2AA0A

Crystal structure of t. gondii adenosine kinase complexed with 6-methylmercaptopurine riboside
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
351
structure length
351
Chain Sequence
TGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAEKTALSTANKEHAVEVCTGALRLLTAGQNTSATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate analogs induce an intermediate conformational change in Toxoplasma gondii adenosine kinase
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Signaling protein,transferase
molecule keywords adenosine kinase
total genus 119
structure length 351
sequence length 351
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 2aa0A02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2aa0A01
2JG1A 2PKMA 4O1GA 3KTNA 2DDWA 4LBXA 1RFVA 2R3BA 2AJPA 3RSSA 4K8CA 5C40A 3IN1A 4K9IA 1YHJA 3NC9A 2A9ZA 3LHXA 3RSGA 5C41A 3RO4A 1V19A 2AA0A 3IQ0A 1U2XA 3KZHA 3RPZA 1RFUA 4KALA 4DU5A 3LJSA 5BYCA 4C5JA 1JXIA 2AFBA 3RTGA 4E8YA 3RTDA 3RU3A 1V1BA 3IBQA 5F11A 3NL5A 2JG5A 3Q1YA 3Q92A 3RS9A 3BF5A 3H49A 2C4EA 1YGJA 4XF7A 3MBJA 3RREA 4YL5A 3B1OA 3B1PA 1TYYA 3PL2A 3RTAA 3I3YA 3RT7A 3RTCA 3IKHA 4KAHA 4EUMA 1UB0A 3NL2A 4C5NA 2VARA 4XF6A 4B8SA 4C5MA 4KBEA 1LIJA 3RQ2A 4KADA 1UA4A 3BGKA 1TD2A 4LC4A 4GM6A 4K8PA 1VM7A 3OTXA 4K8KA 1RKAA 3RSQA 3IE7A 1EKKA 4EN4A 2HLZA 3FHXA 3UBOA 2AB8A 4O1LA 3HPDA 4JKUA 3RPHA 3KD6A 2DDOA 3UMOA 5C3ZA 1LIIA 4K93A 5CGAA 4WJMA 4UBEA 3NM3A 3LOOA 3B3LA 4N08A 3RS8A 4E69A 1EKQA 1WYEA 5COJA 1ESQA 2YXUA 4PVVA 4S1IB 3NBWA 3QAIA 3JULA 1LHRA 4LBGA 2V78A 3VAQA 2QCVA 3RY7A 5BYDA 1JXHA 3GO7A 4KANA 4EBUA 3CQDA 2I5BA 1BX4A 5EYNA 4B8RA 3UQEA 1ESJA 2I6BA 3B1QA 4K8TA 4LCAA 3RQQA 3LKIA 1TZ3A 2AX3A 1VK4A 4K9CA 5BYEA 3GBUA 1RKSA 1LIKA 4DC3A 2F7KA 3RRBA 3K9EA 5TRWA 3RM5A 3KEUA 2XTBA 2JGVA 1DGMA 3PZSA 4C5KA 2ABQA 3DRWA 3RU2A 4U7XA 3B1RA 1LIOA 2QHPA 4XCKA 1V1AA 4EOHA 5B6AA 3NL6A 3UQ9A 3HICA 4XDAA 3RQXA 2AWDA 3NM1A 3RRJA 2AJRA 3B1NA 4S1IA 4E8ZA 4N09A 3MBHA 1RFTA 5F0ZA 3GO6A 2PKNA 4E8WA 4JKSA 5C3YA 2F02A 2PKFA 5TQIA 3W4SA 5EY7A 1RK2A 3H74A 2NWHA 3RTEA 2DDMA 1RKDA 2I6AA 1C3QA 3RQ5A 3RSFA 3IH0A 4E84A 3ZS7A 2PKKA 3HYOA 3UQ6A 3NBVA 3UQDA 4YWRA 3RT9A 4E3AA 5BYFA 1L2LA 2HQQA 3UMPA 1GQTA 1TZ6A 4C5LA 5CGEA 1GC5A 1LHPA 1KYHA 2ABSA 3VASA 3NL3A 2A9YA 2FV7A 3RTBA 3RQHA 3RRFA 1V1SA 2C49A 3FHYA 3RQ8A 5CM5A 2R3EA 3N1CA 3NCAA 3QA2A 3RQ6A 3NC2A 2Q5RA 3EWMA 1VI9A 4S1MA 4X8FA 3DZVA 1YGKA 3K5WA 4JJPA 2HW1A 2DCNA 2YXTA 2RBCA 4S1HA
chains in the Genus database with same CATH superfamily
2JG1A 2PKMA 4O1GA 3KTNA 2AM2A 2DDWA 3HN7A 1RFVA 2R3BA 2AJPA 4LBXA 1E0DA 4K8CA 3IN1A 4K9IA 3RSSA 4CVLA 1YHJA 3NC9A 2A9ZA 5C40A 3LHXA 3RSGA 5C41A 3RO4A 1V19A 2AA0A 1P31A 2UAGA 3IQ0A 1U2XA 3KZHA 3RPZA 1RFUA 1GQQA 3HJ6A 3LJSA 4KALA 4ZIYA 4DU5A 5A5FA 5BYCA 4C5JA 1JXIA 2AFBA 3RTGA 4E8YA 3RTDA 3RU3A 1V1BA 3IBQA 5F11A 3NL5A 2JG5A 3Q1YA 3Q92A 3N2AA 3RS9A 3LK7A 3BF5A 3H49A 2C4EA 2WJPA 1YGJA 4XF7A 3MBJA 2XPCA 3RREA 4YL5A 3B1OA 1JBWA 3B1PA 1TYYA 1EEHA 3PL2A 3RTAA 3I3YA 4UAGA 3RT7A 2Y1OA 2Y68A 2GC5A 3IKHA 3RTCA 4KAHA 4EUMA 1UB0A 3NL2A 4C5NA 2VARA 4XF6A 4B8SA 4C5MA 4KBEA 1LIJA 3RQ2A 4KADA 1UA4A 5BYDA 3BGKA 1TD2A 2GC6A 2VTDA 4LC4A 4GM6A 1E8CA 4K8PA 1VM7A 3UAGA 3OTXA 4K8KA 1RKAA 2X5OA 3IE7A 1EKKA 2VOSA 2HLZA 1GG4A 1O5ZA 3FHXA 3RSQA 2AB8A 3UBOA 4EN4A 4O1LA 4HV4A 3HPDA 4JKUA 3RPHA 1W7KA 2DDOA 3KD6A 3UMOA 1LIIA 1P3DA 2WTZA 4K93A 5C3ZA 5CGAA 4WJMA 4UBEA 4C12A 3NM3A 3LOOA 3B3LA 4N08A 2UUPA 3RS8A 4E69A 1EKQA 1WYEA 5COJA 1ESQA 1FGSA 2YXUA 4PVVA 4S1IB 3NBWA 3QAIA 4QDIA 1GQYA 1LHRA 3JULA 2V78A 3VAQA 4LBGA 2QCVA 3RY7A 3ZL8A 1JXHA 3GO7A 4KANA 4EBUA 3CQDA 2I5BA 1BX4A 2VTEA 5EYNA 4B8RA 3NRSA 3UQEA 1ESJA 2I6BA 3B1QA 4K8TA 4C13A 4LCAA 3RQQA 3LKIA 1TZ3A 2AX3A 1VK4A 4K9CA 5BYEA 2JFGA 3GBUA 1RKSA 1LIKA 4DC3A 2F7KA 3RRBA 3K9EA 5TRWA 3RM5A 3KEUA 1J6UA 2XTBA 2JGVA 1DGMA 2VORA 2AM1A 3PZSA 2ABQA 2XJAA 4C5KA 3DRWA 3RU2A 4U7XA 3B1RA 1LIOA 2QHPA 4XCKA 4CVKA 1V1AA 1W78A 4QF5A 3NL6A 3ZM5A 3UQ9A 3HICA 4XDAA 3RQXA 4EOHA 5B6AA 2AWDA 3NM1A 3RRJA 2AJRA 2JFFA 3B1NA 4S1IA 4E8ZA 4N09A 3MBHA 1RFTA 5F0ZA 3GO6A 2F00A 2PKNA 4E8WA 1UAGA 3QCZA 2F02A 2PKFA 4JKSA 5C3YA 5TQIA 2Y67A 3W4SA 5EY7A 1RK2A 3H74A 2NWHA 3RTEA 2DDMA 1RKDA 2I6AA 1C3QA 3RQ5A 5A5EA 2GCAA 3RSFA 3IH0A 4E84A 3ZS7A 2PKKA 3HYOA 3UQ6A 3NBVA 3UQDA 3PYZA 4YWRA 3RT9A 4E3AA 2GCBA 1L2LA 5BYFA 2HQQA 3UMPA 1GQTA 1TZ6A 3ZM6A 4C5LA 5CGEA 1GC5A 1LHPA 1KYHA 2ABSA 3VASA 3NL3A 2UUOA 2A9YA 2FV7A 3RTBA 3RQHA 3RRFA 1V1SA 2C49A 4BUCA 3FHYA 2Y66A 3EAGA 3RQ8A 5CM5A 2R3EA 3N1CA 3NCAA 3QA2A 3RQ6A 3NC2A 4BUBA 2Q5RA 3EWMA 1VI9A 4CVMA 4S1MA 1JBVA 2JFHA 3DZVA 4X8FA 1YGKA 3K5WA 4JJPA 2HW1A 2DCNA 2YXTA 2RBCA 4S1HA
chains in the Genus database with same CATH topology
2JG1A 2PKMA 4O1GA 3KTNA 2DDWA 4LBXA 1RFVA 2R3BA 2AJPA 3RSSA 4K8CA 5C40A 3IN1A 4K9IA 1YHJA 3NC9A 2A9ZA 3LHXA 3RSGA 5C41A 3RO4A 1V19A 2AA0A 3IQ0A 1U2XA 3KZHA 3RPZA 1RFUA 3HJ6A 4KALA 3LJSA 4DU5A 5BYCA 4C5JA 1JXIA 2AFBA 3RTGA 4E8YA 3RTDA 3RU3A 1V1BA 3IBQA 5F11A 3NL5A 2JG5A 3Q1YA 3Q92A 3RS9A 3BF5A 3H49A 2C4EA 1YGJA 4XF7A 3MBJA 3RREA 4YL5A 3B1OA 3B1PA 1TYYA 3PL2A 3RTAA 3I3YA 3RT7A 3RTCA 3IKHA 4KAHA 4EUMA 1UB0A 3NL2A 4C5NA 2VARA 4XF6A 4B8SA 4C5MA 4KBEA 1LIJA 3RQ2A 4KADA 1UA4A 3BGKA 1TD2A 4LC4A 4GM6A 4K8PA 1VM7A 3OTXA 4K8KA 1RKAA 3RSQA 3IE7A 1EKKA 4EN4A 2HLZA 3FHXA 3UBOA 2AB8A 4O1LA 3HPDA 4JKUA 3RPHA 3KD6A 2DDOA 3UMOA 5C3ZA 1LIIA 4K93A 5CGAA 4WJMA 4UBEA 3NM3A 3LOOA 3B3LA 4N08A 3RS8A 4E69A 1EKQA 1WYEA 5COJA 1ESQA 2YXUA 4PVVA 4S1IB 3NBWA 3QAIA 3JULA 1LHRA 4LBGA 2V78A 3VAQA 2QCVA 3RY7A 5BYDA 1JXHA 3GO7A 4KANA 4EBUA 3CQDA 2I5BA 1BX4A 5EYNA 4B8RA 3UQEA 1ESJA 2I6BA 3B1QA 4K8TA 4LCAA 3RQQA 3LKIA 1TZ3A 2AX3A 1VK4A 4K9CA 5BYEA 3GBUA 1RKSA 1LIKA 4DC3A 2F7KA 3RRBA 3K9EA 5TRWA 3RM5A 3KEUA 2XTBA 2JGVA 1DGMA 3PZSA 4C5KA 2ABQA 3DRWA 3RU2A 4U7XA 3B1RA 1LIOA 2QHPA 4XCKA 1V1AA 4EOHA 5B6AA 3NL6A 3UQ9A 3HICA 4XDAA 3RQXA 2AWDA 3NM1A 3RRJA 2AJRA 3B1NA 4S1IA 4E8ZA 4N09A 3MBHA 1RFTA 5F0ZA 3GO6A 2PKNA 4E8WA 4JKSA 5C3YA 2F02A 2PKFA 5TQIA 3W4SA 5EY7A 1RK2A 3H74A 2NWHA 3RTEA 2DDMA 1RKDA 2I6AA 1C3QA 3RQ5A 3RSFA 3IH0A 4E84A 3ZS7A 2PKKA 3HYOA 3UQ6A 3NBVA 3UQDA 4YWRA 3RT9A 4E3AA 5BYFA 1L2LA 2HQQA 3UMPA 1GQTA 1TZ6A 4C5LA 5CGEA 1GC5A 1LHPA 1KYHA 2ABSA 3VASA 3NL3A 2A9YA 2FV7A 3RTBA 3RQHA 3RRFA 1V1SA 2C49A 3FHYA 3RQ8A 5CM5A 2R3EA 3N1CA 3NCAA 3QA2A 3RQ6A 3NC2A 2Q5RA 3EWMA 1VI9A 4S1MA 4X8FA 3DZVA 1YGKA 3K5WA 4JJPA 2HW1A 2DCNA 2YXTA 2RBCA 4S1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JG1 A;  2PKM A;  4O1G A;  3KTN A;  2DDW A;  4LBX A;  1RFV A;  2R3B A;  2AJP A;  3RSS A;  4K8C A;  5C40 A;  3IN1 A;  4K9I A;  1YHJ A;  3NC9 A;  2A9Z A;  3LHX A;  3RSG A;  5C41 A;  3RO4 A;  1V19 A;  2AA0 A;  3IQ0 A;  1U2X A;  3KZH A;  3RPZ A;  1RFU A;  4KAL A;  4DU5 A;  3LJS A;  5BYC A;  4C5J A;  1JXI A;  2AFB A;  3RTG A;  4E8Y A;  3RTD A;  3RU3 A;  1V1B A;  3IBQ A;  5F11 A;  3NL5 A;  2JG5 A;  3Q1Y A;  3Q92 A;  3RS9 A;  3BF5 A;  3H49 A;  2C4E A;  1YGJ A;  4XF7 A;  3MBJ A;  3RRE A;  4YL5 A;  3B1O A;  3B1P A;  1TYY A;  3PL2 A;  3RTA A;  3I3Y A;  3RT7 A;  3RTC A;  3IKH A;  4KAH A;  4EUM A;  1UB0 A;  3NL2 A;  4C5N A;  2VAR A;  4XF6 A;  4B8S A;  4C5M A;  4KBE A;  1LIJ A;  3RQ2 A;  4KAD A;  1UA4 A;  3BGK A;  1TD2 A;  4LC4 A;  4GM6 A;  4K8P A;  1VM7 A;  3OTX A;  4K8K A;  1RKA A;  3RSQ A;  3IE7 A;  1EKK A;  4EN4 A;  2HLZ A;  3FHX A;  3UBO A;  2AB8 A;  4O1L A;  3HPD A;  4JKU A;  3RPH A;  3KD6 A;  2DDO A;  3UMO A;  5C3Z A;  1LII A;  4K93 A;  5CGA A;  4WJM A;  4UBE A;  3NM3 A;  3LOO A;  3B3L A;  4N08 A;  3RS8 A;  4E69 A;  1EKQ A;  1WYE A;  5COJ A;  1ESQ A;  2YXU A;  4PVV A;  4S1I B;  3NBW A;  3QAI A;  3JUL A;  1LHR A;  4LBG A;  2V78 A;  3VAQ A;  2QCV A;  3RY7 A;  5BYD A;  1JXH A;  3GO7 A;  4KAN A;  4EBU A;  3CQD A;  2I5B A;  1BX4 A;  5EYN A;  4B8R A;  3UQE A;  1ESJ A;  2I6B A;  3B1Q A;  4K8T A;  4LCA A;  3RQQ A;  3LKI A;  1TZ3 A;  2AX3 A;  1VK4 A;  4K9C A;  5BYE A;  3GBU A;  1RKS A;  1LIK A;  4DC3 A;  2F7K A;  3RRB A;  3K9E A;  5TRW A;  3RM5 A;  3KEU A;  2XTB A;  2JGV A;  1DGM A;  3PZS A;  4C5K A;  2ABQ A;  3DRW A;  3RU2 A;  4U7X A;  3B1R A;  1LIO A;  2QHP A;  4XCK A;  1V1A A;  4EOH A;  5B6A A;  3NL6 A;  3UQ9 A;  3HIC A;  4XDA A;  3RQX A;  2AWD A;  3NM1 A;  3RRJ A;  2AJR A;  3B1N A;  4S1I A;  4E8Z A;  4N09 A;  3MBH A;  1RFT A;  5F0Z A;  3GO6 A;  2PKN A;  4E8W A;  4JKS A;  5C3Y A;  2F02 A;  2PKF A;  5TQI A;  3W4S A;  5EY7 A;  1RK2 A;  3H74 A;  2NWH A;  3RTE A;  2DDM A;  1RKD A;  2I6A A;  1C3Q A;  3RQ5 A;  3RSF A;  3IH0 A;  4E84 A;  3ZS7 A;  2PKK A;  3HYO A;  3UQ6 A;  3NBV A;  3UQD A;  4YWR A;  3RT9 A;  4E3A A;  5BYF A;  1L2L A;  2HQQ A;  3UMP A;  1GQT A;  1TZ6 A;  4C5L A;  5CGE A;  1GC5 A;  1LHP A;  1KYH A;  2ABS A;  3VAS A;  3NL3 A;  2A9Y A;  2FV7 A;  3RTB A;  3RQH A;  3RRF A;  1V1S A;  2C49 A;  3FHY A;  3RQ8 A;  5CM5 A;  2R3E A;  3N1C A;  3NCA A;  3QA2 A;  3RQ6 A;  3NC2 A;  2Q5R A;  3EWM A;  1VI9 A;  4S1M A;  4X8F A;  3DZV A;  1YGK A;  3K5W A;  4JJP A;  2HW1 A;  2DCN A;  2YXT A;  2RBC A;  4S1H A; 
#chains in the Genus database with same CATH topology
 2JG1 A;  2PKM A;  4O1G A;  3KTN A;  2AM2 A;  2DDW A;  3HN7 A;  1RFV A;  2R3B A;  2AJP A;  4LBX A;  1E0D A;  4K8C A;  3IN1 A;  4K9I A;  3RSS A;  4CVL A;  1YHJ A;  3NC9 A;  2A9Z A;  5C40 A;  3LHX A;  3RSG A;  5C41 A;  3RO4 A;  1V19 A;  2AA0 A;  1P31 A;  2UAG A;  3IQ0 A;  1U2X A;  3KZH A;  3RPZ A;  1RFU A;  1GQQ A;  3HJ6 A;  3LJS A;  4KAL A;  4ZIY A;  4DU5 A;  5A5F A;  5BYC A;  4C5J A;  1JXI A;  2AFB A;  3RTG A;  4E8Y A;  3RTD A;  3RU3 A;  1V1B A;  3IBQ A;  5F11 A;  3NL5 A;  2JG5 A;  3Q1Y A;  3Q92 A;  3N2A A;  3RS9 A;  3LK7 A;  3BF5 A;  3H49 A;  2C4E A;  2WJP A;  1YGJ A;  4XF7 A;  3MBJ A;  2XPC A;  3RRE A;  4YL5 A;  3B1O A;  1JBW A;  3B1P A;  1TYY A;  1EEH A;  3PL2 A;  3RTA A;  3I3Y A;  4UAG A;  3RT7 A;  2Y1O A;  2Y68 A;  2GC5 A;  3IKH A;  3RTC A;  4KAH A;  4EUM A;  1UB0 A;  3NL2 A;  4C5N A;  2VAR A;  4XF6 A;  4B8S A;  4C5M A;  4KBE A;  1LIJ A;  3RQ2 A;  4KAD A;  1UA4 A;  5BYD A;  3BGK A;  1TD2 A;  2GC6 A;  2VTD A;  4LC4 A;  4GM6 A;  1E8C A;  4K8P A;  1VM7 A;  3UAG A;  3OTX A;  4K8K A;  1RKA A;  2X5O A;  3IE7 A;  1EKK A;  2VOS A;  2HLZ A;  1GG4 A;  1O5Z A;  3FHX A;  3RSQ A;  2AB8 A;  3UBO A;  4EN4 A;  4O1L A;  4HV4 A;  3HPD A;  4JKU A;  3RPH A;  1W7K A;  2DDO A;  3KD6 A;  3UMO A;  1LII A;  1P3D A;  2WTZ A;  4K93 A;  5C3Z A;  5CGA A;  4WJM A;  4UBE A;  4C12 A;  3NM3 A;  3LOO A;  3B3L A;  4N08 A;  2UUP A;  3RS8 A;  4E69 A;  1EKQ A;  1WYE A;  5COJ A;  1ESQ A;  1FGS A;  2YXU A;  4PVV A;  4S1I B;  3NBW A;  3QAI A;  4QDI A;  1GQY A;  1LHR A;  3JUL A;  2V78 A;  3VAQ A;  4LBG A;  2QCV A;  3RY7 A;  3ZL8 A;  1JXH A;  3GO7 A;  4KAN A;  4EBU A;  3CQD A;  2I5B A;  1BX4 A;  2VTE A;  5EYN A;  4B8R A;  3NRS A;  3UQE A;  1ESJ A;  2I6B A;  3B1Q A;  4K8T A;  4C13 A;  4LCA A;  3RQQ A;  3LKI A;  1TZ3 A;  2AX3 A;  1VK4 A;  4K9C A;  5BYE A;  2JFG A;  3GBU A;  1RKS A;  1LIK A;  4DC3 A;  2F7K A;  3RRB A;  3K9E A;  5TRW A;  3RM5 A;  3KEU A;  1J6U A;  2XTB A;  2JGV A;  1DGM A;  2VOR A;  2AM1 A;  3PZS A;  2ABQ A;  2XJA A;  4C5K A;  3DRW A;  3RU2 A;  4U7X A;  3B1R A;  1LIO A;  2QHP A;  4XCK A;  4CVK A;  1V1A A;  1W78 A;  4QF5 A;  3NL6 A;  3ZM5 A;  3UQ9 A;  3HIC A;  4XDA A;  3RQX A;  4EOH A;  5B6A A;  2AWD A;  3NM1 A;  3RRJ A;  2AJR A;  2JFF A;  3B1N A;  4S1I A;  4E8Z A;  4N09 A;  3MBH A;  1RFT A;  5F0Z A;  3GO6 A;  2F00 A;  2PKN A;  4E8W A;  1UAG A;  3QCZ A;  2F02 A;  2PKF A;  4JKS A;  5C3Y A;  5TQI A;  2Y67 A;  3W4S A;  5EY7 A;  1RK2 A;  3H74 A;  2NWH A;  3RTE A;  2DDM A;  1RKD A;  2I6A A;  1C3Q A;  3RQ5 A;  5A5E A;  2GCA A;  3RSF A;  3IH0 A;  4E84 A;  3ZS7 A;  2PKK A;  3HYO A;  3UQ6 A;  3NBV A;  3UQD A;  3PYZ A;  4YWR A;  3RT9 A;  4E3A A;  2GCB A;  1L2L A;  5BYF A;  2HQQ A;  3UMP A;  1GQT A;  1TZ6 A;  3ZM6 A;  4C5L A;  5CGE A;  1GC5 A;  1LHP A;  1KYH A;  2ABS A;  3VAS A;  3NL3 A;  2UUO A;  2A9Y A;  2FV7 A;  3RTB A;  3RQH A;  3RRF A;  1V1S A;  2C49 A;  4BUC A;  3FHY A;  2Y66 A;  3EAG A;  3RQ8 A;  5CM5 A;  2R3E A;  3N1C A;  3NCA A;  3QA2 A;  3RQ6 A;  3NC2 A;  4BUB A;  2Q5R A;  3EWM A;  1VI9 A;  4CVM A;  4S1M A;  1JBV A;  2JFH A;  3DZV A;  4X8F A;  1YGK A;  3K5W A;  4JJP A;  2HW1 A;  2DCN A;  2YXT A;  2RBC A;  4S1H A; 
#chains in the Genus database with same CATH homology
 2JG1 A;  2PKM A;  4O1G A;  3KTN A;  2DDW A;  4LBX A;  1RFV A;  2R3B A;  2AJP A;  3RSS A;  4K8C A;  5C40 A;  3IN1 A;  4K9I A;  1YHJ A;  3NC9 A;  2A9Z A;  3LHX A;  3RSG A;  5C41 A;  3RO4 A;  1V19 A;  2AA0 A;  3IQ0 A;  1U2X A;  3KZH A;  3RPZ A;  1RFU A;  3HJ6 A;  4KAL A;  3LJS A;  4DU5 A;  5BYC A;  4C5J A;  1JXI A;  2AFB A;  3RTG A;  4E8Y A;  3RTD A;  3RU3 A;  1V1B A;  3IBQ A;  5F11 A;  3NL5 A;  2JG5 A;  3Q1Y A;  3Q92 A;  3RS9 A;  3BF5 A;  3H49 A;  2C4E A;  1YGJ A;  4XF7 A;  3MBJ A;  3RRE A;  4YL5 A;  3B1O A;  3B1P A;  1TYY A;  3PL2 A;  3RTA A;  3I3Y A;  3RT7 A;  3RTC A;  3IKH A;  4KAH A;  4EUM A;  1UB0 A;  3NL2 A;  4C5N A;  2VAR A;  4XF6 A;  4B8S A;  4C5M A;  4KBE A;  1LIJ A;  3RQ2 A;  4KAD A;  1UA4 A;  3BGK A;  1TD2 A;  4LC4 A;  4GM6 A;  4K8P A;  1VM7 A;  3OTX A;  4K8K A;  1RKA A;  3RSQ A;  3IE7 A;  1EKK A;  4EN4 A;  2HLZ A;  3FHX A;  3UBO A;  2AB8 A;  4O1L A;  3HPD A;  4JKU A;  3RPH A;  3KD6 A;  2DDO A;  3UMO A;  5C3Z A;  1LII A;  4K93 A;  5CGA A;  4WJM A;  4UBE A;  3NM3 A;  3LOO A;  3B3L A;  4N08 A;  3RS8 A;  4E69 A;  1EKQ A;  1WYE A;  5COJ A;  1ESQ A;  2YXU A;  4PVV A;  4S1I B;  3NBW A;  3QAI A;  3JUL A;  1LHR A;  4LBG A;  2V78 A;  3VAQ A;  2QCV A;  3RY7 A;  5BYD A;  1JXH A;  3GO7 A;  4KAN A;  4EBU A;  3CQD A;  2I5B A;  1BX4 A;  5EYN A;  4B8R A;  3UQE A;  1ESJ A;  2I6B A;  3B1Q A;  4K8T A;  4LCA A;  3RQQ A;  3LKI A;  1TZ3 A;  2AX3 A;  1VK4 A;  4K9C A;  5BYE A;  3GBU A;  1RKS A;  1LIK A;  4DC3 A;  2F7K A;  3RRB A;  3K9E A;  5TRW A;  3RM5 A;  3KEU A;  2XTB A;  2JGV A;  1DGM A;  3PZS A;  4C5K A;  2ABQ A;  3DRW A;  3RU2 A;  4U7X A;  3B1R A;  1LIO A;  2QHP A;  4XCK A;  1V1A A;  4EOH A;  5B6A A;  3NL6 A;  3UQ9 A;  3HIC A;  4XDA A;  3RQX A;  2AWD A;  3NM1 A;  3RRJ A;  2AJR A;  3B1N A;  4S1I A;  4E8Z A;  4N09 A;  3MBH A;  1RFT A;  5F0Z A;  3GO6 A;  2PKN A;  4E8W A;  4JKS A;  5C3Y A;  2F02 A;  2PKF A;  5TQI A;  3W4S A;  5EY7 A;  1RK2 A;  3H74 A;  2NWH A;  3RTE A;  2DDM A;  1RKD A;  2I6A A;  1C3Q A;  3RQ5 A;  3RSF A;  3IH0 A;  4E84 A;  3ZS7 A;  2PKK A;  3HYO A;  3UQ6 A;  3NBV A;  3UQD A;  4YWR A;  3RT9 A;  4E3A A;  5BYF A;  1L2L A;  2HQQ A;  3UMP A;  1GQT A;  1TZ6 A;  4C5L A;  5CGE A;  1GC5 A;  1LHP A;  1KYH A;  2ABS A;  3VAS A;  3NL3 A;  2A9Y A;  2FV7 A;  3RTB A;  3RQH A;  3RRF A;  1V1S A;  2C49 A;  3FHY A;  3RQ8 A;  5CM5 A;  2R3E A;  3N1C A;  3NCA A;  3QA2 A;  3RQ6 A;  3NC2 A;  2Q5R A;  3EWM A;  1VI9 A;  4S1M A;  4X8F A;  3DZV A;  1YGK A;  3K5W A;  4JJP A;  2HW1 A;  2DCN A;  2YXT A;  2RBC A;  4S1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...