2A9YA

Crystal structure of t. gondii adenosine kinase complexed with n6-dimethyladenosine
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
351
structure length
351
Chain Sequence
TGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAEKTALSTANKEHAVEVCTGALRLLTAGQNTSATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate analogs induce an intermediate conformational change in Toxoplasma gondii adenosine kinase
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Signaling protein,transferase
molecule keywords adenosine kinase
total genus 123
structure length 351
sequence length 351
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 2a9yA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2a9yA01
3KTNA 3QA2A 4DC3A 1RK2A 3NL5A 4E8ZA 4YL5A 3RQ5A 4EBUA 1V19A 5EY7A 3B1OA 3BF5A 3JULA 3MBHA 5TRWA 4KBEA 1GQTA 4XCKA 2F7KA 3EWMA 3NC9A 3LJSA 2HW1A 5F11A 3DZVA 1RFVA 1TD2A 3N1CA 4O1GA 4LBGA 4C5KA 1V1AA 4B8SA 4E84A 1RFTA 4S1HA 3UBOA 3RQQA 2AB8A 1TZ3A 2NWHA 2I6BA 2YXTA 2HQQA 3HPDA 1LHPA 2RBCA 4X8FA 2C4EA 3RREA 3KEUA 3IBQA 3QAIA 1ESJA 1GC5A 2I5BA 4JJPA 2DDOA 3PZSA 5BYEA 2AX3A 3IQ0A 3GO7A 3W4SA 2AFBA 4JKSA 2A9YA 3RQ8A 4O1LA 3UMPA 2QCVA 3RT7A 4PVVA 3I3YA 1UA4A 1L2LA 1WYEA 3UQ6A 4S1IA 2PKNA 2V78A 5CM5A 3RTAA 1EKKA 3FHYA 5CGEA 3RSSA 5C40A 4LBXA 4N08A 4K9IA 3RS9A 2AJRA 3B1RA 2ABQA 4LCAA 3RY7A 3HYOA 3NBWA 4S1MA 3CQDA 5C41A 4C5LA 3RSQA 1JXIA 4XDAA 4C5NA 3GBUA 3RPHA 4C5MA 3RQ6A 3RQXA 4XF7A 1YGJA 2Q5RA 1YGKA 3VASA 3NM3A 4EUMA 4LC4A 3RRFA 2AWDA 5BYDA 3RU3A 1LIIA 1C3QA 2VARA 3IE7A 4K93A 1VK4A 2C49A 1VI9A 2R3BA 4K8CA 2AA0A 3IN1A 3RM5A 4B8RA 4E69A 3RT9A 4K8KA 3RRJA 2F02A 2JG1A 3LOOA 1RKSA 4EN4A 1V1BA 3UMOA 1KYHA 3RTBA 3RQ2A 1LIOA 3K9EA 3VAQA 2DDWA 2PKMA 3BGKA 2FV7A 3NM1A 4UBEA 4E8WA 1LIKA 3RQHA 5B6AA 4JKUA 5C3YA 5COJA 3UQEA 1TYYA 2DCNA 2JG5A 3LHXA 2PKKA 3HICA 3B1PA 2PKFA 1DGMA 2XTBA 3KD6A 4C5JA 4KANA 1UB0A 3IKHA 3NC2A 3UQ9A 4GM6A 1RFUA 5TQIA 5BYCA 1RKDA 3MBJA 2HLZA 3Q92A 3RU2A 3KZHA 3NL2A 2AJPA 3B1NA 2R3EA 5EYNA 1LHRA 2QHPA 3NBVA 4N09A 3NCAA 3PL2A 1VM7A 3RTCA 5C3ZA 1JXHA 2ABSA 3IH0A 3LKIA 2YXUA 3RRBA 4E3AA 3RTDA 5CGAA 5F0ZA 4YWRA 3K5WA 3NL6A 4WJMA 2DDMA 3RTGA 1ESQA 4KADA 3RSGA 4DU5A 1V1SA 2A9ZA 3GO6A 3NL3A 1LIJA 4U7XA 4K9CA 3Q1YA 1U2XA 4E8YA 3B1QA 4S1IB 2I6AA 4XF6A 1TZ6A 3OTXA 2JGVA 1YHJA 3RO4A 3RPZA 4KAHA 1RKAA 3FHXA 4KALA 3DRWA 3RTEA 3RS8A 3ZS7A 3B3LA 3UQDA 4K8PA 4K8TA 3RSFA 4EOHA 1EKQA 3H49A 3H74A 5BYFA 1BX4A
chains in the Genus database with same CATH superfamily
3KTNA 3QA2A 4DC3A 1RK2A 3NL5A 4E8ZA 4YL5A 3RQ5A 4C13A 4EBUA 1V19A 5EY7A 1P31A 3B1OA 1FGSA 3BF5A 3JULA 3MBHA 4KBEA 1GQTA 4XCKA 2F7KA 3EWMA 3NC9A 3ZS7A 3LJSA 2HW1A 5F11A 2WJPA 3DZVA 1RFVA 3EAGA 1TD2A 3N1CA 4O1GA 4LBGA 4C5KA 3HJ6A 3QCZA 4CVKA 1V1AA 4B8SA 4E84A 1RFTA 4S1HA 3UBOA 3RQQA 2AB8A 1TZ3A 4ZIYA 3ZL8A 1EEHA 2I6BA 2NWHA 2YXTA 2HQQA 3HPDA 1LHPA 2RBCA 4X8FA 2C4EA 3RREA 3KEUA 3IBQA 3QAIA 1ESJA 1GC5A 2I5BA 1O5ZA 2DDOA 3PZSA 4JJPA 5BYEA 2AX3A 3IQ0A 3GO7A 3W4SA 2AFBA 4JKSA 2Y66A 2A9YA 3RQ8A 4O1LA 3UMPA 2QCVA 3RT7A 1JBVA 4PVVA 4BUCA 3I3YA 1UA4A 1L2LA 1WYEA 3UQ6A 4S1IA 2PKNA 2V78A 3UAGA 2VTDA 5CM5A 3RTAA 1EKKA 3FHYA 5CGEA 2XJAA 4CVLA 4QF5A 3RSSA 5C40A 4LBXA 1E8CA 2VORA 4N08A 4K9IA 3RS9A 2AJRA 3B1RA 2ABQA 4LCAA 3RY7A 4HV4A 3HYOA 3NBWA 4S1MA 3CQDA 1W7KA 4BUBA 4C5LA 3RSQA 1JXIA 4XDAA 4C5NA 3GBUA 3RPHA 4C5MA 3RQ6A 3RQXA 4XF7A 1YGJA 2Q5RA 1YGKA 3VASA 3NM3A 4EUMA 1GG4A 4LC4A 2AWDA 3RRFA 5BYDA 3RU3A 1LIIA 1GQQA 1C3QA 2UAGA 2VARA 3IE7A 4K93A 1VK4A 2C49A 4B8RA 1VI9A 2R3BA 2AA0A 3IN1A 3N2AA 4K8CA 4E69A 3RT9A 4K8KA 3RRJA 2F02A 2JG1A 3LOOA 1RKSA 4EN4A 3UQDA 1V1BA 1GQYA 3UMOA 1KYHA 3RTBA 3RQ2A 1LIOA 3ZM6A 3K9EA 3VAQA 2DDWA 2PKMA 3BGKA 2FV7A 3NM1A 4UBEA 4E8WA 1LIKA 3RQHA 5B6AA 2UUOA 3HN7A 4JKUA 5C3YA 5COJA 2X5OA 1TYYA 2DCNA 3UQEA 2JG5A 2JFFA 3LHXA 2PKKA 2GCBA 3HICA 2XPCA 2GC6A 2PKFA 3B1PA 1DGMA 2XTBA 3KD6A 2Y67A 4KANA 1UB0A 3IKHA 3NC2A 3UQ9A 3NRSA 1RFUA 4GM6A 5TQIA 4C12A 5TRWA 5A5EA 1RKDA 5BYCA 3MBJA 2HLZA 3Q92A 3RU2A 1UAGA 3KZHA 3NL2A 2AJPA 1E0DA 2VOSA 2R3EA 3B1NA 5EYNA 1LHRA 2QHPA 5A5FA 3NBVA 4N09A 1W78A 3NCAA 3PL2A 1VM7A 3RTCA 5C3ZA 1JXHA 3RM5A 4UAGA 2ABSA 3IH0A 3LKIA 2YXUA 3RRBA 4E3AA 2AM1A 3RTDA 3LK7A 5CGAA 4C5JA 5F0ZA 2AM2A 4YWRA 3K5WA 3NL6A 4WJMA 2DDMA 3RTGA 2UUPA 1ESQA 2F00A 2GC5A 4KADA 3RSGA 4DU5A 1V1SA 5C41A 2A9ZA 3GO6A 3NL3A 1LIJA 2VTEA 4K9CA 4U7XA 3Q1YA 1U2XA 4E8YA 3B1QA 4CVMA 4S1IB 1J6UA 2I6AA 2JFHA 2GCAA 4XF6A 1TZ6A 3OTXA 2JGVA 1YHJA 2WTZA 3RO4A 3RPZA 3ZM5A 4KAHA 1RKAA 3FHXA 4KALA 3DRWA 2JFGA 3RS8A 2Y1OA 3B3LA 3RTEA 4K8PA 3PYZA 4K8TA 3RSFA 1P3DA 4EOHA 2Y68A 4QDIA 1EKQA 1JBWA 3H49A 3H74A 5BYFA 1BX4A
chains in the Genus database with same CATH topology
3KTNA 3QA2A 4DC3A 1RK2A 3NL5A 4E8ZA 4YL5A 3RQ5A 4EBUA 1V19A 5EY7A 3B1OA 3BF5A 3JULA 3MBHA 5TRWA 4KBEA 1GQTA 4XCKA 2F7KA 3EWMA 3NC9A 3LJSA 2HW1A 5F11A 3DZVA 1RFVA 1TD2A 3N1CA 4O1GA 4LBGA 4C5KA 3HJ6A 1V1AA 4B8SA 4E84A 1RFTA 4S1HA 3UBOA 3RQQA 2AB8A 1TZ3A 2NWHA 2I6BA 2YXTA 2HQQA 3HPDA 1LHPA 2RBCA 4X8FA 2C4EA 3RREA 3KEUA 3IBQA 3QAIA 1ESJA 1GC5A 2I5BA 4JJPA 2DDOA 3PZSA 5BYEA 2AX3A 3IQ0A 3GO7A 3W4SA 2AFBA 4JKSA 2A9YA 3RQ8A 4O1LA 3UMPA 2QCVA 3RT7A 4PVVA 3I3YA 1UA4A 1L2LA 1WYEA 3UQ6A 4S1IA 2PKNA 2V78A 5CM5A 3RTAA 1EKKA 3FHYA 5CGEA 3RSSA 5C40A 4LBXA 4N08A 4K9IA 3RS9A 2AJRA 3B1RA 2ABQA 4LCAA 3RY7A 3HYOA 3NBWA 4S1MA 3CQDA 5C41A 4C5LA 3RSQA 1JXIA 4XDAA 4C5NA 3GBUA 3RPHA 4C5MA 3RQ6A 3RQXA 4XF7A 1YGJA 2Q5RA 1YGKA 3VASA 3NM3A 4EUMA 4LC4A 3RRFA 2AWDA 5BYDA 3RU3A 1LIIA 1C3QA 2VARA 3IE7A 4K93A 1VK4A 2C49A 4B8RA 1VI9A 2R3BA 2AA0A 3IN1A 4K8CA 4E69A 3RT9A 4K8KA 3RRJA 2F02A 2JG1A 3LOOA 1RKSA 4EN4A 1V1BA 3UMOA 1KYHA 3RTBA 3RQ2A 1LIOA 3K9EA 3VAQA 2DDWA 2PKMA 3BGKA 2FV7A 3NM1A 4UBEA 4E8WA 1LIKA 3RQHA 5B6AA 4JKUA 5C3YA 5COJA 3UQEA 1TYYA 2DCNA 2JG5A 3LHXA 2PKKA 3HICA 3B1PA 2PKFA 1DGMA 2XTBA 3KD6A 4C5JA 4KANA 1UB0A 3IKHA 3NC2A 3UQ9A 4GM6A 1RFUA 5TQIA 5BYCA 1RKDA 3MBJA 2HLZA 3Q92A 3RU2A 3KZHA 3NL2A 2AJPA 3B1NA 2R3EA 5EYNA 1LHRA 2QHPA 3NBVA 4N09A 3NCAA 3PL2A 1VM7A 3RTCA 5C3ZA 1JXHA 3RM5A 2ABSA 3IH0A 3LKIA 2YXUA 3RRBA 4E3AA 3RTDA 5CGAA 5F0ZA 4YWRA 3K5WA 3NL6A 4WJMA 2DDMA 3RTGA 1ESQA 4KADA 3RSGA 4DU5A 1V1SA 2A9ZA 3GO6A 3NL3A 1LIJA 4U7XA 4K9CA 3Q1YA 1U2XA 4E8YA 3B1QA 4S1IB 2I6AA 4XF6A 1TZ6A 3OTXA 2JGVA 1YHJA 3RO4A 3RPZA 4KAHA 1RKAA 3FHXA 4KALA 3DRWA 3RTEA 3RS8A 3ZS7A 3B3LA 3UQDA 4K8PA 4K8TA 3RSFA 4EOHA 1EKQA 3H49A 3H74A 5BYFA 1BX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTN A;  3QA2 A;  4DC3 A;  1RK2 A;  3NL5 A;  4E8Z A;  4YL5 A;  3RQ5 A;  4EBU A;  1V19 A;  5EY7 A;  3B1O A;  3BF5 A;  3JUL A;  3MBH A;  5TRW A;  4KBE A;  1GQT A;  4XCK A;  2F7K A;  3EWM A;  3NC9 A;  3LJS A;  2HW1 A;  5F11 A;  3DZV A;  1RFV A;  1TD2 A;  3N1C A;  4O1G A;  4LBG A;  4C5K A;  1V1A A;  4B8S A;  4E84 A;  1RFT A;  4S1H A;  3UBO A;  3RQQ A;  2AB8 A;  1TZ3 A;  2NWH A;  2I6B A;  2YXT A;  2HQQ A;  3HPD A;  1LHP A;  2RBC A;  4X8F A;  2C4E A;  3RRE A;  3KEU A;  3IBQ A;  3QAI A;  1ESJ A;  1GC5 A;  2I5B A;  4JJP A;  2DDO A;  3PZS A;  5BYE A;  2AX3 A;  3IQ0 A;  3GO7 A;  3W4S A;  2AFB A;  4JKS A;  2A9Y A;  3RQ8 A;  4O1L A;  3UMP A;  2QCV A;  3RT7 A;  4PVV A;  3I3Y A;  1UA4 A;  1L2L A;  1WYE A;  3UQ6 A;  4S1I A;  2PKN A;  2V78 A;  5CM5 A;  3RTA A;  1EKK A;  3FHY A;  5CGE A;  3RSS A;  5C40 A;  4LBX A;  4N08 A;  4K9I A;  3RS9 A;  2AJR A;  3B1R A;  2ABQ A;  4LCA A;  3RY7 A;  3HYO A;  3NBW A;  4S1M A;  3CQD A;  5C41 A;  4C5L A;  3RSQ A;  1JXI A;  4XDA A;  4C5N A;  3GBU A;  3RPH A;  4C5M A;  3RQ6 A;  3RQX A;  4XF7 A;  1YGJ A;  2Q5R A;  1YGK A;  3VAS A;  3NM3 A;  4EUM A;  4LC4 A;  3RRF A;  2AWD A;  5BYD A;  3RU3 A;  1LII A;  1C3Q A;  2VAR A;  3IE7 A;  4K93 A;  1VK4 A;  2C49 A;  1VI9 A;  2R3B A;  4K8C A;  2AA0 A;  3IN1 A;  3RM5 A;  4B8R A;  4E69 A;  3RT9 A;  4K8K A;  3RRJ A;  2F02 A;  2JG1 A;  3LOO A;  1RKS A;  4EN4 A;  1V1B A;  3UMO A;  1KYH A;  3RTB A;  3RQ2 A;  1LIO A;  3K9E A;  3VAQ A;  2DDW A;  2PKM A;  3BGK A;  2FV7 A;  3NM1 A;  4UBE A;  4E8W A;  1LIK A;  3RQH A;  5B6A A;  4JKU A;  5C3Y A;  5COJ A;  3UQE A;  1TYY A;  2DCN A;  2JG5 A;  3LHX A;  2PKK A;  3HIC A;  3B1P A;  2PKF A;  1DGM A;  2XTB A;  3KD6 A;  4C5J A;  4KAN A;  1UB0 A;  3IKH A;  3NC2 A;  3UQ9 A;  4GM6 A;  1RFU A;  5TQI A;  5BYC A;  1RKD A;  3MBJ A;  2HLZ A;  3Q92 A;  3RU2 A;  3KZH A;  3NL2 A;  2AJP A;  3B1N A;  2R3E A;  5EYN A;  1LHR A;  2QHP A;  3NBV A;  4N09 A;  3NCA A;  3PL2 A;  1VM7 A;  3RTC A;  5C3Z A;  1JXH A;  2ABS A;  3IH0 A;  3LKI A;  2YXU A;  3RRB A;  4E3A A;  3RTD A;  5CGA A;  5F0Z A;  4YWR A;  3K5W A;  3NL6 A;  4WJM A;  2DDM A;  3RTG A;  1ESQ A;  4KAD A;  3RSG A;  4DU5 A;  1V1S A;  2A9Z A;  3GO6 A;  3NL3 A;  1LIJ A;  4U7X A;  4K9C A;  3Q1Y A;  1U2X A;  4E8Y A;  3B1Q A;  4S1I B;  2I6A A;  4XF6 A;  1TZ6 A;  3OTX A;  2JGV A;  1YHJ A;  3RO4 A;  3RPZ A;  4KAH A;  1RKA A;  3FHX A;  4KAL A;  3DRW A;  3RTE A;  3RS8 A;  3ZS7 A;  3B3L A;  3UQD A;  4K8P A;  4K8T A;  3RSF A;  4EOH A;  1EKQ A;  3H49 A;  3H74 A;  5BYF A;  1BX4 A; 
#chains in the Genus database with same CATH topology
 3KTN A;  3QA2 A;  4DC3 A;  1RK2 A;  3NL5 A;  4E8Z A;  4YL5 A;  3RQ5 A;  4C13 A;  4EBU A;  1V19 A;  5EY7 A;  1P31 A;  3B1O A;  1FGS A;  3BF5 A;  3JUL A;  3MBH A;  4KBE A;  1GQT A;  4XCK A;  2F7K A;  3EWM A;  3NC9 A;  3ZS7 A;  3LJS A;  2HW1 A;  5F11 A;  2WJP A;  3DZV A;  1RFV A;  3EAG A;  1TD2 A;  3N1C A;  4O1G A;  4LBG A;  4C5K A;  3HJ6 A;  3QCZ A;  4CVK A;  1V1A A;  4B8S A;  4E84 A;  1RFT A;  4S1H A;  3UBO A;  3RQQ A;  2AB8 A;  1TZ3 A;  4ZIY A;  3ZL8 A;  1EEH A;  2I6B A;  2NWH A;  2YXT A;  2HQQ A;  3HPD A;  1LHP A;  2RBC A;  4X8F A;  2C4E A;  3RRE A;  3KEU A;  3IBQ A;  3QAI A;  1ESJ A;  1GC5 A;  2I5B A;  1O5Z A;  2DDO A;  3PZS A;  4JJP A;  5BYE A;  2AX3 A;  3IQ0 A;  3GO7 A;  3W4S A;  2AFB A;  4JKS A;  2Y66 A;  2A9Y A;  3RQ8 A;  4O1L A;  3UMP A;  2QCV A;  3RT7 A;  1JBV A;  4PVV A;  4BUC A;  3I3Y A;  1UA4 A;  1L2L A;  1WYE A;  3UQ6 A;  4S1I A;  2PKN A;  2V78 A;  3UAG A;  2VTD A;  5CM5 A;  3RTA A;  1EKK A;  3FHY A;  5CGE A;  2XJA A;  4CVL A;  4QF5 A;  3RSS A;  5C40 A;  4LBX A;  1E8C A;  2VOR A;  4N08 A;  4K9I A;  3RS9 A;  2AJR A;  3B1R A;  2ABQ A;  4LCA A;  3RY7 A;  4HV4 A;  3HYO A;  3NBW A;  4S1M A;  3CQD A;  1W7K A;  4BUB A;  4C5L A;  3RSQ A;  1JXI A;  4XDA A;  4C5N A;  3GBU A;  3RPH A;  4C5M A;  3RQ6 A;  3RQX A;  4XF7 A;  1YGJ A;  2Q5R A;  1YGK A;  3VAS A;  3NM3 A;  4EUM A;  1GG4 A;  4LC4 A;  2AWD A;  3RRF A;  5BYD A;  3RU3 A;  1LII A;  1GQQ A;  1C3Q A;  2UAG A;  2VAR A;  3IE7 A;  4K93 A;  1VK4 A;  2C49 A;  4B8R A;  1VI9 A;  2R3B A;  2AA0 A;  3IN1 A;  3N2A A;  4K8C A;  4E69 A;  3RT9 A;  4K8K A;  3RRJ A;  2F02 A;  2JG1 A;  3LOO A;  1RKS A;  4EN4 A;  3UQD A;  1V1B A;  1GQY A;  3UMO A;  1KYH A;  3RTB A;  3RQ2 A;  1LIO A;  3ZM6 A;  3K9E A;  3VAQ A;  2DDW A;  2PKM A;  3BGK A;  2FV7 A;  3NM1 A;  4UBE A;  4E8W A;  1LIK A;  3RQH A;  5B6A A;  2UUO A;  3HN7 A;  4JKU A;  5C3Y A;  5COJ A;  2X5O A;  1TYY A;  2DCN A;  3UQE A;  2JG5 A;  2JFF A;  3LHX A;  2PKK A;  2GCB A;  3HIC A;  2XPC A;  2GC6 A;  2PKF A;  3B1P A;  1DGM A;  2XTB A;  3KD6 A;  2Y67 A;  4KAN A;  1UB0 A;  3IKH A;  3NC2 A;  3UQ9 A;  3NRS A;  1RFU A;  4GM6 A;  5TQI A;  4C12 A;  5TRW A;  5A5E A;  1RKD A;  5BYC A;  3MBJ A;  2HLZ A;  3Q92 A;  3RU2 A;  1UAG A;  3KZH A;  3NL2 A;  2AJP A;  1E0D A;  2VOS A;  2R3E A;  3B1N A;  5EYN A;  1LHR A;  2QHP A;  5A5F A;  3NBV A;  4N09 A;  1W78 A;  3NCA A;  3PL2 A;  1VM7 A;  3RTC A;  5C3Z A;  1JXH A;  3RM5 A;  4UAG A;  2ABS A;  3IH0 A;  3LKI A;  2YXU A;  3RRB A;  4E3A A;  2AM1 A;  3RTD A;  3LK7 A;  5CGA A;  4C5J A;  5F0Z A;  2AM2 A;  4YWR A;  3K5W A;  3NL6 A;  4WJM A;  2DDM A;  3RTG A;  2UUP A;  1ESQ A;  2F00 A;  2GC5 A;  4KAD A;  3RSG A;  4DU5 A;  1V1S A;  5C41 A;  2A9Z A;  3GO6 A;  3NL3 A;  1LIJ A;  2VTE A;  4K9C A;  4U7X A;  3Q1Y A;  1U2X A;  4E8Y A;  3B1Q A;  4CVM A;  4S1I B;  1J6U A;  2I6A A;  2JFH A;  2GCA A;  4XF6 A;  1TZ6 A;  3OTX A;  2JGV A;  1YHJ A;  2WTZ A;  3RO4 A;  3RPZ A;  3ZM5 A;  4KAH A;  1RKA A;  3FHX A;  4KAL A;  3DRW A;  2JFG A;  3RS8 A;  2Y1O A;  3B3L A;  3RTE A;  4K8P A;  3PYZ A;  4K8T A;  3RSF A;  1P3D A;  4EOH A;  2Y68 A;  4QDI A;  1EKQ A;  1JBW A;  3H49 A;  3H74 A;  5BYF A;  1BX4 A; 
#chains in the Genus database with same CATH homology
 3KTN A;  3QA2 A;  4DC3 A;  1RK2 A;  3NL5 A;  4E8Z A;  4YL5 A;  3RQ5 A;  4EBU A;  1V19 A;  5EY7 A;  3B1O A;  3BF5 A;  3JUL A;  3MBH A;  5TRW A;  4KBE A;  1GQT A;  4XCK A;  2F7K A;  3EWM A;  3NC9 A;  3LJS A;  2HW1 A;  5F11 A;  3DZV A;  1RFV A;  1TD2 A;  3N1C A;  4O1G A;  4LBG A;  4C5K A;  3HJ6 A;  1V1A A;  4B8S A;  4E84 A;  1RFT A;  4S1H A;  3UBO A;  3RQQ A;  2AB8 A;  1TZ3 A;  2NWH A;  2I6B A;  2YXT A;  2HQQ A;  3HPD A;  1LHP A;  2RBC A;  4X8F A;  2C4E A;  3RRE A;  3KEU A;  3IBQ A;  3QAI A;  1ESJ A;  1GC5 A;  2I5B A;  4JJP A;  2DDO A;  3PZS A;  5BYE A;  2AX3 A;  3IQ0 A;  3GO7 A;  3W4S A;  2AFB A;  4JKS A;  2A9Y A;  3RQ8 A;  4O1L A;  3UMP A;  2QCV A;  3RT7 A;  4PVV A;  3I3Y A;  1UA4 A;  1L2L A;  1WYE A;  3UQ6 A;  4S1I A;  2PKN A;  2V78 A;  5CM5 A;  3RTA A;  1EKK A;  3FHY A;  5CGE A;  3RSS A;  5C40 A;  4LBX A;  4N08 A;  4K9I A;  3RS9 A;  2AJR A;  3B1R A;  2ABQ A;  4LCA A;  3RY7 A;  3HYO A;  3NBW A;  4S1M A;  3CQD A;  5C41 A;  4C5L A;  3RSQ A;  1JXI A;  4XDA A;  4C5N A;  3GBU A;  3RPH A;  4C5M A;  3RQ6 A;  3RQX A;  4XF7 A;  1YGJ A;  2Q5R A;  1YGK A;  3VAS A;  3NM3 A;  4EUM A;  4LC4 A;  3RRF A;  2AWD A;  5BYD A;  3RU3 A;  1LII A;  1C3Q A;  2VAR A;  3IE7 A;  4K93 A;  1VK4 A;  2C49 A;  4B8R A;  1VI9 A;  2R3B A;  2AA0 A;  3IN1 A;  4K8C A;  4E69 A;  3RT9 A;  4K8K A;  3RRJ A;  2F02 A;  2JG1 A;  3LOO A;  1RKS A;  4EN4 A;  1V1B A;  3UMO A;  1KYH A;  3RTB A;  3RQ2 A;  1LIO A;  3K9E A;  3VAQ A;  2DDW A;  2PKM A;  3BGK A;  2FV7 A;  3NM1 A;  4UBE A;  4E8W A;  1LIK A;  3RQH A;  5B6A A;  4JKU A;  5C3Y A;  5COJ A;  3UQE A;  1TYY A;  2DCN A;  2JG5 A;  3LHX A;  2PKK A;  3HIC A;  3B1P A;  2PKF A;  1DGM A;  2XTB A;  3KD6 A;  4C5J A;  4KAN A;  1UB0 A;  3IKH A;  3NC2 A;  3UQ9 A;  4GM6 A;  1RFU A;  5TQI A;  5BYC A;  1RKD A;  3MBJ A;  2HLZ A;  3Q92 A;  3RU2 A;  3KZH A;  3NL2 A;  2AJP A;  3B1N A;  2R3E A;  5EYN A;  1LHR A;  2QHP A;  3NBV A;  4N09 A;  3NCA A;  3PL2 A;  1VM7 A;  3RTC A;  5C3Z A;  1JXH A;  3RM5 A;  2ABS A;  3IH0 A;  3LKI A;  2YXU A;  3RRB A;  4E3A A;  3RTD A;  5CGA A;  5F0Z A;  4YWR A;  3K5W A;  3NL6 A;  4WJM A;  2DDM A;  3RTG A;  1ESQ A;  4KAD A;  3RSG A;  4DU5 A;  1V1S A;  2A9Z A;  3GO6 A;  3NL3 A;  1LIJ A;  4U7X A;  4K9C A;  3Q1Y A;  1U2X A;  4E8Y A;  3B1Q A;  4S1I B;  2I6A A;  4XF6 A;  1TZ6 A;  3OTX A;  2JGV A;  1YHJ A;  3RO4 A;  3RPZ A;  4KAH A;  1RKA A;  3FHX A;  4KAL A;  3DRW A;  3RTE A;  3RS8 A;  3ZS7 A;  3B3L A;  3UQD A;  4K8P A;  4K8T A;  3RSF A;  4EOH A;  1EKQ A;  3H49 A;  3H74 A;  5BYF A;  1BX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...