2A9YA

Crystal structure of t. gondii adenosine kinase complexed with n6-dimethyladenosine
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
351
structure length
351
Chain Sequence
TGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAEKTALSTANKEHAVEVCTGALRLLTAGQNTSATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Substrate analogs induce an intermediate conformational change in Toxoplasma gondii adenosine kinase
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Signaling protein,transferase
molecule keywords adenosine kinase
total genus 123
structure length 351
sequence length 351
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 2a9yA02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2a9yA01
5TQIA 1L2LA 4XF7A 3GO6A 3N1CA 2YXUA 3CQDA 4K93A 3I3YA 4K8CA 4S1IB 4XDAA 3RQHA 4XF6A 4JKUA 4N09A 1LIKA 3RU3A 3KTNA 3NBWA 1RK2A 2I5BA 3VASA 3NCAA 2XTBA 3EWMA 4EBUA 1BX4A 1RFUA 2DDWA 3RTAA 2HQQA 1WYEA 5CM5A 3W4SA 1LIOA 3PL2A 4EOHA 4K8TA 2I6AA 2JG5A 2QCVA 3BGKA 3GO7A 3RQ6A 2C4EA 2I6BA 3IQ0A 1RKAA 1GC5A 5C3YA 1YGJA 4E84A 2A9ZA 1VI9A 3MBJA 4KADA 3RQ8A 1EKKA 3RPHA 4XCKA 3RM5A 5BYFA 3H74A 3RTCA 4LC4A 3Q92A 3UMPA 3VAQA 5BYDA 2C49A 3B1OA 3RQ5A 4N08A 1LHRA 1V1BA 1TZ6A 3IH0A 2PKKA 3IN1A 3UBOA 3UQ6A 3RREA 3NC9A 3UMOA 1TZ3A 5EYNA 3B1QA 2HLZA 3HYOA 3PZSA 3K9EA 3RY7A 3IBQA 3IKHA 4O1GA 1YGKA 4B8RA 5BYEA 3NL3A 3LJSA 2PKMA 1KYHA 4K8KA 1LIJA 2PKNA 2AX3A 3KZHA 3RS9A 1EKQA 1ESQA 1RFTA 4JKSA 4E69A 1GQTA 5C3ZA 2AJRA 4KBEA 2DDMA 4S1HA 1JXHA 2VARA 3FHXA 3UQDA 2FV7A 2JGVA 4S1IA 1UB0A 2RBCA 3RQXA 3KEUA 3GBUA 3RT9A 1V1AA 2R3BA 2YXTA 3NM1A 4LBXA 4LBGA 5TRWA 3RPZA 3RSSA 4C5MA 4C5JA 2ABSA 4DU5A 3RSGA 5B6AA 2A9YA 1U2XA 3RRBA 5EY7A 2F7KA 2QHPA 4EUMA 1V1SA 1JXIA 2DDOA 4K9CA 3OTXA 1LIIA 1C3QA 3KD6A 4O1LA 3B3LA 3NM3A 2NWHA 3NL5A 3QA2A 5BYCA 5C40A 4KALA 4K9IA 3RQ2A 3B1RA 3RSQA 4WJMA 2AA0A 3RTEA 3UQ9A 4E8YA 5F0ZA 4U7XA 3HPDA 3DZVA 3H49A 3RTBA 1VM7A 4S1MA 3RQQA 1VK4A 5CGAA 3RO4A 1RKDA 3HICA 3RT7A 4B8SA 3RU2A 3MBHA 2AWDA 2AB8A 4DC3A 1V19A 3B1NA 3IE7A 4C5NA 3B1PA 4X8FA 2V78A 1LHPA 4GM6A 1RFVA 2ABQA 3FHYA 1TYYA 2PKFA 2JG1A 4K8PA 4YL5A 3RSFA 4EN4A 5CGEA 2DCNA 3UQEA 4YWRA 2AFBA 5COJA 3RRJA 3LKIA 3K5WA 3LHXA 3ZS7A 2F02A 3RTDA 2HW1A 3JULA 3QAIA 4JJPA 4C5LA 3DRWA 1DGMA 3Q1YA 3NBVA 3NC2A 3RTGA 4LCAA 3BF5A 1TD2A 4C5KA 2R3EA 5F11A 4UBEA 4PVVA 4KANA 4KAHA 1YHJA 2Q5RA 3NL2A 1UA4A 3RS8A 3LOOA 2AJPA 1RKSA 4E3AA 4E8ZA 4E8WA 5C41A 3NL6A 1ESJA 3RRFA
chains in the Genus database with same CATH superfamily
5TQIA 1L2LA 4XF7A 3GO6A 3N1CA 2YXUA 3CQDA 3QCZA 3I3YA 4K93A 4K8CA 2GC5A 3N2AA 4S1IB 4XDAA 2WJPA 4JKUA 4N09A 1LIKA 4XF6A 3RU3A 3KTNA 3NBWA 1RK2A 4C12A 2I5BA 3VASA 3NCAA 2XTBA 3EWMA 4ZIYA 3NRSA 1BX4A 1RFUA 2DDWA 3RTAA 4EBUA 2HQQA 1WYEA 1P31A 5CM5A 1LIOA 3PL2A 3W4SA 4K8TA 2I6AA 2JG5A 1JBVA 2AM1A 2QCVA 3BGKA 3GO7A 1FGSA 2C4EA 2I6BA 2X5OA 4HV4A 3IQ0A 1RKAA 1GC5A 2WTZA 5C3YA 1YGJA 3EAGA 4E84A 2A9ZA 1JBWA 1VI9A 2UUOA 3MBJA 4KADA 3RQ8A 3RQHA 4QDIA 2JFHA 1EKKA 3RPHA 4XCKA 1P3DA 3RM5A 1GG4A 5A5EA 3H74A 5BYFA 5CGEA 3RTCA 4LC4A 2Y68A 2XJAA 3VAQA 3Q92A 2C49A 3UMPA 3B1OA 3RQ5A 1E0DA 4N08A 1LHRA 2VOSA 1V1BA 1TZ6A 3IH0A 2PKKA 3IN1A 3UBOA 3UQ6A 3RREA 3NC9A 3UMOA 1TZ3A 5EYNA 3B1QA 2HLZA 1J6UA 3HYOA 3PZSA 4BUCA 3K9EA 3LK7A 3RY7A 3IBQA 3IKHA 4O1GA 1YGKA 4B8RA 5BYEA 3NL3A 3LJSA 1UAGA 2PKMA 5C40A 1KYHA 4K8KA 1LIJA 2PKNA 2AX3A 3KZHA 3PYZA 1EKQA 1ESQA 1RFTA 4JKSA 3RS9A 1GQTA 4E69A 2AJRA 4KBEA 5C3ZA 3ZL8A 2DDMA 4S1HA 1JXHA 2VARA 2Y1OA 4CVKA 3FHXA 4BUBA 3UQDA 2FV7A 2JGVA 4S1IA 1UB0A 2RBCA 3RQXA 3KEUA 3GBUA 3RT9A 1V1AA 2R3BA 2YXTA 3NM1A 4LBXA 4LBGA 5TRWA 3RPZA 3RSSA 4C5MA 4C5JA 2ABSA 1EEHA 4DU5A 3RSGA 5B6AA 1U2XA 2A9YA 3RRBA 5EY7A 2F7KA 2QHPA 4EUMA 1V1SA 1JXIA 2DDOA 4K9CA 3OTXA 1LIIA 1C3QA 3KD6A 4O1LA 3B3LA 3NM3A 2NWHA 3NL5A 3QA2A 5BYDA 2Y67A 5BYCA 3RQ6A 2GCBA 4KALA 4K9IA 3RQ2A 3B1RA 3RSQA 4WJMA 2AA0A 3HN7A 3UQ9A 2JFGA 3RTEA 4E8YA 5F0ZA 1O5ZA 4U7XA 1GQYA 3HPDA 3DZVA 3H49A 3RTBA 1VM7A 4S1MA 3RQQA 1VK4A 5CGAA 3ZM6A 3RO4A 1RKDA 3HICA 3RT7A 4B8SA 3RU2A 3HJ6A 3MBHA 2AWDA 2AB8A 4DC3A 1V19A 3B1NA 3IE7A 2GC6A 4C5NA 4E8WA 3B1PA 4X8FA 2V78A 1LHPA 2VTDA 4GM6A 1RFVA 2ABQA 3FHYA 1TYYA 2PKFA 2JG1A 4K8PA 4YL5A 1GQQA 2Y66A 1W78A 3RSFA 4EN4A 2DCNA 3UQEA 4YWRA 2AFBA 4EOHA 5COJA 2UUPA 3RRJA 4CVLA 2JFFA 3LKIA 3K5WA 3LHXA 2XPCA 3ZS7A 2VORA 2F02A 3RTDA 2HW1A 3JULA 3QAIA 4JJPA 2VTEA 2AM2A 4QF5A 4C5LA 3DRWA 1DGMA 3Q1YA 3NBVA 3NC2A 3RTGA 3ZM5A 4LCAA 2UAGA 3BF5A 1TD2A 4C5KA 4UAGA 2R3EA 5F11A 4UBEA 1W7KA 1E8CA 2GCAA 4KANA 4PVVA 4KAHA 1YHJA 4CVMA 2Q5RA 5A5FA 3NL2A 1UA4A 3RS8A 3LOOA 2AJPA 1RKSA 3UAGA 2F00A 4C13A 4E3AA 4E8ZA 5C41A 3NL6A 1ESJA 3RRFA
chains in the Genus database with same CATH topology
5TQIA 1L2LA 4XF7A 3GO6A 3N1CA 2YXUA 3CQDA 4K93A 3I3YA 4K8CA 4S1IB 4XDAA 3RQHA 4XF6A 4JKUA 4N09A 1LIKA 3RU3A 3KTNA 3NBWA 1RK2A 2I5BA 3VASA 3NCAA 2XTBA 3EWMA 4EBUA 1BX4A 1RFUA 2DDWA 3RTAA 2HQQA 1WYEA 5CM5A 3W4SA 1LIOA 3PL2A 4EOHA 4K8TA 2I6AA 2JG5A 2QCVA 3BGKA 3GO7A 3RQ6A 2C4EA 2I6BA 3IQ0A 1RKAA 1GC5A 5C3YA 1YGJA 4E84A 2A9ZA 1VI9A 3MBJA 4KADA 3RQ8A 1EKKA 3RPHA 4XCKA 3RM5A 5BYFA 3H74A 3RTCA 4LC4A 3Q92A 3UMPA 3VAQA 5BYDA 2C49A 3B1OA 3RQ5A 4N08A 1LHRA 1V1BA 1TZ6A 3IH0A 2PKKA 3IN1A 3UBOA 3UQ6A 3RREA 3NC9A 3UMOA 1TZ3A 5EYNA 3B1QA 2HLZA 3HYOA 3PZSA 3K9EA 3RY7A 3IBQA 3IKHA 4O1GA 1YGKA 4B8RA 5BYEA 3NL3A 3LJSA 2PKMA 1KYHA 4K8KA 1LIJA 2PKNA 2AX3A 3KZHA 3RS9A 1EKQA 1ESQA 1RFTA 4JKSA 4E69A 1GQTA 5C3ZA 2AJRA 4KBEA 2DDMA 4S1HA 1JXHA 2VARA 3FHXA 3UQDA 2FV7A 2JGVA 4S1IA 1UB0A 2RBCA 3RQXA 3KEUA 3GBUA 3RT9A 1V1AA 2R3BA 2YXTA 3NM1A 4LBXA 4LBGA 5TRWA 3RPZA 3RSSA 4C5MA 4C5JA 2ABSA 4DU5A 3RSGA 5B6AA 1U2XA 2A9YA 3RRBA 5EY7A 2F7KA 2QHPA 4EUMA 1V1SA 1JXIA 2DDOA 4K9CA 3OTXA 1LIIA 1C3QA 3KD6A 4O1LA 3B3LA 3NM3A 2NWHA 3NL5A 3QA2A 5BYCA 5C40A 4KALA 4K9IA 3RQ2A 3B1RA 3RSQA 4WJMA 2AA0A 3RTEA 3UQ9A 4E8YA 5F0ZA 4U7XA 3HPDA 3DZVA 3H49A 3RTBA 1VM7A 4S1MA 3RQQA 1VK4A 5CGAA 3RO4A 1RKDA 3HICA 3RT7A 4B8SA 3RU2A 3HJ6A 3MBHA 2AWDA 2AB8A 4DC3A 1V19A 3B1NA 3IE7A 4C5NA 3B1PA 4X8FA 2V78A 1LHPA 4GM6A 1RFVA 2ABQA 3FHYA 1TYYA 2PKFA 2JG1A 4K8PA 4YL5A 3RSFA 4EN4A 5CGEA 2DCNA 3UQEA 4YWRA 2AFBA 5COJA 3RRJA 3LKIA 3K5WA 3LHXA 3ZS7A 2F02A 3RTDA 2HW1A 3JULA 3QAIA 4JJPA 4C5LA 3DRWA 1DGMA 3Q1YA 3NBVA 3NC2A 3RTGA 4LCAA 3BF5A 1TD2A 4C5KA 2R3EA 5F11A 4UBEA 4PVVA 4KANA 4KAHA 1YHJA 2Q5RA 3NL2A 1UA4A 3RS8A 3LOOA 2AJPA 1RKSA 4E3AA 4E8ZA 4E8WA 5C41A 3NL6A 1ESJA 3RRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TQI A;  1L2L A;  4XF7 A;  3GO6 A;  3N1C A;  2YXU A;  3CQD A;  4K93 A;  3I3Y A;  4K8C A;  4S1I B;  4XDA A;  3RQH A;  4XF6 A;  4JKU A;  4N09 A;  1LIK A;  3RU3 A;  3KTN A;  3NBW A;  1RK2 A;  2I5B A;  3VAS A;  3NCA A;  2XTB A;  3EWM A;  4EBU A;  1BX4 A;  1RFU A;  2DDW A;  3RTA A;  2HQQ A;  1WYE A;  5CM5 A;  3W4S A;  1LIO A;  3PL2 A;  4EOH A;  4K8T A;  2I6A A;  2JG5 A;  2QCV A;  3BGK A;  3GO7 A;  3RQ6 A;  2C4E A;  2I6B A;  3IQ0 A;  1RKA A;  1GC5 A;  5C3Y A;  1YGJ A;  4E84 A;  2A9Z A;  1VI9 A;  3MBJ A;  4KAD A;  3RQ8 A;  1EKK A;  3RPH A;  4XCK A;  3RM5 A;  5BYF A;  3H74 A;  3RTC A;  4LC4 A;  3Q92 A;  3UMP A;  3VAQ A;  5BYD A;  2C49 A;  3B1O A;  3RQ5 A;  4N08 A;  1LHR A;  1V1B A;  1TZ6 A;  3IH0 A;  2PKK A;  3IN1 A;  3UBO A;  3UQ6 A;  3RRE A;  3NC9 A;  3UMO A;  1TZ3 A;  5EYN A;  3B1Q A;  2HLZ A;  3HYO A;  3PZS A;  3K9E A;  3RY7 A;  3IBQ A;  3IKH A;  4O1G A;  1YGK A;  4B8R A;  5BYE A;  3NL3 A;  3LJS A;  2PKM A;  1KYH A;  4K8K A;  1LIJ A;  2PKN A;  2AX3 A;  3KZH A;  3RS9 A;  1EKQ A;  1ESQ A;  1RFT A;  4JKS A;  4E69 A;  1GQT A;  5C3Z A;  2AJR A;  4KBE A;  2DDM A;  4S1H A;  1JXH A;  2VAR A;  3FHX A;  3UQD A;  2FV7 A;  2JGV A;  4S1I A;  1UB0 A;  2RBC A;  3RQX A;  3KEU A;  3GBU A;  3RT9 A;  1V1A A;  2R3B A;  2YXT A;  3NM1 A;  4LBX A;  4LBG A;  5TRW A;  3RPZ A;  3RSS A;  4C5M A;  4C5J A;  2ABS A;  4DU5 A;  3RSG A;  5B6A A;  2A9Y A;  1U2X A;  3RRB A;  5EY7 A;  2F7K A;  2QHP A;  4EUM A;  1V1S A;  1JXI A;  2DDO A;  4K9C A;  3OTX A;  1LII A;  1C3Q A;  3KD6 A;  4O1L A;  3B3L A;  3NM3 A;  2NWH A;  3NL5 A;  3QA2 A;  5BYC A;  5C40 A;  4KAL A;  4K9I A;  3RQ2 A;  3B1R A;  3RSQ A;  4WJM A;  2AA0 A;  3RTE A;  3UQ9 A;  4E8Y A;  5F0Z A;  4U7X A;  3HPD A;  3DZV A;  3H49 A;  3RTB A;  1VM7 A;  4S1M A;  3RQQ A;  1VK4 A;  5CGA A;  3RO4 A;  1RKD A;  3HIC A;  3RT7 A;  4B8S A;  3RU2 A;  3MBH A;  2AWD A;  2AB8 A;  4DC3 A;  1V19 A;  3B1N A;  3IE7 A;  4C5N A;  3B1P A;  4X8F A;  2V78 A;  1LHP A;  4GM6 A;  1RFV A;  2ABQ A;  3FHY A;  1TYY A;  2PKF A;  2JG1 A;  4K8P A;  4YL5 A;  3RSF A;  4EN4 A;  5CGE A;  2DCN A;  3UQE A;  4YWR A;  2AFB A;  5COJ A;  3RRJ A;  3LKI A;  3K5W A;  3LHX A;  3ZS7 A;  2F02 A;  3RTD A;  2HW1 A;  3JUL A;  3QAI A;  4JJP A;  4C5L A;  3DRW A;  1DGM A;  3Q1Y A;  3NBV A;  3NC2 A;  3RTG A;  4LCA A;  3BF5 A;  1TD2 A;  4C5K A;  2R3E A;  5F11 A;  4UBE A;  4PVV A;  4KAN A;  4KAH A;  1YHJ A;  2Q5R A;  3NL2 A;  1UA4 A;  3RS8 A;  3LOO A;  2AJP A;  1RKS A;  4E3A A;  4E8Z A;  4E8W A;  5C41 A;  3NL6 A;  1ESJ A;  3RRF A; 
#chains in the Genus database with same CATH topology
 5TQI A;  1L2L A;  4XF7 A;  3GO6 A;  3N1C A;  2YXU A;  3CQD A;  3QCZ A;  3I3Y A;  4K93 A;  4K8C A;  2GC5 A;  3N2A A;  4S1I B;  4XDA A;  2WJP A;  4JKU A;  4N09 A;  1LIK A;  4XF6 A;  3RU3 A;  3KTN A;  3NBW A;  1RK2 A;  4C12 A;  2I5B A;  3VAS A;  3NCA A;  2XTB A;  3EWM A;  4ZIY A;  3NRS A;  1BX4 A;  1RFU A;  2DDW A;  3RTA A;  4EBU A;  2HQQ A;  1WYE A;  1P31 A;  5CM5 A;  1LIO A;  3PL2 A;  3W4S A;  4K8T A;  2I6A A;  2JG5 A;  1JBV A;  2AM1 A;  2QCV A;  3BGK A;  3GO7 A;  1FGS A;  2C4E A;  2I6B A;  2X5O A;  4HV4 A;  3IQ0 A;  1RKA A;  1GC5 A;  2WTZ A;  5C3Y A;  1YGJ A;  3EAG A;  4E84 A;  2A9Z A;  1JBW A;  1VI9 A;  2UUO A;  3MBJ A;  4KAD A;  3RQ8 A;  3RQH A;  4QDI A;  2JFH A;  1EKK A;  3RPH A;  4XCK A;  1P3D A;  3RM5 A;  1GG4 A;  5A5E A;  3H74 A;  5BYF A;  5CGE A;  3RTC A;  4LC4 A;  2Y68 A;  2XJA A;  3VAQ A;  3Q92 A;  2C49 A;  3UMP A;  3B1O A;  3RQ5 A;  1E0D A;  4N08 A;  1LHR A;  2VOS A;  1V1B A;  1TZ6 A;  3IH0 A;  2PKK A;  3IN1 A;  3UBO A;  3UQ6 A;  3RRE A;  3NC9 A;  3UMO A;  1TZ3 A;  5EYN A;  3B1Q A;  2HLZ A;  1J6U A;  3HYO A;  3PZS A;  4BUC A;  3K9E A;  3LK7 A;  3RY7 A;  3IBQ A;  3IKH A;  4O1G A;  1YGK A;  4B8R A;  5BYE A;  3NL3 A;  3LJS A;  1UAG A;  2PKM A;  5C40 A;  1KYH A;  4K8K A;  1LIJ A;  2PKN A;  2AX3 A;  3KZH A;  3PYZ A;  1EKQ A;  1ESQ A;  1RFT A;  4JKS A;  3RS9 A;  1GQT A;  4E69 A;  2AJR A;  4KBE A;  5C3Z A;  3ZL8 A;  2DDM A;  4S1H A;  1JXH A;  2VAR A;  2Y1O A;  4CVK A;  3FHX A;  4BUB A;  3UQD A;  2FV7 A;  2JGV A;  4S1I A;  1UB0 A;  2RBC A;  3RQX A;  3KEU A;  3GBU A;  3RT9 A;  1V1A A;  2R3B A;  2YXT A;  3NM1 A;  4LBX A;  4LBG A;  5TRW A;  3RPZ A;  3RSS A;  4C5M A;  4C5J A;  2ABS A;  1EEH A;  4DU5 A;  3RSG A;  5B6A A;  1U2X A;  2A9Y A;  3RRB A;  5EY7 A;  2F7K A;  2QHP A;  4EUM A;  1V1S A;  1JXI A;  2DDO A;  4K9C A;  3OTX A;  1LII A;  1C3Q A;  3KD6 A;  4O1L A;  3B3L A;  3NM3 A;  2NWH A;  3NL5 A;  3QA2 A;  5BYD A;  2Y67 A;  5BYC A;  3RQ6 A;  2GCB A;  4KAL A;  4K9I A;  3RQ2 A;  3B1R A;  3RSQ A;  4WJM A;  2AA0 A;  3HN7 A;  3UQ9 A;  2JFG A;  3RTE A;  4E8Y A;  5F0Z A;  1O5Z A;  4U7X A;  1GQY A;  3HPD A;  3DZV A;  3H49 A;  3RTB A;  1VM7 A;  4S1M A;  3RQQ A;  1VK4 A;  5CGA A;  3ZM6 A;  3RO4 A;  1RKD A;  3HIC A;  3RT7 A;  4B8S A;  3RU2 A;  3HJ6 A;  3MBH A;  2AWD A;  2AB8 A;  4DC3 A;  1V19 A;  3B1N A;  3IE7 A;  2GC6 A;  4C5N A;  4E8W A;  3B1P A;  4X8F A;  2V78 A;  1LHP A;  2VTD A;  4GM6 A;  1RFV A;  2ABQ A;  3FHY A;  1TYY A;  2PKF A;  2JG1 A;  4K8P A;  4YL5 A;  1GQQ A;  2Y66 A;  1W78 A;  3RSF A;  4EN4 A;  2DCN A;  3UQE A;  4YWR A;  2AFB A;  4EOH A;  5COJ A;  2UUP A;  3RRJ A;  4CVL A;  2JFF A;  3LKI A;  3K5W A;  3LHX A;  2XPC A;  3ZS7 A;  2VOR A;  2F02 A;  3RTD A;  2HW1 A;  3JUL A;  3QAI A;  4JJP A;  2VTE A;  2AM2 A;  4QF5 A;  4C5L A;  3DRW A;  1DGM A;  3Q1Y A;  3NBV A;  3NC2 A;  3RTG A;  3ZM5 A;  4LCA A;  2UAG A;  3BF5 A;  1TD2 A;  4C5K A;  4UAG A;  2R3E A;  5F11 A;  4UBE A;  1W7K A;  1E8C A;  2GCA A;  4KAN A;  4PVV A;  4KAH A;  1YHJ A;  4CVM A;  2Q5R A;  5A5F A;  3NL2 A;  1UA4 A;  3RS8 A;  3LOO A;  2AJP A;  1RKS A;  3UAG A;  2F00 A;  4C13 A;  4E3A A;  4E8Z A;  5C41 A;  3NL6 A;  1ESJ A;  3RRF A; 
#chains in the Genus database with same CATH homology
 5TQI A;  1L2L A;  4XF7 A;  3GO6 A;  3N1C A;  2YXU A;  3CQD A;  4K93 A;  3I3Y A;  4K8C A;  4S1I B;  4XDA A;  3RQH A;  4XF6 A;  4JKU A;  4N09 A;  1LIK A;  3RU3 A;  3KTN A;  3NBW A;  1RK2 A;  2I5B A;  3VAS A;  3NCA A;  2XTB A;  3EWM A;  4EBU A;  1BX4 A;  1RFU A;  2DDW A;  3RTA A;  2HQQ A;  1WYE A;  5CM5 A;  3W4S A;  1LIO A;  3PL2 A;  4EOH A;  4K8T A;  2I6A A;  2JG5 A;  2QCV A;  3BGK A;  3GO7 A;  3RQ6 A;  2C4E A;  2I6B A;  3IQ0 A;  1RKA A;  1GC5 A;  5C3Y A;  1YGJ A;  4E84 A;  2A9Z A;  1VI9 A;  3MBJ A;  4KAD A;  3RQ8 A;  1EKK A;  3RPH A;  4XCK A;  3RM5 A;  5BYF A;  3H74 A;  3RTC A;  4LC4 A;  3Q92 A;  3UMP A;  3VAQ A;  5BYD A;  2C49 A;  3B1O A;  3RQ5 A;  4N08 A;  1LHR A;  1V1B A;  1TZ6 A;  3IH0 A;  2PKK A;  3IN1 A;  3UBO A;  3UQ6 A;  3RRE A;  3NC9 A;  3UMO A;  1TZ3 A;  5EYN A;  3B1Q A;  2HLZ A;  3HYO A;  3PZS A;  3K9E A;  3RY7 A;  3IBQ A;  3IKH A;  4O1G A;  1YGK A;  4B8R A;  5BYE A;  3NL3 A;  3LJS A;  2PKM A;  1KYH A;  4K8K A;  1LIJ A;  2PKN A;  2AX3 A;  3KZH A;  3RS9 A;  1EKQ A;  1ESQ A;  1RFT A;  4JKS A;  4E69 A;  1GQT A;  5C3Z A;  2AJR A;  4KBE A;  2DDM A;  4S1H A;  1JXH A;  2VAR A;  3FHX A;  3UQD A;  2FV7 A;  2JGV A;  4S1I A;  1UB0 A;  2RBC A;  3RQX A;  3KEU A;  3GBU A;  3RT9 A;  1V1A A;  2R3B A;  2YXT A;  3NM1 A;  4LBX A;  4LBG A;  5TRW A;  3RPZ A;  3RSS A;  4C5M A;  4C5J A;  2ABS A;  4DU5 A;  3RSG A;  5B6A A;  1U2X A;  2A9Y A;  3RRB A;  5EY7 A;  2F7K A;  2QHP A;  4EUM A;  1V1S A;  1JXI A;  2DDO A;  4K9C A;  3OTX A;  1LII A;  1C3Q A;  3KD6 A;  4O1L A;  3B3L A;  3NM3 A;  2NWH A;  3NL5 A;  3QA2 A;  5BYC A;  5C40 A;  4KAL A;  4K9I A;  3RQ2 A;  3B1R A;  3RSQ A;  4WJM A;  2AA0 A;  3RTE A;  3UQ9 A;  4E8Y A;  5F0Z A;  4U7X A;  3HPD A;  3DZV A;  3H49 A;  3RTB A;  1VM7 A;  4S1M A;  3RQQ A;  1VK4 A;  5CGA A;  3RO4 A;  1RKD A;  3HIC A;  3RT7 A;  4B8S A;  3RU2 A;  3HJ6 A;  3MBH A;  2AWD A;  2AB8 A;  4DC3 A;  1V19 A;  3B1N A;  3IE7 A;  4C5N A;  3B1P A;  4X8F A;  2V78 A;  1LHP A;  4GM6 A;  1RFV A;  2ABQ A;  3FHY A;  1TYY A;  2PKF A;  2JG1 A;  4K8P A;  4YL5 A;  3RSF A;  4EN4 A;  5CGE A;  2DCN A;  3UQE A;  4YWR A;  2AFB A;  5COJ A;  3RRJ A;  3LKI A;  3K5W A;  3LHX A;  3ZS7 A;  2F02 A;  3RTD A;  2HW1 A;  3JUL A;  3QAI A;  4JJP A;  4C5L A;  3DRW A;  1DGM A;  3Q1Y A;  3NBV A;  3NC2 A;  3RTG A;  4LCA A;  3BF5 A;  1TD2 A;  4C5K A;  2R3E A;  5F11 A;  4UBE A;  4PVV A;  4KAN A;  4KAH A;  1YHJ A;  2Q5R A;  3NL2 A;  1UA4 A;  3RS8 A;  3LOO A;  2AJP A;  1RKS A;  4E3A A;  4E8Z A;  4E8W A;  5C41 A;  3NL6 A;  1ESJ A;  3RRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...