P5JA 1SUIA 3UCEA 3H83A 4B7ZA 2AEFA 2RD2A 5F1OA 2E4VA 3NC0C 3QZUA 1FJ2A 2C4VA 4O2LA 5JIBA 1M10A 4DCMA 3C0KA 4V3BA 3V4VB 2JNWA 4QTZA 3WL8A 3KUDA 4S05A 1KEZA 2VHXA 3E4CA 3W3ZB 5LYYA 4BNWA 5AHWA 4BFCA 3GA7A 3O03A 4H7FA 3TLGB 2VDWB 5AUPB 2OE2A 5FUMA 1ORIA 4G0UA 1MX1A 3SC4A 2ZDHA 3DF9A 3LXXA 4G5XA 1FSGA 1RZUA 4U2FA 5C80A 1FQOA 3L8EA 4H3VA 3KQWA 4EABA 4ODIA 3MJVA 3P0FA 1TYCA 1TZCA 3L7AA 2HSDA 2QX4A 2IYYA 1R3DA 2ATIA 2HQOA 1CYEA 1KYIA 1P6XA 2ZWPA 1K6IA 4EY6A 3MMSA 2Q1SA 5IAGA 2QI9C 1O6BA 2XIJA 1XEXA 4YGXB 1J8FA 4BZWA 3DBVO 4MICA 3UK7A 3G9UA 2IH4A 4Y2SA 3OTOB 4JJ7A 4UQPA 1RRPA 3I6YA 1M8KA 2J5RA 2P6RA 4TTPA 2WIDA 4LX0A 1NKVA 3JR3A 3IUNA 1PI3A 1R6UA 3EVTA 1Q15A 1I4OA 2DHDA 2NU9A 2I4OA 2XEDA 2JFXA 3C74A 3JRXA 3BMXA 1V71A 3GBSA 2ZSBA 3K35A 3UATA 4MRPA 1ZM9A 1DRVA 2FKAA 4KQ1A 1E79A 2G5GX 3EIHA 5DB4A 2JIQA 2V3VA 1Z28A 3WBBA 2HDHA 2R25B 5CVDA 2OBXA 3IS3A 4ILKA 3ITKA 2GH1A 4ZCLA 4HTFA 2ZANA 5JYBA 3CB4A 4E3WA 1KFEB 2IE0A 3RLFA 2GPWA 1JI0A 3M1YA 4CNQA 3NBQA 3SJZA 3SD7A 3A1TA 4M1TA 1I7QB 2H2FA 1T24A 1TU4A 1OX4B 1Y81A 2NUTB 3AYXB 3IT2A 5IARA 4B76A 3JYQA 4RKRA 4I9NA 4U5QA 1GL6A 4KYUA 5JS8A 3KHSA 4UUQA 1D3AA 3FI9A 3HCRA 3OZGA 2DQZA 1O0BA 3DPSA 2HRCA 3WYNA 1H1TA 1BGWA 4JC8A 1XTUA 3EZYA 3SKVA 4HXFB 2QTFA 4BYGA 4DBZA 4EYSA 5CM9C 1Q0TA 3RHFA 4ZIRB 1GCUA 2UU9B 1LPOA 3KPWA 5JMTA 5IT9A 3ZGLA 5CFOA 1CEQA 3VR2A 1JSCA 4Q9NA 3D3QA 2YICA 4G67A 4M9CA 3FSGD 4ZU3A 1RC1A 1N7JA 1XAHA 2X8JB 1D07A 4S0XA 1PO7A 2I55A 2P6OA 4YJ3A 1ULBA 3LF2A 2PL5A 2PH3A 5ESRA 5FOXA 5BQ5A 1DO2A 5D3MA 4LMBA 1RM0A 4PEVA 4E32A 4Z2AA 5U9CA 4MV4A 4NU0A 3RT9A 2D7CA 2ZKIA 4GC5A 3G2OA 4QEDA 3GCXA 3UCXA 4M1QA 2YJ5A 2FU5C 2PS3A 4WACA 1VL0A 4B8ZA 1QU2A 1NUAA 3FOWA 1IEXA 2Y77A 2ET6A 4TQ9A 4UHKA 4BQPA 4YRBA 2SCUB 1E6MA 1V35A 1HFJA 3FXAA 5J4VA 5TY0A 4QTUB 2C9ZA 3RV3A 1N5DA 4R1MA 4KDCA 3HMQA 3GPIA 4REMA 5TC4A 1QHHA 1Q3KA 2PMWB 4TL6A 3I62A 1DSSG 3BXEA 3HJBA 1E6WA 4OVKA 4JI3B 1OBOA 1RPTA 4BO1A 3O8OB 1MJNA 1T13A 1DVRA 4TRRA 4D3SA 4EJSC 2E18A 1L7BA 3KYCB 1KJNA 2OT3B 1YS1X 4RESA 1ZMRA 4C4RA 4KLZA 1GXSA 4RPLA 5EJMA 1CUVA 3GLFE 4OQFA 4AMUA 1NBME 5GZ3A 4H1WA 2G1UA 3U3JA 2BGKA 1PWYE 3DQQA 4EY8A 1EX6A 1TCAA 3KBBA 2QXUA 1W4ZA 3PJFA 4J76A 4N9QA 1IAQA 2COEA 3DBLA 4PXYA 3ET5A 3ZS9A 4LJ6A 4LY9A 4KRFA 1GN9A 4FYWA 2QG4A 5IH3A 5FF9A 2X2PA 3BB1A 1SH7A 1WAMA 4RZQA 2VT6A 2H63A 2R6FA 1SXIA 2W6JA 3T5DA 4MJLA 1Q0RA 1U1IA 2OBBA 2Y0DA 4OHKA 3TCNA 5L3RA 3KB1A 3WGUA 3A4LA 2HJHA 1WWKA 2IUUA 1W85A 4CDNA 5DK4A 4XIYA 5IVPA 1OFTA 3I8SA 3TJMA 2WMNB 1O3YA 1N5IA 1NW8A 2INGX 3M7IA 4RZ3A 4BZZA 4DDVA 5JVDF 2A0WA 3DW1X 3L6BA 5SY9A 1E1CB 1OV6A 2J6BA 2QW1A 1RZVA 4AMGA 5F12A 2G5TA 1BKYA 2VBIA 3EDYA 4ZHQA 3BH0A 3LKZA 4AZ0A 1VL2A 5DYTA 2FMKA 1IPEA 3E2IA 4Z86A 4OQ4A 3OCYA 1RYBA 3VRHA 2PR2A 5BUSA 3RAPR 3UPTA 3GRYA 2W00A 1G6OA 4B2PA 2I6QA 4GMHA 1R7RA 3M0EA 4RTOA 3UMCA 2QIPA 4PRZA 2H5LA 5E7IA 3FVQA 1V11B 2GZ1A 4LHVA 2ZYRA 2BFBB 1Y6FA 5BN3B 1VRWA 2B1IA 2P5YA 3CZQA 4PR3A 5C7OO 4QXAA 2NSYA 3G0CA 2VPYA 3FD8A 4KSCA 5KWEA 1EH5A 1VKRA 4AY2A 1HWYA 1EG7A 4L9SA 1Q0PA 3F78A 1HDYA 3PGMA 4LRSB 3H1GA 3W2FA 1Y6GA 1D0SA 5A3VA 2NM0A 2IZ6A 5JCOA 3H4IA 2QTBA 3JW8A 5B36A 1C1XA 5KNDH 3UMSA 4QL3A 2Q46A 3ZGZA 2DPLA 3OZEA 5ER9A 1W5FA 3DBHB 3UG7A 4KL8S 1OX5A 1H5NA 3IP6A 1G6HA 5JJKA 5J2UF 2ZSJA 3RRXA 5B3AA 4ND5A 3ZHXA 1O0CA 2ORIA 4IIFA 3JARA 1DAGA 1WXIA 3A6JA 5EUQB 3VR3A 4KTVE 4PQEA 5AJYA 3RAJA 1AMUA 5HKKA 4MIKA 1FS4A 3AK4A 4I1YA 3IKVA 3ZOZA 1QZTA 3KV3O 3MWGA 5KUTA 2GPSA 1XVVA 1LVGA 1PJAA 3L04A 3NHSA 1SUAA 3WLSA 3DOOA 4MWSA 2WAYA 3TG8A 3Q15C 1WBJB 4C4XA 4F1KA 1JIJA 2HPZA 3L93A 2OGTA 1HK7A 3GG9A 4Q16A 1OI4A 3BQ9A 5AM0A 3W5JA 5GJVC 3QWHA 3LPLA 4WLNA 4F3KA 1X7XB 4C5BA 3D8RA 3N86A 1YMUA 2BMDA 2MDTA 4R1OA 4R1NA 1FEZA 3KDSE 1HC7A 4KOAA 3WKEA 3ZY3A 221PA 1HDIA 4RV4A 3S2ZA 4BX8A 4PQFA 1VSQA 1ZN8A 3OCVA 3DT8A 4A4DA 1N5RA 1CUZA 1AUVA 4MYTA 4F9TA 4YT2A 2OBMA 5BWBA 1NLMA 2FZEA 2PT5A 4XOUA 5AW0A 1FTSA 4B48A 3UCFA 3U13A 1EUQA 1QIJA 4G0XA 2G9RA 2KW5A 3II6X 4TSFD 4HEA1 1MB9A 3O7WA 4C20A 4Q9KA 2ODTX 2P69A 3MSCA 4CR8A 1N0IA 1YQGA 3CEHA 1TZMA 2P4SA 4LRUA 5HP4A 4DUZB 2RBEA 4F6RB 2TSYB 2BLNA 1GGVA 1YRYE 1YQDA 3UJDA 4FMBB 3UUWA 1SXGA 1U7ZA 2ODAA 4JFAA 4LNUB 4ZO4A 2PMKA 1BYUA 1GARA 2CFSA 4FYIA 4IP0A 3F73A 1OPXA 1YL5A 3LUBA 3RFTA 4BNGA 4YRAA 3RU9A 1WEHA 1FZQA 2APJA 2QT1A 3MIIA 1Y8QB 3ROGA 5LR6A 1QGDA 4NMHA 1HLGA 3R6DA 4L5YA 4PSCA 4ZAGA 1VPEA 1L3CA 2QN6A 4EG5A 1ADYA 2AZ4A 2IY7A 1A4UA 3RK0A 3N0WA 1UXJA 4YT4A 4JYAB 1KVSA 1ECBA 3U40A 4RQAA 2G17A 2EKBA 3DMYA 2ZBVA 1EHCA 1RWQA 2HPAA 1FUKA 4LF7B 2A1TS 3CNQS 5BVGA 2IH2A 4LK3A 3KVYA 1HA3A 1PK7A 4LNAA 4OH7A 3V2HA 1FBTA 4Z4GA 1YKGA 1GPJA 2B4YA 3FMPB 5CBPB 1NQWA 3E7XA 5KVCA 2HRZA 2J5QA 5CG2A 2IYRA 4X90A 4DJTA 1OD6A 1P6QA 5IXJA 2XCRB 4F92B 4HEQA 3JZDA 5C5CA 4OYRA 2PX3A 4TKUA 1BEZA 1H93A 4ZZ3A 4D43A 4B2YA 2BEVB 4P92A 3MAAC 1B93A 2CBXA 4RGBA 1IXZA 1POXA 2P5UA 3LZ6A 5FOSA 5LU9A 1Y8AA 4QAJA 1I0IA 4K8RB 4C0QC 5B1EA 1JYFA 5DNVA 1VGVA 3D3KA 1MJ5A 3QX3A 5KOIA 3L6UA 3SHFA 5JECA 4Q7JB 1DBWA 2CLKB 3WLHA 3AGQA 4ETNA 2ZAYA 3O84A 3GJ0A 3JYOA 1QQ7A 4NABA 4AB1A 5F7XA 3F3MA 3UW1A 3TAXA 5KVAA 1GN8A 1DLIA 4FDTA 1ZONA 4GXNA 3ROKA 4NLLA 1I2MA 1SC6A 3HKBB 2W8BA 4FGUA 2DOKA 4BMOB 4MS1B 4TTIA 1GT91 1AQNA 4B09A 2C3UA 1XCGB 1Z08A 3T5GA 3DTYA 1CC1S 1Y1TA 3R7BA 3KJFA 2JW5A 3VR2D 1E2KA 3EZXA 2J30A 1XTJA 4HWOA 3AUKA 5CFQA 4QHSA 4FNAA 2IYOA 4MZXA 3WRWA 4TMZA 1K63A 1Y8RB 3A25A 3G0OA 4S1TA 3T5TA 1KK0A 1EVQA 2PX4A 2VHQA 4MHSA 2DT5A 2NMVA 2EFEB 3W05A 1XDGA 4W7SA 8ATCA 1W34A 1KY2A 4BX9A 1W36B 2ZT7A 3LQRA 3OEYA 4LY6A 4LFBB 1B00A 3BD9A 3KOUA 3OCZA 4J8PA 4IX9A 5ESDA 1NF2A 2JIMA 5I7HA 4FZJA 3CY6A 4HLUA 1ULUA 3FPCA 3L9XA 5C51B 3LSYA 4J6FA 2FQXA 1U0OC 4J0JA 4OBXA 4B4KA 4D4KA 3ZS8A 4IJUA 2H1LA 2CDAA 1I36A 1ZM4A 3ICCA 2CXXA 3H9CA 1ODCA 2A84A 5JAQA 1M8FA 3CVVA 3I2KA 1Y82A 5B2EA 4K26A 4DB2A 1GVNB 1E1CA 1RHJA 3EVDA 1Z4PX 1ISMA 1AQ6A 4HVAA 4XIGS 2WF5A 5E9JA 4CWAA 2JCYA 2XJ4A 4EGJA 1W4AA 1WZIA 2PYIA 3FPKA 3FOAA 3L0IB 1W9MA 3HU3A 1ZHHA 4RS4A 3ITDA 1QG0A 4WFQA 5F5XA 4ZCIA 5J4YA 1IMJA 2ECKA 2Z0MA 2I8CA 3QF4B 3ZE6A 1I0LA 3QBEA 5JD6A 1NM5C 2K2WA 4KN8A 1NXSA 1BDBA 4BCBA 1N8KA 4XDHA 2R6CA 4PSUA 2J6IA 1D2NA 1Q83A 1J2JA 3UICA 4D9CA 3OLZA 2EL9A 3ZWBA 4NNJA 4CU2A 2X0KA 4XSVA 2B6HA 5MN6A 3QEJA 1E9DA 2ZR7A 4WOJA 4YQYA 3CISA 4TL7A 5DULA 5F64A 1NP6A 5ITZA 1OC4A 2HCFA 3GLUA 3HPQA 4EI7A 5FLEX 2HTFA 1QVZA 1TNDA 3BEDA 5JNUA 4W9NC 4ARBA 5FI1B 1CIPA 4JB2A 3UV3A 4GG1A 5B3JC 4Q9JA 2ANBA 1NR5A 4ZICA 4I1OA 1I14A 1NLUA 1N2IA 5ALSA 3CX3A 4DV4B 1RWBA 4QFDA 1R9NA 3P9SA 3W78A 4A8HA 3B9PA 4N1AA 5ED0A 1D4ZA 1WOMA 3H3FA 4F3TA 2GJ9A 3GCZA 4CV3A 3VPSA 3E8XA 3E3OA 4YJ2B 5AIAA 1MB2A 1GITA 2Z98A 3CF2A 1XZJA 6REQA 1I2DA 2V5AA 4ON9A 2MCFA 4BJ1A 1UBKS 4BE7B 1L4NA 1JXMA 2FEMA 4ZKEA 4IINA 3I2HA 1I24A 2X6TA 4PXAA 1Y1SA 1U7WA 2G0TA 2J3JA 2Q2QA 1N2XA 2RI0A 3AR3A 4GECA 4I55B 4NF2A 1M74A 4RK6A 1G20E 5KOHB 3RYIA 4M9XA 2CC2A 3RKUA 4CUKA 4BO5A 1QBKC 4P0QB 5IAEA 3OIFA 1QX4A 3LX6A 2I65A 1JAYA 4CR6A 2B98A 2GJ4A 3GNSA 2XRFA 3DZHA 1TAUA 2NXJA 4OJNA 5G0SA 3DXZA 3I76A 2YV5A 1MB4A 3ZGOA 3GJTA 4FHEA 1RQLA 5FADA 5AD1A 5AJUA 2NUAA 3FF1A 2DJIA 2VEDA 2W71A 4UMFA 2WF6A 5F98A 1QTQA 4A6PA 3ROMA 1PEYA 3HNRA 1SVSA 5FPTA 3KQUA 1TTTA 4IFEA 3A4VA 4OL0A 3ZLVA 1NQAO 4E03A 4NAVA 3RSQA 3K1AA 2JARA 1NR7A 2Q49A 3QUTA 1XJQA 2A59A 2IT1A 3LJKA 1DTEA 3QTLA 1U0SY 1CFJA 5FB3A 1ZRMA 2DSTA 4PINA 3U16A 4WBNB 4OJQA 4B6SA 3GFRA 3L8YA 4MB6A 1MH1A 3N07A 5CT5A 1RLIA 5JVDB 5IVHA 1VSBA 3AV0B 4ZTBA 4KVFA 1PWXA 4YLGA 1PDVA 2QGNA 1SZJG 4WEOA 4BJ3A 2FRVA 1MFZA 1YNSA 2R62A 2XUDA 3MYRA 3OIYA 1L5YA 3PVZA 1FLAA 2RHGB 1AMNA 4UBLA 4R6XA 3QWFA 4B80A 2PKXA 5B3LA 3MRSA 4CCYB 2I1QA 3CVWA 1Z4KA 2XQVA 1U1DA 3LE8A 3TF5A 3PX2A 1VDMA 2K2QB 2EJWA 2P79A 2PGDA 3IPCA 3KRTA 2OHOA 4TZTA 1Z74A 1ISFA 4WDQA 3AUAA 3DEIA 3LMKA 1R5OA 4OQXA 5CG1A 3ZU4A 1ABFA 4M9SA 1NJ8A 3Q5DA 1OUMA 5LQSA 4ZARA 4DQKA 5JSUA 3N2NA 4PO1A 4A0FA 3COZA 4AXXA 5KREA 5CDSA 1XNGA 4R1LA 4CPDA 3CBQA 3DE3X 4BO2A 4QQRA 1D09A 2IWHA 2R7LA 1W6RA 1FFGA 2R65A 2W0MA 2VKQA 2PMEA 1QAQA 3LDUA 4LBYA 4AJOA 4PSDA 3E9CA 1GTZA 3TQQA 1FUUA 4PQRA 2AI2A 2IGTA 5FORA 3U7FB 4A5SA 1NNLA 3DZGA 1CV2A 7GPBA 4P3NA 5CJPA 1VIMA 5EYPA 2FY8A 4LC9A 1RXUA 3KKEA 1WV1A 3E9DA 3FUVA 4BQFA 3UC9A 4LK2A 2XDQA 2D5CA 1K6XA 4OGFA 3R7NA 3C14C 5I01A 3X2EA 2BEUB 3STVA 3UWDA 3IUMA 4UHFA 2BUAA 4G2NA 1KYYA 4XEHA 2A14A 4HH1A 4EW6A 3RJZA 3TLMA 2LPMA 3MOIA 3R0XA 3L9WA 1FU4A 2L82A 3PKZA 4ZVUA 2XNDA 4MAMA 2PUJA 2QHXA 2RAVA 3CXRA 4RCZA 1IE3A 1P33A 3P9RA 4NV0A 4Z0HO 1IN4A 4KIJA 3ESRA 3QMPA 1NC3A 2XA1A 3LRTA 4H4EA 1Y8ZA 3G68A 1RMYA 4N7JA 4DARA 1FC0A 2IP2A 4MINA 4QEKA 4ZYUA 4PHGA 1K1EA 4GX1A 5IJXA 4WJZA 4IJVA 5E6RA 4B17A 3OUZA 2Y1OA 3TSYA 5IHPA 2C7BA 2GRUA 3T9CA 4CF3A 4J3NA 3I42A 1DG1G 4PIMA 3LLMA 3QV2A 4J0CA 2X0JA 1KSGA 2CLFB 2QSZA 1T0BA 2YC2C 4KAJA 3H5IA 2FE1A 1D4AA 3QA3E 3KZNA 1C9MA 3B38A 3D4NA 2J9FA 4K0RA 3CUWA 4GL2A 2WHPA 3B78A 1MKYA 1A88A 1F20A 4KPYA 4YALA 5EESA 3PA6A 3ZWVA 2CLHB 1JUDA 4N0QA 3TRDA 1O6ZA 2OB1A 3TRFA 1J20A 2O1SA 2MSKA 4L3VA 4JAVC 3ZI0A 2PH5A 3A3KA 1CPYA 3LQ1A 4WTOA 2BMVA 4BZQA 2EP8A 3TQIA 4DKJA 2Q1YA 3HS3A 1L4YA 4FB5A 2GCOA 2HLHA 4O1IA 4BDSA 2QRVB 4C3VA 5GGYA 1X94A 2P6PA 4ZRDA 1KWKA 1HPLA 1RACA 4HYTA 4E2FA 4JSRA 5AHRA 4AYTA 2C61A 2Y1LA 1PWHA 2I1VB 4P4GA 3P5BA 5D3QA 4E5SA 2PGNA 3MN1A 4DIMA 2YIVX 1W5BA 4EKEA 3M6LA 4DYVA 4D25A 3MRXA 2Z6QA 2WD8A 4XA8A 4N65A 5KNDD 1XXHA 3RI3A 1NVUQ 3PQ5A 4JIMA 4Q05A 5EIHA 4MVJG 5JCJA 4RNDB 1Y1QA 4NJEA 1PGQA 4RADA 2PUVA 3FDJA 1FUIA 1YJXA 2WWHA 5ERXA 4C0SA 2ZIVB 4P54A 3JWIA 1L9KA 2P40A 3PPYA 3STYA 4QG3A 4FFOA 1Q1GA 3RS0A 5DKFA 4JXJA 2ATCA 2HLDA 5B64A 4XYMA 2F1HA 1QKJA 3ZTWA 3VJRA 3TGPA 3T3GA 4MPJA 3HADA 3UBTA 3TZCA 3N75A 4HS9A 1X74A 1KGSA 2HEGA 4TQGA 3RS2A 2IRWA 5JQWA 4OX9Y 3GH1A 4LJ7A 1UBTS 2O8DA 1OZGA 1IJBA 5HM6A 1PD1A 5F7JA 2WILA 2P9JA 4HKTA 1GSHA 2HZBA 2O3QA 4R81A 4F5EA 1F4VA 1BJRE 5TS3A 2IYNA 3B2EA 5C5EA 1RRCA 4RU1A 5BORA 2E0IA 2PXAA 3HUEA 4B7UA 3IHKA 4P7FA 2XVMA 4MRMB 4XRRA 3I09A 4RK7A 4P5EA 3REFA 1XRRA 1ZL0A 1C0LA 2QX9A 1IRXA 2LGJA 3DCJA 2QGFA 2C57A 4P82A 2WVGA 3DJYA 3OAAD 4D1YA 3PFNA 4YRTA 3WLJA 4AIRA 3O26A 4EMSA 4QXRA 4JU9A 1DEOA 1TUGA 3ZNQA 2DBQA 1WF3A 1GNVA 4WUVA 2DAPA 4JOBA 1IQ0A 4L07A 1P18A 1Z3CA 4M1SA 4WVFA 3K70B 4LF6B 1G3IA 1EQAA 3CTPA 4PYMA 3KXKA 4YCDA 2HD4A 1HFKA 1NRJB 3UHOA 3FZYA 1ZI9A 4M1YA 2WF8A 1IJFA 4EJSB 3U4MA 3WC4A 4C5CA 4GQBA 4MEBA 4A5OA 3GP3A 5E4FA 4KG7A 1SU6A 1B74A 4TS4A 5JSQA 3BWYA 3KNZA 1E5VA 3D7MA 3VZDA 4F2PA 4EATA 1D2GA 2F48A 2YNMC 2BCJQ 5CVEA 3ZK8A 5CEJA 4MPPA 1C5KA 2AYZA 2G4VA 3L0OA 1PFQA 1X8LA 2OGWA 3QEMA 1YF3A 1JDUA 2AG8A 3OLYA 4NZ9A 2ILVA 3SGLA 2V6BA 3WK4A 4AO6A 2M32A 2IYLD 4EAAA 4ZHQB 4XWKA 1JFVA 2EP5A 2IYTA 2VNJA 3LHDA 1H2HA 4QG7A 2Z8ZA 5HS6A 4R16A 4TGLA 3MGGA 3JALA 3FMFA 3QVVA 3AR8A 3TBHA 5CMLA 3BGOS 3IBFA 2JGMA 3DSRA 3DOCA 2PCLA 1NJ5A 1D5WA 5FBZA 4Q9AA 3GJ5A 3FNQA 4WW0A 5C2JB 4TZ0A 2WTBA 1JTEA 1QDEA 2VF7A 3AFOA 3NKLA 721PA 1XMOB 1LLFA 2XOXA 3SXJA 3RK1A 4IOKA 1DFHA 3GZJA 3GGDA 4HAZA 3IPAA 1E6CA 5GINE 2BFCB 2XE6A 4KLCA 1IY0A 1Y5NA 5H68A 3RKRA 1ULZA 2ZWIA 3ND5A 4LCJA 4CKCA 1QDLB 2SKCA 1S5PA 2NTJA 1VE6A 1VE5A 5EZYB 5AVXA 2PLWA 3LRPA 4DR6B 4X84A 1JQ3A 3CLKA 4G1EB 2RDMA 1JNYA 2DFKB 1L3BA 1Z2AA 2IFTA 3K30A 1A2OA 5EC8A 3ZU5A 5ADVA 5HZKA 4D9JA 1TCVA 3G8BA 4TUYF 4GBGA 5FJJA 1H4QA 4MVCA 1YBFA 1AQLA 5AVYA 3K92A 3RIXA 2HM7A 4IW3B 5CXQA 1Y4DE 4HMPA 4Y0NA 4QTXA 2XGSA 3GGCA 2J87A 1IEQA 2JLYA 3K9WA 5KWIA 4LF8B 1S96A 1JX6A 1TLFA 2YHIB 1V1RA 2AFIB 1MQSA 2OZEA 3MJHA 1A9ZA 2I67A 3WWCA 3L0PA 2O23A 4MO9A 3IEPA 3EG5A 2HJRA 2HU5A 5EQJB 4DR5B 3GNQA 4GPTA 3Q5GA 1M34E 4EOGA 4TYWA 1C0KA 4A8TA 5KTMA 4Z99A 4HQNA 5DHQA 2C5LA 3LUGA 1EAYA 3INRA 5GM2A 1FNCA 3VU0A 1LJUA 3AWDA 5AKYA 4UNSA 1FXWA 2CYBA 2GESA 3M89A 1I9CA 1A97A 2ICAA 2LR0A 1Y5RA 5J4LA 3LCUA 3QENA 3ZXYA 1Z0FA 1BGXT 5ELLA 1GCOA 1IVNA 1X7XA 1KH2A 2NAFA 2QROA 1GZ7A 2W37A 4QPNA 4TMFA 3SIRA 3SSNA 5JDCC 4XQEA 5EN4A 2WICA 1I13A 3EXHB 2OCXA 2O2SA 2N75A 3TTTA 1NX6A 3BS4A 1XKLA 2FYTA 2I7VA 2ZIAA 1YS2X 1HE2A 2C54A 3OD5A 4JH0A 2J7KA 3JQBC 3KXIA 4MGYR 4BE4A 1IBLB 1LC3A 1YI8A 1YB2A 4IUCS 2O2XA 1ZU5A 1KOGA 1EFVB 3K0BA 1IG0A 1QYXA 1A8HA 4FEYA 4Y7CA 4BNJA 2EKPA 2VHEA 1ZNQO 5DSZA 3S1AA 1V39A 3ZE0B 4XXHA 2WHQA 5ARBA 4QT0A 3LUCA 3PENA 4QO8A 4BC1A 5ALUA 5BNWA 4XIIA 3DQPA 3OH8A 1PUIA 1VBMA 1PFVA 2QTVA 1H6BA 2W4MA 3OF2A 2NSJA 3VU8A 4XVUA 3H5OA 3UGTA 2RGDA 3FPBA 1JR3D 1ESMA 2OP0A 4N18A 2OZPA 2NO4A 5BV1A 1R0XA 4FU0A 2NU9B 5H8WA 3PC8A 3GRUA 1C7EA 4ZT5A 5GOZA 3SY8A 3EQZA 4KQWA 3FMVA 2B2CA 4KQ2A 5DRTA 1TZJA 2PWAA 3ZZ0A 1E1LA 4DABA 3DKKA 2EFYA 4N5DA 4JUFA 2Q3MA 5LL6P 1HNWB 4EA9A 2PMBA 4YRCA 1SBHA 1Q0QA 4KVAA 3DJFA 4QYWA 3B6KA 5CVVA 4EMTA 4PAMA 1LDEA 2PZKA 3EXAA 5FAKA 2I2WA 1JIQA 4OXYA 5FBRB 2ODNA 3RVNA 3V33A 1UUFA 3LUPA 2J59A 2WMDA 3SHQA 2I3AA 1L8AA 1HM5A 1PT7A 1THGA 2FSVA 2XB6A 2RC6A 5BSFA 5IPFA 2ZYIA 3BQMB 4EYEA 5AI0A 5HZGA 4KFCA 1YA4A 4QXOA 2QG6A 2IV7A 1NVFA 1SUEA 4M1ZA 4A2CA 1L4KA 1FFHA 3BRSA 2HZ7A 1I2BA 4G84A 4AZWA 5HUJA 4A0SA 1MZVA 4NL4H 4E21A 1R0CA 4MUEA 1ANKA 3GAAA 4MQ6A 3RC7A 1V16B 2X1HA 1X70A 3F6BX 3L7MA 4MS1A 5AQ1A 4XGRA 1ZYUA 3D31A 4QNNA 2QSUA 3Q7IA 3MWEB 1VG1A 1U2SA 2WZBA 3BMNB 4JOSA 4Y1GA 4YAEA 2DR2A 1W75A 1T10A 1MXHA 1WSBA 2R7MA 4D97A 4OBEA 1SWWA 3JWJA 4GR4A 4I1PA 1MAAA 2ONZA 2XMBA 3AFIA 3D6MA 2R1TB 1ZNZA 4M0MA 3N5CA 2QGZA 4GLLA 2AR9A 4NBUA 2W8BB 4Q1EA 4B1FA 3TR5A 2HPVA 2O52A 1S2GA 2Y4OA 4HUTA 1V9CA 2CGEA 1QK3A 2OO7A 4MUNA 3B7PA 3B89A 3W1EA 2QU7A 2QUZA 3X2SA 4EUFA 2C2WA 2PIAA 3FRIA 3PG5A 4GX5A 3R8FA 4Q9HA 3TIGA 1L3IA 3PL5A 3F6YA 3O8OA 1ECFA 4G4SP 1QFYA 4HQRA 4ZXPA 1CUXA 4M49A 5CLGA 3RG8A 3N0VA 3IJPA 5B7GA 3FHOA 3GJ3A 1G64A 1SBQA 4Q1VA 3X1WA 3R5FA 3WIBA 1CB0A 1VXRA 4WXYB 4GMKA 4EVSA 1RFLA 1PF7E 4G89A 3HHEA 4NOMA 4MITA 5ALRA 2O48X 4I1RA 2X86A 3HEMA 2XEXA 3MTBA 3UV6A 3G5UA 1DWPA 3VH1A 4ABTA 1LJLA 3OECA 4UMDA 1ULTA 5EL0A 4AURA 1JFSA 4PGHA 4NRDA 4ZYXA 2FW7A 1CUWA 4PHFA 4DQUA 5FLYA 5CBPA 3G13A 4QBKA 4MR9A 1B26A 2FEAA 3EASA 3V4OA 1DJMA 4ICIA 4NENA 3U2QA 1XXHB 2ZPTX 4O2BA 1KBQA 3G7SA 3LKBA 1ZD9A 4Q1FA 5LZ9A 3BRWA 3CURA 1LTHR 4TV8A 3JD3A 2ZIUB 1RM4A 4O0MA 3OIGA 2GSDA 4IHJA 4EF5A 5HKAA 4MR9B 2XYVA 5GV8A 4D9NA 3HCAA 3H0KA 3P96A 3EBOA 4HCJA 1N4DA 2B36A 3HUDA 3H0EA 2ZI6A 2PEZA 2IYVA 2YASA 4MEAA 2GLTA 3FDXA 2QTLA 3I28A 2V0GA 2HW8A 3ER8A 3ECCA 1ES9A 4UTOA 1N0UA 2X8LA 4K9LA 1L5RA 4RPKA 1FXSA 1IIBA 3K6RA 1J1ZA 3ZHVA 2CEAA 1MVNA 3WP1B 2IXFA 4N4AA 5CYFA 3WRVA 1XNHA 2ERXA 3EXFB 2YJ6A 3TTUA 2Z1MA 1D9ZA 1HSOA 1UJ5A 2IIBA 4FB4A 1EXDA 3LOPA 2VHWA 3IMKA 1GNLA 3K4HA 1OY1A 5DTMA 2DH6A 3HWX1 4RVCA 5KEIA 1J07A 3H11A 3E3MA 2V98A 4PNHA 5TPWA 1ZS9A 1E2JA 4GI2A 3M70A 1GZ6A 3QKIA 3CNLA 1RD4A 3D7NA 3RFXA 1MMFB 1DB3A 1CZKA 3NV7A 2I6UA 1TGVA 2H48A 2ZUDA 3BN3A 3DDZX 5T41A 1EHYA 2YIDA 4FGLA 2ADMA 2FPWA 5KU7A 5KU1A 4YMWA 1FRVA 1LW6E 4E46A 1Z9BA 5DEIA 2W2MA 3CVYA 1P0FA 1SHUX 2XMRA 4HNRA 4Y6OA 2ZE6A 1ELOA 2JEOA 3LL7A 4OHWA 2IXDA 3V80A 3OFNA 4BBPA 1W1UA 4NX2A 2PD3A 2WSLA 2E49A 1P1FA 2Z9CA 3EGIA 4DEVA 3L18A 4HZUA 1UEJA 1M6HA 4N54A 1V25A 3P32A 5ICSA 5KYYB 1Z0SA 3BWMA 2I7XA 1UT5A 3G2PA 4KO4S 3PPXA 2C31A 2K7FA 1CJSA 1ZBQA 4NXNB 4EJSA 1J8YF 1T6BY 4L9WA 1Q11A 2EEPA 4X45A 2BFDA 3E0QA 3OT4A 3V8EA 4HAXA 2BMAA 3DKIA 2WU1A 1A5SB 3OBIA 3UWMA 4HVTA 4IGIA 3F3SA 3FJOA 3JR7A 1TZKA 2A3NA 3TPCA 1AMOA 4Q39A 3EXEA 1FS6A 1TA9A 2Z4TA 1PT5A 4JP2A 5CX4A 3WMRA 1KK3A 4CIVA 3ORYA 3V42A 4E5MA 3U31A 3NDPA 4Z5XA 4C2BA 1DQNA 4PZUA 4OD0A 1R8QA 4YH1A 1C4KA 2ZWAA 2VJCA 1JG1A 2BCEA 4D5GA 3K6JA 5JXHA 5FX2A 4Z4IA 1WV0A 1ZEJA 1BYIA 2C1EA 1TLTA 3ZCSA 1E60A 1CYDA 1QHXA 1MIOB 2FTKE 1TECE 2OY0A 2Q4OA 2QYSA 3I6ZA 5BVHB 1KEKA 4G97A 3RK4A 4WKPA 1F2UA 1U11A 1R5NA 1WCWA 4WZBA 2XXJA 3SNKA 4BKQA 1OLUA 1NBMD 1ZNXA 3COVA 4ZOEA 1YUMA 1AGRA 1CB7A 4UFPA 3NJ8A 4Z6KA 1C3EA 5F9HA 3MUOA 4PYQA 1JPJA 3MCZA 3L07A 4LG1A 4J3FA 1YQTA 4RHFA 4ZO8A 4WKNA 1RJ9B 1DX4A 5LP6B 1H8HD 2CHGA 5BSUA 3V1UA 1H9AA 1NXOA 4KP7A 1ISHA 1SD5A 1SBTA 1ZZEA 1HEIA 2GASA 4CCYA 1EM8A 2IUFA 4X1OA 1ORWA 1IYZA 1OYWA 3BILA 3CPJB 3K6KA 4OGLA 5EP2A 4QWWA 5ALVA 5CLFA 3Q3IA 5NLLA 1K7CA 2QM8A 1AT1A 3C39A 3VNQA 3G8CA 4LX8A 1GRRA 2YXDA 4DS3A 2P0EA 5DYYA 3ZXUB 3FIJA 2YRFA 1TPZA 5K0BA 4BLQA 2G4CA 2HF7A 2EG9A 4RWZA 4MYDA 1E1DA 3JQDA 5HIKA 4K3VA 4RTJA 2JCBA 4BJHB 3B1KA 3TIXB 2VDPB 2G8LA 1H2ZA 1FL9A 2FRXA 3D0OA 1BE0A 3D8HA 3DE6X 1Q50A 1FVHA 3E23A 2FK8A 3G5AA 4GI5A 4RQUA 2VWHA 4F5WA 2PX2A 4COKA 2Z43A 3FFBA 4B3FX 3H5AA 2AB0A 1G8KA 2CVZA 4AK9A 3EC7A 4D3ZA 5LQKA 5EZ6B 3WFIA 3K2IA 3N1UA 5JMOA 4BFVA 4ZTUB 3QKWA 1GUAA 3UT6A 1YASA 1M5UA 3LPDA 2X4DA 1VJ5A 2NO6A 3PUZA 4FS3A 5KOJB 5DM70 3I6IA 1U3DA 2XRMA 5EMKA 1KP2A 1CF4A 3BYZA 1PL6A 3W9YA 1ZC4A 3IB3A 3QJYA 5HIJA 2QMOA 2SCUA 4KXYA 5FQNA 1YI0A 3TPFA 5E1BA 1XHLA 3MWJA 4URXR 3O4RA 2ZRNA 3FB4A 2JFFA 3D1VA 3DCYA 3JU3A 4I55A 4XYGA 1IQRA 4YA6A 4X7BA 5B30A 3B12A 1SXPA 2D5BA 1ZN9A 4GXRA 4RE5A 4BMSA 4ZV4A 2FHSA 2IH5A 4CIDA 1GZDA 3Q2IA 3ID6C 5GVRA 4MUHA 3V8RA 5ICCA 4ZVSA 4MHTA 2ZBUA 4ZEWA 5LZ7A 3QXSA 1A4RA 1WOYA 3UVEA 3V55A 3ZIDA 1AN9A 4M2LA 4BEJA 1JDVA 1SVUA 3N8IA 4B35A 1K5HA 2FMTA 2Y0BA 2WYIA 2W6IA 1WLSA 3GGGA 1WNFA 1YU6A 3M6AA 1KSHA 1ZW1A 3P9KA 4NG5A 1OZFA 4OOFA 4EIWA 1Z0ZA 1T1EA 2EU8A 4RFSA 5FDFA 1FNSA 1KAEA 1X7HA 1XRQA 3ESCA 1BXKA 5AR1A 3IBGA 2QP4A 1GAWA 2HQRA 1NC1A 2BF4A 3I04M 4L0QA 2JF0A 4X3CA 5FOTA 2ACEA 2HU7A 3LC0A 4KYVA 4O4JB 3SBXA 1DOAA 2GFIA 3D43A 2RHHA 3WYEA 4B84A 1U8UA 1CTQA 1N2SA 3AR5A 2IC5A 3AP1A 2EX1A 2IHZA 4GOXA 2C7QA 2VPZA 1UJ2A 2HDNB 4PGMA 1ESNA 3LBHA 2B61A 3IPXA 4PLVA 4BEWA 2O7NA 2QN7A 1Q5PA 3H1AA 4L0MA 1GKYA 2BZGA 4UNIA 1S2DA 2N42A 2JS7A 3BGIA 3QQPA 5ARCA 4QBFA 3KO8A 1KU6A 1NVWQ 1OFUX 2JFGA 5T8KA 3CCBA 5SYMA 3RU7A 3PRYA 4DWJA 3H19A 4LHEA 3FHTA 1HNXB 2DSNA 4ZCRA 4C4SA 1NIPA 1OU0A 4RD1A 1FVFA 1C2TA 4DDWA 1P73A 1GUBA 4OB7A 5D01A 4COOA 5GJCA 3U9SA 1MA3A 4QYIB 4YJGA 4DM4A 5HK8A 5KS2A 1Z25A 1USVA 4R83A 1KKLA 4FFBB 1C8VB 4DREA 4CDMA 5HW0A 2C9DA 1ORHA 3WK5A 4TLLB 3ESYA 1PNRA 1JHMA 3UQZA 1HEYA 4R8MA 1Z3IX 2CNOA 3ZYZA 3K6SA 2B1QA 4BP3A 2GBLC 3URMA 3Q7RA 1F8GA 2FZCA 2EHJA 4YV2A 2A5FA 3GLGE 1N1EA 4ND6A 3PWKA 3ZW9A 1FFSA 1HBJA 2O5VA 4PZEA 4INOA 2C96A 2QWXA 4U2EA 4QDKA 1WIWA 3EB9A 1U5BB 1JHAA 3KLNA 4H0NA 4ZEXA 3X1MA 5CUQA 3DZCA 1ISRA 2R2AA 4O25A 2B83A 1SHKA 4AO7A 1E59A 1NDQA 1QCZA 2Q27A 3NLLA 2HGZA 2H7VA 1RHKA 3A9VA 5IW8A 1U63A 3OLWA 3IOEA 5K8JB 3B3GA 5CITA 1T1IA 5B53A 1YFKA 4OIMA 4R2LA 2BISA 4F12A 1VMEA 1E4VA 1YCGA 5IH7A 5J9FA 2WM3A 2A35A 3EMDA 3SU8A 1WW2A 1PP4A 2BE9A 4BMXA 1YACA 1J00A 2VDRB 2VUIB 4IXTA 3RSSA 5K8LA 3I5YA 2JFPA 1Z5UA 3OTWA 1DEKA 4FYVA 4KRXA 2HK6A 1AKRA 5HMLA 1Y3CE 4DR7B 1O96B 2OVFA 2XXAB 5BMVF 1A9TA 1TQ6A 2XX3A 1CR4A 4RA6A 4NYIR 4XVRA 1V6AA 4UUNA 3EEBA 1I7NA 1IN5A 4EG8A 5EXXA 2QEQA 3C98A 1RYZA 1VCMA 2A2ZA 4KX3A 4RENA 3BWEA 4U9UA 1Z6PA 5E6UA 1MW8X 4CU5A 3N2GA 4J16C 1Y80A 3FSGA 1A98A 1QR6A 1X9HA 2W2LD 4R5HA 3N6RA 4UD6A 5DNWA 5KDLA 5HX7A 1M0SA 4UQLA 1SXJD 2DECA 3GHYA 1NW4A 4OXKA 2NT3A 3KBOA 4X64B 3ANNA 2I5PO 3B3FA 3DOEA 2CFOA 4RIHA 4V39A 1H9BA 1X77A 4FD2A 4NPHA 2TECE 2XUKA 1EIZA 4KN9S 2HFKA 4WJKB 5D5HA 3PD0A 5HEKA 5BQOA 2GCOB 5CVUA 2WG2A 3U56A 1U3WA 4CEIB 4K40A 1O5TA 2IXEA 3SZ3A 1NUSA 3O83A 4FE3A 2EKQA 2XNCA 1YBMA 4QHYA 2PUBA 1XQ1A 2UYCA 1F51E 4RLFA 3G7NA 5GONA 3HUTA 3D5QA 2XWJI 3BZWA 5SZHB 4KRYA 3SMVA 3VZSA 1UOQA 4B8WA 2VZ8A 3AIMA 3OEED 1II8B 4EKGA 2BFCA 5A5EA 1E66A 2F62A 4GLOA 4BATA 3NHWA 4MB2A 1U5CA 4Z7QB 5KC8A 1G41A 4DV7B 1UJNA 3T0FA 3NTRA 2OZKA 1M6EX 1CUYA 2JGNA 2VP4A 2NV2B 2YWRA 1JLSA 1R8SA 2YYZA 1AS0A 2Q4TA 3ONWA 3UNXA 2OV1A 5JFGA 5K0SA 2JK1A 3EUWA 2WWFA 3FTEA 5A5VA 1RBYA 4MQLA 4V0KA 2YWCA 1ZSNA 4WY5A 3PS9A 2JZCA 2GM5A 2Q5EA 2VT7A 3PUYA 4LFCB 2H1RA 2O3RA 1EE9A 1SHZA 4MK4A 2ZE8A 3B3JA 4NWIA 1HZZC 3Q8LA 4JT4A 5CAEA 1EFAA 1NUQA 2AVDA 4FKBA 5KSZA 4RK5A 4H1UA 4AN0A 1GAEO 2H1HA 1X7WA 1XKTA 2EHDA 5EKUA 2R3SA 5COBA 4R71A 5KYXB 1CE8A 1NXQA 4RKYA 3IOYA 1O5OA 4KGVA 4HDKB 4EW2A 4JV5B 5K0TA 5J63A 3ED5A 1CY4A 2Q1XA 2PZEA 4P53A 3SIWA 3N28A 4PYJA 3H2YA 4M0LA 2E4UA 5I9MA 3ICOA 1JECA 2GM3A 4KO2S 1XQVA 4JJIA 4W6QA 3GGOA 3SFZA 3A05A 1B8OA 4WNAB 1R2QA 1DMRA 1XMJA 5J4KA 3WB0A 2W8ZA 3DMNA 4KYTA 4URHA 1E7RA 2LNDA 2Q9CA 3WIVA 1VYTA 2GPAA 1JDBB 4TT3A 5FULA 2ZQYA 1AXEA 3WBJA 4DA7A 1XTZA 4CM4A 1UXIA 4UXIA 1GUDA 1DX6A 2OHXA 4P58A 4MGEA 1BW9A 1XLVA 3WNDA 1ZBDA 2V7XA 3HLYA 3C6XA 3P2YA 4H7IA 3WK6A 4MMZB 2FJ0A 1RLUA 1JVBA 3X43A 3T1YB 3BTOA 3TTXA 3WK9A 1SG9A 2Q5HA 1CNMA 2W6CX 1ZH4A 3LO5A 3TD2A 3B5JA 1JLLB 4OK3A 1NU8A 2PUEA 5EEGA 1V7CA 5ITWA 4D96A 3PQFA 2V5VA 1WCXA 5H9VA 1SVWA 3ANYB 3ESDA 2RGNC 3F8SA 2WWGA 4ZCSA 1K6MA 3V32A 2F1JA 4D42A 5LNK6 1CF9A 1SXJE 4KXQA 2JFBA 3OHSX 5A1JA 1IM2A 4UPEA 2BJWA 2EJUA 4L6AA 1OW3B 4TTAA 1H65A 1R4NB 1DKUA 1LV7A 4X95A 5IEBA 1VBKA 4IWXA 3GZNB 3N2YA 1RRGA 2EP7A 3IV6A 6AT1A 1ZLYA 3DZFA 4H6XA 5KTSA 5EWJB 3UW3A 2FF7A 2FPGA 1VLVA 2VH2A 3I2YX 1T4GA 1F1JA 1MC4A 2BKUA 2NZJA 1KYTA 1NBAA 1RAFA 4I5IA 2AMVA 3DHEA 2HIMA 2P1DA 4LWOA 4G8CA 4LKRA 2YS7A 2OTCA 4TV8B 3Q8XB 1CJMA 1BGVA 3V8PA 3VDXA 4E5KA 4EB0A 1Q0LA 3FYTA 4QU0A 2JGLA 4JC4A 4YCJA 4Y2QA 2R0QC 3OX4A 5EZYA 1SK8A 5JJCA 3ME5A 3KDAA 1W48A 2AX3A 4RL4A 2C4UA 1GA4A 1HDGO 4GI1A 3MJEA 2AE2A 3IERA 4C3UA 4YC7A 3NT5A 2GETA 4PO8A 1RYFA 2HA7A 3LA6A 3LHSA 3OIUA 1E2EA 1JGTA 2FGKA 2AOVA 2XCOA 1WZNA 2X77A 4H35A 1XNRB 4IDOA 2AQKA 4Q4AA 2KB0A 1EBFA 2QY9A 5F33A 5ED4A 5TIIA 4CUJA 2NPOA 3LNTA 1ORTA 3SEQA 1Z7WA 4XYLA 3HZRA 3A9TA 2WLSA 3HGQA 4QFCA 5LXTA 3R3XA 3GVPA 2CDBA 3THSA 4CCAA 2I66A 5ALNA 4J43A 5HF6A 3W1VA 2EZUA 2Q0HA 3CF6R 3TGLA 1KEPA 4NESA 1PEKE 1X9IA 3PDUA 2OILA 1N32B 3OPXA 2PFGA 5HIAA 3ENWA 3UKJA 4U2CA 1C0IA 1P75A 4G0MA 3VQTA 3H8VA 4MULA 5ERYA 3WDMA 2NV6A 2FOXA 4IOJA 2HQBA 4PPFA 4JI5B 1V3VA 1KA9H 3OM8A 3L7YA 4JI0B 1EFRD 3LF1A 3AJ8A 3WKCA 2E7ZA 2EDCA 2QIOA 3CW9A 2GPNA 3NDIA 3P97A 1C1DA 4NDZA 4O4JA 4DNQA 4DNXA 3JRNA 2X4IA 5B58T 1KMQA 4LZAA 4NPCA 2HA0A 2P62A 3PVSA 3HFSA 3RS7A 4DZRA 2WNSA 4D9FA 2QPAA 2K4MA 1WABA 1Z6QA 3PYLA 1PG5A 4X62B 3B8EA 1ZR2A 1ZD1A 3KPJA 3GPLA 2IXGA 4URFA 2P78A 3JYPA 3KJNA 4R5MA 3NNSA 2HF2A 4WZAA 1ZRSA 2AW5A 5THQA 3SJCA 4N49A 2VDNB 3LLSA 1NF3A 3LCRA 4RCVA 4O33A 5FXMA 3HVHA 2C92A 4WN9B 4RQTA 5I6DA 5K9ZA 1KQPA 3OQIA 4KIGA 2WA1A 5AXBA 2OFFA 4DCVA 3AVQA 4OO3A 4DGQA 4FZVA 4LOKA 3I9OA 4OLJA 1CEXA 1Y9AA 4G5GA 4RZ2A 4H1VA 2XUIA 2ID8A 2ZOSA 4O2AA 1Z18A 2BGLA 1OFVA 5JD5A 3IQHX 2OOKA 3OI7A 4PO3X 1U9ZA 5A5DA 3HZOA 3M83A 2L69A 4JYZA 3SYTA 3CNHA 1T4DA 3LQQA 3G0HA 1E3MA 2H3HA 4RIFA 1A0OA 1ORVA 2QF7A 3RJ5A 1EFHA 2Q4BA 2PBLA 2B5WA 2ZRDA 3BZUA 5LB2A 5GJBA 4KR3A 4KQXA 3COPA 3O47A 4RJKA 4WGGA 2MINA 2F3QA 2QUJA 3DL7A 3PC4A 3DWFA 3THXB 3T3EA 4BB0A 1ADBA 1EP9A 1O5IA 1R0YA 2VI5A 3CG4A 4LSMA 4TSRA 1XD9A 3NQ41 1G8MA 5LOVB 2WIFA 1JG7A 2AXNA 2WM9B 1Y9EA 4ZQHA 1DAHA 1QOZA 4Q7KA 3EIXA 2O06A 2O8BB 3REOA 3U09A 1G5RA 9MHTA 2V0NA 4FBGA 3IELA 2ORYA 2ONYA 4Q4AB 4P3KA 4H7PA 4U8GA 4G6ZA 1K4YA 1SBIA 4OF4A 2EIXA 1G8YA 5H81A 1JTVA 3N8DA 4D3YA 5CFLA 5EIFA 3L8ZA 5DOVA 1GA1A 3C1UA 3U44B 3LPNA 3D2AA 4E2WA 2IPMA 2O8VA 1EGAA 2PJDA 2W98A 3CUSA 2WD7A 3E61A 5P8WA 1I2AA 3TE7A 3H3JA 2ID4A 3L02A 2D00A 5I51A 4ZAYA 2N3ZA 2XIQA 3P19A 1P0PA 4LJLA 4CM7A 4D7AA 3IDOA 4U7FA 1CJBA 3EOBI 3GRAA 1YQUA 2VP9A 2XMZA 3KTOA 3NHKA 1P7VA 4LPKA 4ZAZA 1ZH6A 1G63A 3IQWA 5EFOA 4IWNA 3R5SA 2AC4A 4C3ZA 1B42A 2ZS8A 1OBVA 1MB3A 2D54A 4CN9A 1K8XB 2NQ2C 3I9FA 3VC3A 5CIWA 3H7IA 2J0VA 2XUAA 4BO3A 2OKCA 2WUFA 1OU4A 4GE0A 1ZJWA 1ZGJA 3AB7A 5BXQC 1JEDA 1LSJA 1UMBB 2JBWA 4HAIA 3G7UA 5IASA 4DOMA 3QJ5A 3ICQB 4RZXA 2ETXA 3OX1A 2JJ1D 4BQRA 1PVOA 4QLOA 4GSYA 1PNTA 4HOYA 4EVQA 1QGED 4HQLA 1QCCA 1EK1A 1FFXA 2BFFB 3E03A 3JQPA 3MJDA 3SR0A 1ZK4A 3UT0A 5B57C 5EJ7A 2XZOA 3IQXA 4RD2A 1A9QA 1EDZA 4I3GA 4TLAA 4C30A 4C7BA 5KWSA 4EF4A 1UJBA 3AERA 4D0NA 3HJFA 2NIPA 1NAHA 3E0XA 1PCXA 2DX7A 4G8DA 4X5OA 1GU1A 3UK0A 4ZGBA 4L08A 2QVGA 4R8SA 3GFTA 2WHEA 2D2XA 3NXSA 4R2JA 1RW4A 2WSYB 3RS4A 5A9SB 4I3FA 3A6ZA 1XJCA 5FOWA 4KUGA 1QX3A 3FG9A 4QVKA 4ERNA 2PSJA 2Z95A 4TKVB 3AUXA 2JLUA 5HKKD 1UM9B 1PVVA 4E11A 5JSFA 1B8NA 3T1QA 5SICE 4BKOA 5JRJA 3OF5A 1D1TA 1O7JA 2V7UA 2X9QA 5AW1A 4OJYA 4MQ5A 1NWCA 3QWBA 2DE0X 2RJNA 2VIIA 2EJVA 3AJAA 4DLRA 3PC3A 1GDDA 1XZIA 3ROPA 2ZJ6A 4JUIA 4YAIA 1KJWA 3HJTA 2O0JA 4N3CA 2P8JA 3R9WA 4KTTE 1DC7A 2PU5A 2C0PA 5LA6A 1F17A 2OXIA 4LI0A 2WFLA 4RJJA 3CG0A 3N2LA 1M2FA 2HB6A 1YHZA 4S0ZA 4A23A 1I3CA 2YWBA 3UF0A 2WV9A 1AKVA 1V4VA 4N3AA 2JIRA 2YW9A 3AEKB 4HH4A 4OAPA 2JFWA 3WRXC 3I1YA 3ETLA 3N2IA 3SR3A 1RS0A 3D4OA 3MRVA 1IJKA 3HCCA 2PA3A 5CT9A 3PHCA 2HWUA 4MYUA 4IIDA 4O2AB 4HFJA 5ICEA 2C5EA 2O5EA 3C3XA 1GPAA 2ZAOA 4G37A 2HV8A 2VK4A 4FCVA 4XIJA 1CRQA 4LJ8A 5REQB 3ZCPA 4F06A 4RULA 4UAGA 2W48A 4IH9A 4XYBA 3UKDA 1S1CA 5TX7A 4G8JA 2FLKA 2R1ZA 3EOZA 1DQYA 3DT6A 3HJUA 3AO0B 5E2AA 3ROTA 4ZGGA 2VWPA 1Z38A 1L8QA 2JKVA 3D4IA 2FX5A 1ZP6A 3ABOB 5BRAA 2QU8A 4J94A 5CB4B 1T15A 1T3SA 4CIYA 2IDKA 4FN4A 2FPMA 3HDYA 1L5KA 1QDUA 1P4JA 1W1IA 2ZSKA 3AR6A 4EI9A 2KLHA 2ZUWA 3NH9A 5H0IA 2FJPA 2H4ZA 4OX9B 1RBMA 4WV3A 4JLNA 3PV0A 5J1TB 4DRYA 1Z88A 1QV6A 1ZC3A 2ZYVX 2QRLA 1T0UA 1UMKA 3QXGA 4WQMA 4MRAA 2IHBA 3SICE 1C3VA 2C0QA 4YXWA 3DD5A 4GBJA 1GPUA 4FVTA 5JDCA 1TIKA 3AVPA 1B0ZA 4MB0A 1SJ9A 2IZ0A 2P3QA 1X1RA 5IYZB 1XZFA 2RH9B 3ONVA 4G0NA 4W9MC 2EL7A 3U4QB 3BXOA 4RF5A 4A92A 3O9ZA 1YDEA 4LSWA 3U7QB 4CODB 3GLFA 3SR4A 1DQRA 2ALJA 3VPHA 1JFTA 1GNPA 4CL2A 3DA8A 2PFSA 4YWHA 2B35A 4YUVA 1XUOA 5DSTA 3FTQA 5JS1A 2Q1TA 5KMGB 5IFKA 4QC2A 1DJLA 2B6NA 2WUGA 4F46A 5HVNA 3K0KA 2EX0A 3LP8A 4BXOB 4FGWA 3V5NA 521PA 4PNZA 4FGJA 3WG9A 2JD2A 4L2IA 3B3QA 1E3DA 3BL5A 3HBAA 1UBRS 2A78A 2ZEJA 2EDAA 4YDRA 5F52A 1FDOA 1AY0A 1MD9A 3CRZA 1SPBS 2NSDA 2J3DA 1YB6A 3DLIA 4XYEA 4EB6A 5B4UA 3IKTA 4L8VA 1FTYA 4Y2RA 5J58A 4OLHA 5H82A 1QONA 1K8RA 3DBRB 2X3YA 4AMVA 5HKBA 4TV8F 3RIMA 4D99A 3OP1A 3PICA 1XTBA 1WB4A 4GC9A 5BV8A 3A4MA 3EW9A 3S2SA 3OE7D 2OZLB 2QJTA 4OHBA 1CUSA 4IOLA 2VPXA 5E4YA 4MKHA 3CUTA 4YR9A 5HS4A 1JR2A 2BGGA 1F5SA 4FOLA 4TT3D 1ESZA 3JQGB 4NBTA 1ZCFA 2P2DA 1CBUA 1XAJA 2JFNA 4P3OA 4EY4A 3ZJUA 2O19A 1GT6A 2X0NA 4YP7A 1JAHA 3NRCA 4PR0A 4BZXA 2G76A 5COAA 1GO2A 4PYRA 2BT4A 3PSHA 4EHBA 4UOZA 2VEOA 5KSWB 1V41E 3CUKA 2VP3A 2VLIA 4CDRA 1R27A 1Y33E 3H05A 1JXAA 2XBLA 1PQWA 2R44A 2PIDA 2YL2A 3E22A 2NYRA 1YHYA 3KEOA 4ZO9A 5DIZA 5A9RA 2IPLA 2AOUB 1V5EA 4WE3A 3V9PA 3RFVA 4F1JA 3ZHYA 1P1CA 3VC2A 5AM2A 4YHHB 2JAUA 1XU9A 1JQJC 5EKXA 3WGHA 3WGOA 2R4TA 1E1QA 2FSVC 2PK3A 4UXJA 1F6BA 3QBVA 1OAKA 4Z1MA 1U81A 2RG7A 3IUPA 2H9AA 2RIPA 2X8BA 5TMEA 1M6YA 1TEXA 4EPWA 1X9GA 4YRIA 3EWSA 1BC5A 2H1CA 2R8PA 2XYGA 3GELA 1BXRA 2G9ZA 3I9LA 3PR1A 3Q3HA 4MWTA 3UXMA 3DDUA 1M83A 2GKOA 2ZYAA 4UKDA 2BM9A 5CA0A 4Z2YA 4MSUA 5B7QA 4IL5A 3NAZA 4MYCA 3TEJA 1T2NA 4H7DA 4HQ6A 1LPSA 2GHRA 4BFUA 2QRMA 3F4BA 1BE8A 5T3YA 4CMCA 1W44A 1L7PA 3ZDYB 5DNDA 4C5AA 3MPUA 2XF8A 1RE0A 4HWKA 4Y2VA 3QU7A 4BU0A 4D4IA 2DG2A 1TQHA 2NU7A 5DWVA 4MP3A 5D85A 2J48A 2QTRA 1QO0A 4FQ8A 2BTEA 3BOSA 3RBAA 1EFVA 1ULHA 1MAVA 4W1RA 5DCUA 2ZAMA 4MGIR 1OI3A 1T5DX 4K9RA 1R18A 1XQ9A 2Z3WA 4WZZA 1SCIA 3WMEA 4Z7NB 4IJ5A 4ESHA 3X2FA 3NGLA 3QKTA 4FOOA 3D9QX 1SOAA 1TUEA