2AA0A

Crystal structure of t. gondii adenosine kinase complexed with 6-methylmercaptopurine riboside
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
351
structure length
351
Chain Sequence
TGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAEKTALSTANKEHAVEVCTGALRLLTAGQNTSATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate analogs induce an intermediate conformational change in Toxoplasma gondii adenosine kinase
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Signaling protein,transferase
molecule keywords adenosine kinase
total genus 119
structure length 351
sequence length 351
ec nomenclature ec 2.7.1.20: Adenosine kinase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1110.10 Alpha Beta 2-Layer Sandwich Adenosine kinase, small domain Adenosine kinase, small domain 2aa0A02
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 2aa0A01
1V19A 1DGMA 4GM6A 3B1RA 1LHRA 3VASA 2DCNA 3CQDA 3K5WA 1RKSA 2AA0A 1RK2A 5CGAA 2AFBA 3IKHA 3BGKA 2V78A 3N1CA 1V1BA 2VARA 3RTCA 2AJPA 2F7KA 3H49A 3UQEA 1BX4A 4KALA 4PVVA 3RU2A 3FHYA 4E3AA 5C3ZA 3NBVA 1YGKA 2C49A 2NWHA 3UQ6A 3RREA 3RTEA 1TZ6A 1VI9A 5EYNA 5CGEA 2Q5RA 2JG1A 2QHPA 2R3EA 3RS9A 3UBOA 1GQTA 2R3BA 2QCVA 3NC9A 3Q1YA 4K9IA 1V1SA 2JG5A 2A9YA 1TZ3A 4UBEA 2FV7A 4XDAA 1V1AA 4E69A 3RPZA 3RRFA 4E8YA 2RBCA 1RKAA 1RFTA 4S1HA 2HLZA 4LBXA 3RTBA 3NL6A 3K9EA 3RRBA 1EKQA 1RFVA 2DDMA 2HW1A 3KTNA 4O1LA 3W4SA 5BYFA 4YWRA 3RSFA 4E8WA 3NM3A 3IH0A 3RY7A 2PKNA 4LC4A 3LOOA 5BYEA 4E84A 5C40A 3H74A 1VM7A 4K8TA 1UA4A 3VAQA 1UB0A 3IQ0A 3ZS7A 4B8SA 4C5NA 3RQ5A 4XCKA 3B1PA 1GC5A 3KZHA 1JXHA 4XF7A 2AJRA 1YHJA 3NM1A 4K93A 4XF6A 2PKKA 5COJA 4EOHA 3B1NA 3JULA 4KADA 3PZSA 3NCAA 4N09A 4U7XA 4JKSA 4S1MA 5C3YA 1L2LA 2F02A 4C5KA 4EN4A 4N08A 1C3QA 1ESJA 1RKDA 3UQDA 4B8RA 1TYYA 2DDWA 3RQ2A 5BYDA 4S1IB 3RSSA 4C5LA 3B3LA 1LIJA 4DC3A 2DDOA 5EY7A 3RS8A 3DRWA 3HPDA 3IE7A 3GBUA 3KD6A 5BYCA 2A9ZA 4KAHA 3RSQA 3RU3A 4C5JA 4WJMA 1YGJA 4S1IA 5C41A 1KYHA 2YXUA 1EKKA 4C5MA 2YXTA 1LIIA 4KBEA 3EWMA 3RM5A 5B6AA 1U2XA 3RT7A 3MBJA 4LCAA 3Q92A 4KANA 5CM5A 3RQQA 3RT9A 2AB8A 5TQIA 3RRJA 2XTBA 4JKUA 3RTGA 3UMOA 3RQ6A 2I5BA 3FHXA 3NL5A 4X8FA 3RQHA 4EUMA 4JJPA 2HQQA 3BF5A 4K9CA 3LJSA 1LIKA 4K8CA 3RPHA 2AX3A 3NC2A 3RQ8A 1RFUA 5F0ZA 3GO6A 1TD2A 2AWDA 3IN1A 4YL5A 1LIOA 2C4EA 2I6AA 3NBWA 3HICA 4K8PA 3UMPA 2JGVA 3NL3A 3LHXA 3OTXA 3QAIA 1JXIA 4O1GA 3RQXA 3UQ9A 4EBUA 2ABSA 2ABQA 2PKFA 4DU5A 2I6BA 1VK4A 3KEUA 3RTDA 4E8ZA 2PKMA 4LBGA 3LKIA 1ESQA 3NL2A 3B1OA 3QA2A 5TRWA 3RO4A 3IBQA 3MBHA 3I3YA 3GO7A 3RSGA 1WYEA 4K8KA 3DZVA 5F11A 1LHPA 3B1QA 3RTAA 3PL2A 3HYOA
chains in the Genus database with same CATH superfamily
1V19A 3ZM6A 1DGMA 2GCBA 3B1RA 1LHRA 2XPCA 4GM6A 4C13A 3VASA 1JBWA 2DCNA 3CQDA 3K5WA 1RKSA 2AA0A 1RK2A 5CGAA 2AFBA 3IKHA 3BGKA 2V78A 2AM2A 1V1BA 2VARA 3N1CA 3RTCA 2AJPA 2F7KA 3H49A 3UQEA 1P3DA 3ZL8A 1BX4A 4KALA 4PVVA 3RU2A 3FHYA 1GQQA 4E3AA 5C3ZA 3NBVA 1YGKA 2AM1A 2C49A 3UQ6A 2NWHA 3RREA 3RTEA 1TZ6A 1VI9A 2Y66A 5EYNA 4CVLA 5CGEA 2Q5RA 2JG1A 2QHPA 2R3EA 4UAGA 3RS9A 3UBOA 1GQTA 2R3BA 2QCVA 3NC9A 3Q1YA 4K9IA 1V1SA 2JG5A 2A9YA 1TZ3A 4UBEA 2FV7A 4XDAA 1V1AA 4E69A 3RPZA 3RRFA 4E8YA 2RBCA 1RKAA 1RFTA 4S1HA 2HLZA 4LBXA 3RT9A 3NL6A 3RTBA 3K9EA 3ZM5A 3RRBA 1EKQA 1RFVA 2DDMA 2HW1A 3KTNA 4O1LA 3W4SA 5BYFA 4YWRA 1E8CA 1O5ZA 3RSFA 4E8WA 3NM3A 3IH0A 3RY7A 2PKNA 4CVKA 4LC4A 1GG4A 1GQYA 3LOOA 5BYEA 4E84A 5C40A 3H74A 1VM7A 2UUOA 4K8TA 1UA4A 3VAQA 4B8SA 1UB0A 3IQ0A 3ZS7A 4HV4A 4C5NA 3RQ5A 4XCKA 3B1PA 1GC5A 3KZHA 4C12A 1JXHA 4XF7A 2AJRA 1YHJA 3NM1A 4K93A 4XF6A 2PKKA 5COJA 4EOHA 3B1NA 3JULA 4KADA 3PZSA 3NCAA 4N09A 2UUPA 4U7XA 3HN7A 4JKSA 4S1MA 3UAGA 5C3YA 1L2LA 2F02A 4C5KA 4EN4A 4N08A 1C3QA 1ESJA 1RKDA 3UQDA 4B8RA 1TYYA 2DDWA 3RQ2A 5BYDA 4BUBA 4S1IB 3RSSA 4C5LA 4CVMA 3B3LA 1LIJA 2WTZA 4DC3A 2DDOA 5EY7A 3RS8A 3DRWA 1EEHA 1FGSA 3HPDA 3IE7A 3GBUA 3KD6A 5BYCA 2A9ZA 4KAHA 3RSQA 3RU3A 2Y67A 3HJ6A 4C5JA 4WJMA 3EAGA 1YGJA 3QCZA 4S1IA 5C41A 1KYHA 2YXUA 5A5EA 1EKKA 4C5MA 2YXTA 1LIIA 4KBEA 2XJAA 3EWMA 3RM5A 5B6AA 1U2XA 2JFGA 2Y68A 3MBJA 4LCAA 3RT7A 1W78A 3Q92A 4KANA 2GCAA 1JBVA 5CM5A 2AB8A 2UAGA 5TQIA 2XTBA 4JKUA 3RQQA 3RRJA 3RTGA 3UMOA 3NRSA 4ZIYA 3RQ6A 2I5BA 3FHXA 4QF5A 3NL5A 4X8FA 2VOSA 2JFFA 3RQHA 4JJPA 2HQQA 3BF5A 4K9CA 4EUMA 3LJSA 1LIKA 4K8CA 4QDIA 3RPHA 5A5FA 2AX3A 3NC2A 3RQ8A 1RFUA 5F0ZA 3GO6A 1TD2A 2AWDA 3IN1A 4YL5A 1LIOA 2C4EA 2I6AA 2VORA 3HICA 3N2AA 2GC5A 3NBWA 4K8PA 2F00A 3UMPA 1W7KA 2JGVA 2JFHA 2WJPA 3NL3A 3LHXA 3OTXA 3QAIA 1JXIA 4O1GA 3RQXA 2X5OA 1J6UA 3UQ9A 2VTDA 4EBUA 2ABSA 2ABQA 2PKFA 2GC6A 2I6BA 1VK4A 3KEUA 3RTDA 4DU5A 4E8ZA 2PKMA 4LBGA 1UAGA 3LKIA 1ESQA 3NL2A 2VTEA 3B1OA 3QA2A 1E0DA 5TRWA 3RO4A 2Y1OA 3IBQA 3MBHA 3I3YA 3GO7A 3RSGA 1WYEA 4K8KA 3DZVA 4BUCA 5F11A 1LHPA 3B1QA 1P31A 3RTAA 3LK7A 3PL2A 3HYOA 3PYZA
chains in the Genus database with same CATH topology
1V19A 1DGMA 4GM6A 3B1RA 1LHRA 3VASA 2DCNA 3CQDA 3K5WA 1RKSA 2AA0A 1RK2A 5CGAA 2AFBA 3IKHA 3BGKA 2V78A 3N1CA 1V1BA 2VARA 3RTCA 2AJPA 2F7KA 3H49A 3UQEA 1BX4A 4KALA 4PVVA 3RU2A 3FHYA 4E3AA 5C3ZA 3NBVA 1YGKA 2C49A 2NWHA 3UQ6A 3RREA 3RTEA 1TZ6A 1VI9A 5EYNA 5CGEA 2Q5RA 2JG1A 2QHPA 2R3EA 3RS9A 3UBOA 1GQTA 2R3BA 2QCVA 3NC9A 3Q1YA 4K9IA 1V1SA 2JG5A 2A9YA 1TZ3A 4UBEA 2FV7A 4XDAA 1V1AA 4E69A 3RPZA 3RRFA 4E8YA 2RBCA 1RKAA 1RFTA 4S1HA 2HLZA 4LBXA 3RTBA 3NL6A 3K9EA 3RRBA 1EKQA 1RFVA 2DDMA 2HW1A 3KTNA 4O1LA 3W4SA 5BYFA 4YWRA 3RSFA 4E8WA 3NM3A 3IH0A 3RY7A 2PKNA 4LC4A 3LOOA 5BYEA 4E84A 5C40A 3H74A 1VM7A 4K8TA 1UA4A 3VAQA 4B8SA 1UB0A 3IQ0A 3ZS7A 4C5NA 3RQ5A 4XCKA 3B1PA 1GC5A 3KZHA 1JXHA 4XF7A 2AJRA 1YHJA 3NM1A 4K93A 4XF6A 2PKKA 5COJA 4EOHA 3B1NA 3JULA 4KADA 3PZSA 3NCAA 4N09A 4U7XA 4JKSA 4S1MA 5C3YA 1L2LA 2F02A 4C5KA 4EN4A 4N08A 1C3QA 1ESJA 1RKDA 3UQDA 4B8RA 1TYYA 2DDWA 3RQ2A 5BYDA 4S1IB 3RSSA 4C5LA 3B3LA 1LIJA 4DC3A 2DDOA 5EY7A 3RS8A 3DRWA 3HPDA 3IE7A 3GBUA 3KD6A 5BYCA 2A9ZA 4KAHA 3RSQA 3RU3A 3HJ6A 4C5JA 4WJMA 1YGJA 4S1IA 5C41A 1KYHA 2YXUA 1EKKA 4C5MA 2YXTA 1LIIA 4KBEA 3EWMA 3RM5A 5B6AA 1U2XA 3RT7A 3MBJA 4LCAA 3Q92A 4KANA 5CM5A 3RQQA 3RT9A 2AB8A 5TQIA 3RRJA 2XTBA 4JKUA 3RTGA 3UMOA 3RQ6A 2I5BA 3FHXA 3NL5A 4X8FA 3RQHA 4EUMA 4JJPA 2HQQA 3BF5A 4K9CA 3LJSA 1LIKA 4K8CA 3RPHA 2AX3A 3NC2A 3RQ8A 1RFUA 5F0ZA 3GO6A 1TD2A 2AWDA 3IN1A 4YL5A 1LIOA 2C4EA 2I6AA 3NBWA 3HICA 4K8PA 3UMPA 2JGVA 3NL3A 3LHXA 3OTXA 3QAIA 1JXIA 4O1GA 3RQXA 3UQ9A 4EBUA 2ABSA 2ABQA 2PKFA 4DU5A 2I6BA 1VK4A 3KEUA 3RTDA 4E8ZA 2PKMA 4LBGA 3LKIA 1ESQA 3NL2A 3B1OA 3QA2A 5TRWA 3RO4A 3IBQA 3MBHA 3I3YA 3GO7A 3RSGA 1WYEA 4K8KA 3DZVA 5F11A 1LHPA 3B1QA 3RTAA 3PL2A 3HYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V19 A;  1DGM A;  4GM6 A;  3B1R A;  1LHR A;  3VAS A;  2DCN A;  3CQD A;  3K5W A;  1RKS A;  2AA0 A;  1RK2 A;  5CGA A;  2AFB A;  3IKH A;  3BGK A;  2V78 A;  3N1C A;  1V1B A;  2VAR A;  3RTC A;  2AJP A;  2F7K A;  3H49 A;  3UQE A;  1BX4 A;  4KAL A;  4PVV A;  3RU2 A;  3FHY A;  4E3A A;  5C3Z A;  3NBV A;  1YGK A;  2C49 A;  2NWH A;  3UQ6 A;  3RRE A;  3RTE A;  1TZ6 A;  1VI9 A;  5EYN A;  5CGE A;  2Q5R A;  2JG1 A;  2QHP A;  2R3E A;  3RS9 A;  3UBO A;  1GQT A;  2R3B A;  2QCV A;  3NC9 A;  3Q1Y A;  4K9I A;  1V1S A;  2JG5 A;  2A9Y A;  1TZ3 A;  4UBE A;  2FV7 A;  4XDA A;  1V1A A;  4E69 A;  3RPZ A;  3RRF A;  4E8Y A;  2RBC A;  1RKA A;  1RFT A;  4S1H A;  2HLZ A;  4LBX A;  3RTB A;  3NL6 A;  3K9E A;  3RRB A;  1EKQ A;  1RFV A;  2DDM A;  2HW1 A;  3KTN A;  4O1L A;  3W4S A;  5BYF A;  4YWR A;  3RSF A;  4E8W A;  3NM3 A;  3IH0 A;  3RY7 A;  2PKN A;  4LC4 A;  3LOO A;  5BYE A;  4E84 A;  5C40 A;  3H74 A;  1VM7 A;  4K8T A;  1UA4 A;  3VAQ A;  1UB0 A;  3IQ0 A;  3ZS7 A;  4B8S A;  4C5N A;  3RQ5 A;  4XCK A;  3B1P A;  1GC5 A;  3KZH A;  1JXH A;  4XF7 A;  2AJR A;  1YHJ A;  3NM1 A;  4K93 A;  4XF6 A;  2PKK A;  5COJ A;  4EOH A;  3B1N A;  3JUL A;  4KAD A;  3PZS A;  3NCA A;  4N09 A;  4U7X A;  4JKS A;  4S1M A;  5C3Y A;  1L2L A;  2F02 A;  4C5K A;  4EN4 A;  4N08 A;  1C3Q A;  1ESJ A;  1RKD A;  3UQD A;  4B8R A;  1TYY A;  2DDW A;  3RQ2 A;  5BYD A;  4S1I B;  3RSS A;  4C5L A;  3B3L A;  1LIJ A;  4DC3 A;  2DDO A;  5EY7 A;  3RS8 A;  3DRW A;  3HPD A;  3IE7 A;  3GBU A;  3KD6 A;  5BYC A;  2A9Z A;  4KAH A;  3RSQ A;  3RU3 A;  4C5J A;  4WJM A;  1YGJ A;  4S1I A;  5C41 A;  1KYH A;  2YXU A;  1EKK A;  4C5M A;  2YXT A;  1LII A;  4KBE A;  3EWM A;  3RM5 A;  5B6A A;  1U2X A;  3RT7 A;  3MBJ A;  4LCA A;  3Q92 A;  4KAN A;  5CM5 A;  3RQQ A;  3RT9 A;  2AB8 A;  5TQI A;  3RRJ A;  2XTB A;  4JKU A;  3RTG A;  3UMO A;  3RQ6 A;  2I5B A;  3FHX A;  3NL5 A;  4X8F A;  3RQH A;  4EUM A;  4JJP A;  2HQQ A;  3BF5 A;  4K9C A;  3LJS A;  1LIK A;  4K8C A;  3RPH A;  2AX3 A;  3NC2 A;  3RQ8 A;  1RFU A;  5F0Z A;  3GO6 A;  1TD2 A;  2AWD A;  3IN1 A;  4YL5 A;  1LIO A;  2C4E A;  2I6A A;  3NBW A;  3HIC A;  4K8P A;  3UMP A;  2JGV A;  3NL3 A;  3LHX A;  3OTX A;  3QAI A;  1JXI A;  4O1G A;  3RQX A;  3UQ9 A;  4EBU A;  2ABS A;  2ABQ A;  2PKF A;  4DU5 A;  2I6B A;  1VK4 A;  3KEU A;  3RTD A;  4E8Z A;  2PKM A;  4LBG A;  3LKI A;  1ESQ A;  3NL2 A;  3B1O A;  3QA2 A;  5TRW A;  3RO4 A;  3IBQ A;  3MBH A;  3I3Y A;  3GO7 A;  3RSG A;  1WYE A;  4K8K A;  3DZV A;  5F11 A;  1LHP A;  3B1Q A;  3RTA A;  3PL2 A;  3HYO A; 
#chains in the Genus database with same CATH topology
 1V19 A;  3ZM6 A;  1DGM A;  2GCB A;  3B1R A;  1LHR A;  2XPC A;  4GM6 A;  4C13 A;  3VAS A;  1JBW A;  2DCN A;  3CQD A;  3K5W A;  1RKS A;  2AA0 A;  1RK2 A;  5CGA A;  2AFB A;  3IKH A;  3BGK A;  2V78 A;  2AM2 A;  1V1B A;  2VAR A;  3N1C A;  3RTC A;  2AJP A;  2F7K A;  3H49 A;  3UQE A;  1P3D A;  3ZL8 A;  1BX4 A;  4KAL A;  4PVV A;  3RU2 A;  3FHY A;  1GQQ A;  4E3A A;  5C3Z A;  3NBV A;  1YGK A;  2AM1 A;  2C49 A;  3UQ6 A;  2NWH A;  3RRE A;  3RTE A;  1TZ6 A;  1VI9 A;  2Y66 A;  5EYN A;  4CVL A;  5CGE A;  2Q5R A;  2JG1 A;  2QHP A;  2R3E A;  4UAG A;  3RS9 A;  3UBO A;  1GQT A;  2R3B A;  2QCV A;  3NC9 A;  3Q1Y A;  4K9I A;  1V1S A;  2JG5 A;  2A9Y A;  1TZ3 A;  4UBE A;  2FV7 A;  4XDA A;  1V1A A;  4E69 A;  3RPZ A;  3RRF A;  4E8Y A;  2RBC A;  1RKA A;  1RFT A;  4S1H A;  2HLZ A;  4LBX A;  3RT9 A;  3NL6 A;  3RTB A;  3K9E A;  3ZM5 A;  3RRB A;  1EKQ A;  1RFV A;  2DDM A;  2HW1 A;  3KTN A;  4O1L A;  3W4S A;  5BYF A;  4YWR A;  1E8C A;  1O5Z A;  3RSF A;  4E8W A;  3NM3 A;  3IH0 A;  3RY7 A;  2PKN A;  4CVK A;  4LC4 A;  1GG4 A;  1GQY A;  3LOO A;  5BYE A;  4E84 A;  5C40 A;  3H74 A;  1VM7 A;  2UUO A;  4K8T A;  1UA4 A;  3VAQ A;  4B8S A;  1UB0 A;  3IQ0 A;  3ZS7 A;  4HV4 A;  4C5N A;  3RQ5 A;  4XCK A;  3B1P A;  1GC5 A;  3KZH A;  4C12 A;  1JXH A;  4XF7 A;  2AJR A;  1YHJ A;  3NM1 A;  4K93 A;  4XF6 A;  2PKK A;  5COJ A;  4EOH A;  3B1N A;  3JUL A;  4KAD A;  3PZS A;  3NCA A;  4N09 A;  2UUP A;  4U7X A;  3HN7 A;  4JKS A;  4S1M A;  3UAG A;  5C3Y A;  1L2L A;  2F02 A;  4C5K A;  4EN4 A;  4N08 A;  1C3Q A;  1ESJ A;  1RKD A;  3UQD A;  4B8R A;  1TYY A;  2DDW A;  3RQ2 A;  5BYD A;  4BUB A;  4S1I B;  3RSS A;  4C5L A;  4CVM A;  3B3L A;  1LIJ A;  2WTZ A;  4DC3 A;  2DDO A;  5EY7 A;  3RS8 A;  3DRW A;  1EEH A;  1FGS A;  3HPD A;  3IE7 A;  3GBU A;  3KD6 A;  5BYC A;  2A9Z A;  4KAH A;  3RSQ A;  3RU3 A;  2Y67 A;  3HJ6 A;  4C5J A;  4WJM A;  3EAG A;  1YGJ A;  3QCZ A;  4S1I A;  5C41 A;  1KYH A;  2YXU A;  5A5E A;  1EKK A;  4C5M A;  2YXT A;  1LII A;  4KBE A;  2XJA A;  3EWM A;  3RM5 A;  5B6A A;  1U2X A;  2JFG A;  2Y68 A;  3MBJ A;  4LCA A;  3RT7 A;  1W78 A;  3Q92 A;  4KAN A;  2GCA A;  1JBV A;  5CM5 A;  2AB8 A;  2UAG A;  5TQI A;  2XTB A;  4JKU A;  3RQQ A;  3RRJ A;  3RTG A;  3UMO A;  3NRS A;  4ZIY A;  3RQ6 A;  2I5B A;  3FHX A;  4QF5 A;  3NL5 A;  4X8F A;  2VOS A;  2JFF A;  3RQH A;  4JJP A;  2HQQ A;  3BF5 A;  4K9C A;  4EUM A;  3LJS A;  1LIK A;  4K8C A;  4QDI A;  3RPH A;  5A5F A;  2AX3 A;  3NC2 A;  3RQ8 A;  1RFU A;  5F0Z A;  3GO6 A;  1TD2 A;  2AWD A;  3IN1 A;  4YL5 A;  1LIO A;  2C4E A;  2I6A A;  2VOR A;  3HIC A;  3N2A A;  2GC5 A;  3NBW A;  4K8P A;  2F00 A;  3UMP A;  1W7K A;  2JGV A;  2JFH A;  2WJP A;  3NL3 A;  3LHX A;  3OTX A;  3QAI A;  1JXI A;  4O1G A;  3RQX A;  2X5O A;  1J6U A;  3UQ9 A;  2VTD A;  4EBU A;  2ABS A;  2ABQ A;  2PKF A;  2GC6 A;  2I6B A;  1VK4 A;  3KEU A;  3RTD A;  4DU5 A;  4E8Z A;  2PKM A;  4LBG A;  1UAG A;  3LKI A;  1ESQ A;  3NL2 A;  2VTE A;  3B1O A;  3QA2 A;  1E0D A;  5TRW A;  3RO4 A;  2Y1O A;  3IBQ A;  3MBH A;  3I3Y A;  3GO7 A;  3RSG A;  1WYE A;  4K8K A;  3DZV A;  4BUC A;  5F11 A;  1LHP A;  3B1Q A;  1P31 A;  3RTA A;  3LK7 A;  3PL2 A;  3HYO A;  3PYZ A; 
#chains in the Genus database with same CATH homology
 1V19 A;  1DGM A;  4GM6 A;  3B1R A;  1LHR A;  3VAS A;  2DCN A;  3CQD A;  3K5W A;  1RKS A;  2AA0 A;  1RK2 A;  5CGA A;  2AFB A;  3IKH A;  3BGK A;  2V78 A;  3N1C A;  1V1B A;  2VAR A;  3RTC A;  2AJP A;  2F7K A;  3H49 A;  3UQE A;  1BX4 A;  4KAL A;  4PVV A;  3RU2 A;  3FHY A;  4E3A A;  5C3Z A;  3NBV A;  1YGK A;  2C49 A;  2NWH A;  3UQ6 A;  3RRE A;  3RTE A;  1TZ6 A;  1VI9 A;  5EYN A;  5CGE A;  2Q5R A;  2JG1 A;  2QHP A;  2R3E A;  3RS9 A;  3UBO A;  1GQT A;  2R3B A;  2QCV A;  3NC9 A;  3Q1Y A;  4K9I A;  1V1S A;  2JG5 A;  2A9Y A;  1TZ3 A;  4UBE A;  2FV7 A;  4XDA A;  1V1A A;  4E69 A;  3RPZ A;  3RRF A;  4E8Y A;  2RBC A;  1RKA A;  1RFT A;  4S1H A;  2HLZ A;  4LBX A;  3RTB A;  3NL6 A;  3K9E A;  3RRB A;  1EKQ A;  1RFV A;  2DDM A;  2HW1 A;  3KTN A;  4O1L A;  3W4S A;  5BYF A;  4YWR A;  3RSF A;  4E8W A;  3NM3 A;  3IH0 A;  3RY7 A;  2PKN A;  4LC4 A;  3LOO A;  5BYE A;  4E84 A;  5C40 A;  3H74 A;  1VM7 A;  4K8T A;  1UA4 A;  3VAQ A;  4B8S A;  1UB0 A;  3IQ0 A;  3ZS7 A;  4C5N A;  3RQ5 A;  4XCK A;  3B1P A;  1GC5 A;  3KZH A;  1JXH A;  4XF7 A;  2AJR A;  1YHJ A;  3NM1 A;  4K93 A;  4XF6 A;  2PKK A;  5COJ A;  4EOH A;  3B1N A;  3JUL A;  4KAD A;  3PZS A;  3NCA A;  4N09 A;  4U7X A;  4JKS A;  4S1M A;  5C3Y A;  1L2L A;  2F02 A;  4C5K A;  4EN4 A;  4N08 A;  1C3Q A;  1ESJ A;  1RKD A;  3UQD A;  4B8R A;  1TYY A;  2DDW A;  3RQ2 A;  5BYD A;  4S1I B;  3RSS A;  4C5L A;  3B3L A;  1LIJ A;  4DC3 A;  2DDO A;  5EY7 A;  3RS8 A;  3DRW A;  3HPD A;  3IE7 A;  3GBU A;  3KD6 A;  5BYC A;  2A9Z A;  4KAH A;  3RSQ A;  3RU3 A;  3HJ6 A;  4C5J A;  4WJM A;  1YGJ A;  4S1I A;  5C41 A;  1KYH A;  2YXU A;  1EKK A;  4C5M A;  2YXT A;  1LII A;  4KBE A;  3EWM A;  3RM5 A;  5B6A A;  1U2X A;  3RT7 A;  3MBJ A;  4LCA A;  3Q92 A;  4KAN A;  5CM5 A;  3RQQ A;  3RT9 A;  2AB8 A;  5TQI A;  3RRJ A;  2XTB A;  4JKU A;  3RTG A;  3UMO A;  3RQ6 A;  2I5B A;  3FHX A;  3NL5 A;  4X8F A;  3RQH A;  4EUM A;  4JJP A;  2HQQ A;  3BF5 A;  4K9C A;  3LJS A;  1LIK A;  4K8C A;  3RPH A;  2AX3 A;  3NC2 A;  3RQ8 A;  1RFU A;  5F0Z A;  3GO6 A;  1TD2 A;  2AWD A;  3IN1 A;  4YL5 A;  1LIO A;  2C4E A;  2I6A A;  3NBW A;  3HIC A;  4K8P A;  3UMP A;  2JGV A;  3NL3 A;  3LHX A;  3OTX A;  3QAI A;  1JXI A;  4O1G A;  3RQX A;  3UQ9 A;  4EBU A;  2ABS A;  2ABQ A;  2PKF A;  4DU5 A;  2I6B A;  1VK4 A;  3KEU A;  3RTD A;  4E8Z A;  2PKM A;  4LBG A;  3LKI A;  1ESQ A;  3NL2 A;  3B1O A;  3QA2 A;  5TRW A;  3RO4 A;  3IBQ A;  3MBH A;  3I3Y A;  3GO7 A;  3RSG A;  1WYE A;  4K8K A;  3DZV A;  5F11 A;  1LHP A;  3B1Q A;  3RTA A;  3PL2 A;  3HYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...