2AADA

The role of histidine-40 in ribonuclease t1 catalysis: three-dimensional structures of the partially active his40lys mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPKKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1 ISOZYME
publication title Role of histidine-40 in ribonuclease T1 catalysis: three-dimensionalstructures of the partially active His40Lys mutant.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 27
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2aadA00
3AGNA 1YVSA 1YNVX 6GSPA 1LRAA 3KCHA 1B27A 1RTUA 1RSNA 1BSBA 1GMPA 1B2UA 1B21A 1BNJA 1BNSA 3DGYA 1HZ1A 2RNTA 3GSPA 2BU4A 1RGLA 1UCKA 1T2HA 1X1YA 2GSPA 1RGAA 1PY3A 1BANA 3A5EA 1FYSA 1BIRA 2HOHA 1BVIA 7GSPA 1BNFA 2F4YA 1I0VA 1RGFA 1RN1A 1UCIA 1CH0A 2AAEA 4HOHA 2F5WA 4GSPA 5BU4A 3WR2A 1GOUA 1BU4A 5BIRA 1BRGA 1BRIA 2KF6A 2KAAA 9RNTA 3WHOA 3AGOA 1RCLA 1BNRA 1RN4A 1TTOA 1HYFA 1R4YA 1BRKA 7RNTA 4BU4A 1ZGXA 1I0XA 2KF3A 1BRJA 1BSEA 4GHOA 1FZUA 1FUTA 1DE3A 1RGGA 1FW7A 1X1WA 8RNTA 4J5GA 1B20A 1I3IA 1DETA 1AY7A 1BAOA 4RNTA 1I2EA 1BNEA 3RNTA 1PYLA 1TRQA 1RGCA 2ZA4A 1AQZA 1B3SA 1YGWA 1B2ZA 1BRHA 3SYUA 1LOVA 1I70A 1B2MA 1T2IA 2KF5A 1RGEA 1GSPA 3Q3FA 3URPA 2KF4A 1BSDA 2SARA 3HOHA 1MGWA 1RGKA 4HAAA 1GOVA 1TRPA 2F56A 1BNIA 5HOHA 1RNBA 1BGSA 2F5MA 1RLSA 2BIRA 1RGHA 1LOWA 1Q9EA 1BSAA 1B2SA 1UCJA 4J5KA 1GMQA 1SARA 3AHSA 1BRNL 3AHWA 5RNTA 1I2FA 1I3FA 2C4BA 1X1XA 1BRSA 1I2GA 1RHLA 1G02A 1IYYA 1LOYA 1BUJA 1BOXA 1JBTA 5GSPA 1A2PA 3D5GA 1JBRA 3D4AA 1RMSA 3BIRA 1UCLA 1LNIA 3DH2A 1RCKA 1BSCA 1I8VA 1JBSA 2AADA 1GOYA 1B2XA 1X1UA 1FUSA 1C54A 6RNTA 3BU4A 3D5IA 4BIRA 1BNGA 1MGRA 1RDSA 1GMRA 2RBIA 1RNTA
chains in the Genus database with same CATH superfamily
3WMDA 4HM1B 4TX4A 4U13A 1Q40B 1OF5B 1W00A 3VF1A 1W6YA 4HM7B 4XDWA 1UUGB 2UGIA 3KCHA 2GEXA 3G4S3 1RTUA 3EBYA 4RBNA 4HM0B 5AYSC 1GMPA 4LMIA 3S5CA 3EC9A 2CWUA 3DGYA 1HZ1A 3GSPA 4H3UA 1ZO2A 2H0HA 3S28A 3UL5A 2QEX3 1AR0A 1VQK3 2CFKA 1T2HA 4HBRA 1X1YA 2GSPA 1OGZA 1RGAA 3K63A 2P0MA 5DREA 1BVIA 3EBTA 3EF8A 1YJ93 5CK6A 1K28A 3X3YA 1RGFA 1UCIA 1CH0A 1N9JA 4N6LA 2AAEA 4HOHA 5D81A 5IEPA 1VQQA 3IJEB 3LYGA 2KCDA 1RRHA 4GSPA 1GOUA 3D9RA 4KZ1A 5EEOA 5AEUB 2KF6A 1Y4KA 3NV0A 2ZDJA 4JRFA 3QRDA 4OVMA 4CCVA 1BNRA 1O7MB 1RN4A 2WOHA 1OHOA 1KSIA 1EKMA 3F9SA 3WA3A 1ISKA 1ULJB 1RKYA 2CC3A 2Q07A 4ILFA 1AVLA 3G0KA 4HM2B 3ZG5A 1VQL3 1A2KA 2Z7AA 1KWIA 3B8LA 1OPYA 3FH1A 5IG0A 1UI7A 1N8QA 4J5GA 2CFLA 2MC8A 4NREA 1I2EA 1BNEA 2W56B 1G96A 3H3HA 4JF8A 3FSDA 4RZMA 4CPKA 1FA3A 1OH0A 4J8TA 1AQZA 4N3VA 5AIIA 1CQSA 1NO3A 1SPUA 1W02A 5A0OB 1DMMA 1Q42A 1V57A 5JBSA 3CXC2 2BMRB 1LOVA 1B2MA 5ELUA 3MG3A 1GSPA 3X41A 3HOHA 3NXJA 1O7PB 4HAAA 4N6UA 2I9WA 3UB1A 1GOVA 3S67A 3I563 2W2CA 1YIJ3 2RSXA 2LQVA 1TRPA 2MF7A 1LQMB 3CCJ3 3U1WA 4NHFA 1FGQA 1ULIB 2F5MA 3BNBA 3MG1A 3OWYA 2BIRA 4K1VA 2IUJA 4BTYA 1LOWA 5M19A 3FG3A 1BSAA 3DM8A 4QWTA 4N6MA 4FCMA 3WOEB 1EQKA 1UCJA 1RN7A 1JB2A 4J5KA 3VSYA 5CLKA 1STDA 3OXAA 3AHSA 4X2OA 1BRNL 3STDA 1OHSA 1TU5A 2C4BA 1AV4A 3CME3 1IVWA 1HU9A 2XGLA 3ZG0A 1BOXA 1EG9B 1V74A 1Q824 1QVG2 3KN4A 4BTXA 1QJGA 3CC23 5KP3A 1DVDA 3LT9A 1T5YA 1LNIA 3IPTA 3CNXA 2STDA 1IVXA 5EQLA 1VQ93 2AADA 3OX9A 2W9QA 2C10A 3WDGB 1GOYA 3CCM3 1JB5A 1OGXA 1FUSA 3LTBA 4HZBB 1FGOA 1SIIA 3V98A 5KP1A 3BU4A 2Y73A 2W6JH 4MMZB 3D5IA 1LOXA 3NX0A 1BNGA 2W56A 3SXXA 1D6ZA 2CFDA 2RBIA 3MHEA 5JPUA 1RNTA 3CC73 3F8HA 1MWRA 5CF2A 4XBTA 1YNVX 4MMYB 3LXUX 3ZFZA 1LVNA 1B27A 2CG0A 3FZWA 2W0QA 3OWSA 2KXGA 5AEWB 1BSBA 1JRQA 1B2UA 1W2ZA 3GZYB 1JN5B 1BNJA 4K90B 4R80A 2D42A 2RNTA 3DY5A 3EX9A 1RGLA 1UCKA 2CK3H 3KE7A 1FUWA 3CNMA 1IQYA 5FW5A 3LTCA 1BANA 2HOHA 1BIRA 1TJDA 1JV2B 2JDIH 4ZM8A 1BNFA 7GSPA 2P38A 3B7CA 1N5PA 1RN1A 4HM6B 3TDGA 3SEDA 1U5OA 1DMQA 2F5WA 1VQM3 2K54A 5BU4A 5IG5A 4K61A 1BU4A 4HVNA 1ZX2A 1BRIA 1V58A 2R41A 3I0YA 1W7CA 2CG1A 1RCLA 1HYFA 3EN8A 1BRKA 3HI7A 3DGOA 1UGIA 1IVVA 1L5GB 1NDOB 2KF3A 2BNGA 2FNQA 2Z76A 3H51A 1IT8A 1BSEA 3GWRA 3HIIA 4K1UA 2BO9B 4IIAA 1N5HA 3HX8A 4GHOA 5DRVA 3V99A 5IW9A 1DVCA 1JKGB 2PNCA 1GY7A 4XM4A 1DE3A 1W6GA 2BHMA 2CHCA 1X1WA 3DXOA 2KRTA 3ROBA 1Q814 3G8ZA 1T3BA 3FCSB 3DGNA 3FG4A 1PYLA 2ZA4A 3L0RA 3UJMA 1B3SA 1GYBA 3LTAA 3NBBA 3WA2X 2ZHXB 5AI1A 1VQN3 1BUQA 4R1KA 1F8NA 2E2TA 5G2GA 4IT7A 2K3DA 1W5ZA 3PXMA 6STDA 1VQP3 3SYUA 2GBXB 1VQ43 1AVKA 2CX0A 1WNHA 1T2IA 4FMBA 1RGEA 3URPA 2QIYA 2SARA 1RGKA 2CH9A 3SVAA 2K0MA 5BXQA 4LEHA 3J7Yd 3MPHA 1JJ22 1YIT3 1Q864 5HOHA 1K734 3CPOA 1RRLA 3N8BA 3T8UA 1KC84 2XFTA 2GBWB 2O3OA 1JB4A 3CCU3 1Q9EA 2P05A 3RDEA 3OWUA 2HMNB 2OCTA 4N6OB 1B2SA 4FMAA 1TUHA 4CDLA 4HZ9B 1SARA 3GZRA 1IQXA 2LYXA 1O7WB 1Q7Y4 1TFOA 4WYKA 5RNTA 1I2FA 1I3FA 1NNVA 2M7OA 2XGNA 1NB3I 1IQ8A 1X1XA 1BRSA 4L7KA 4MJDA 1IYYA 1Q40A 1OF5A 1MWTA 1LOYA 3JUQA 5STDA 1PU4A 2Z6BA 1IVUA 2ZL8A 1QALA 2IMJA 3LH4A 3PGBA 5IERA 4HM3B 2C11A 2YFIB 2XH9A 1JBRA 4L8OA 1RMSA 4FR9A 1YHQ3 3PYJA 1S723 1N9EA 1I8VA 2WGQA 4CJNA 3LTDA 1O7GB 4G1MB 1YJN3 4EBGA 2WOFA 2YFLB 1W4NA 3EQQB 4L8PA 4WP5A 1JKGA 3F7SA 3EHCA 3B4OA 4HYZA 1E97A 1MNLA 1RJOA 1MWUA 1UUWB 6RNTA 5IG4A 5IF6A 2R4IA 1Q7HA 1RDSA 1GMRA 2F86B 1MOLA 3MSOA 3BLZA 5FGOA 3AGNA 3NM2A 3ER7A 3K0ZA 3B4PA 4FMCA 3E99A 3CC43 2HMKB 4O8SA 5AIFA 3O8YA 1RSNA 5D82A 4PEJA 3Q1CA 2F98A 1U8CB 3FLJA 3LT8A 1B21A 4DKIA 1UW1A 4MMXB 2SBLA 2OWPA 3N54B 2CW9A 4KFEA 2V1LA 1QAKA 5BVBA 2Y74A 2CIUA 1WTHA 4FMDA 4AKYA 4WHAA 1NU3A 4XDVA 5AYRB 1PY3A 1Z1SA 3UL6A 4HJLB 3JUNA 1IV9A 1LNHA 1O7HB 3WR2A 1A90A 2IA7A 4I5QA 2YFJB 1EUIC 1BRGA 5IENA 4O3VA 3FKAA 2OTL3 1FGRA 1WQLB 2KAAA 5AIHA 9RNTA 2D1WA 3AGOA 3NBRA 1C7HA 1OCVA 3KZTA 1VQ73 4O2HA 1ZS7A 1LQGC 1R4YA 1IT7A 2RCDA 2W9PA 2QGUA 2E2UA 4BU4A 1ZGXA 5M18A 2OTJ3 5CF1A 2RFRA 1GD4A 1K9M4 4HM8B 3G6E3 3SX1A 1FZUA 1FUTA 1FGTA 3NQZA 2UUGC 3DUKA 1JNQA 4R9LA 1FW7A 4O02B 1PFPA 4GL6A 4J9AA 3MG2A 1B20A 1YGEA 2JQ5A 1DETA 4N6TA 3U97A 1BAOA 1LXEA 3AMOB 3D79A 3KFQC 3RNTA 3X3XA 1E3VA 2IYJA 3NHXA 4OUQA 1GD3A 1M1K4 3MWZA 2GU3A 3HIGA 3F40A 2Z77A 1CYUA 1B2ZA 1K8A4 8CHOA 1VQ63 3DZLA 1VQ83 1I70A 3DGMA 1W6CA 3JUMA 3Q3FA 5HGRA 4BL2A 4WWUC 2P09A 2GU1A 1ASKA 1EEJA 3N9HA 4EV2A 2F56A 3NM7A 4H61A 3JUOA 3K7CA 1JZDA 1W01A 4RNZA 4EW5A 2H0GA 1BGSA 1NB5I 1RNBA 1RLSA 1OUNA 2F99A 3BNEA 2B24B 3CCQ3 1WMOA 1GY6A 4BL3A 3CCE3 1NJI4 1MWSA 1GMQA 3M8CA 1G0TA 3CMA3 2WGOA 3AHWA 2IUKA 1VZZA 4LSOA 1GY5A 2RGQA 5G1LA 1YVBI 1R4CA 2HMLB 3Q2PA 3ALAA 1VQ53 3EB8A 2HMOB 1WMPA 3GRDA 3GAXA 5I97A 1A2PA 1TFKA 3D5GA 3F8XA 3K9MC 4BTWA 3BIRA 7STDA 3K5TA 2OOVC 1JN5A 1CEWI 1OACA 3FGYA 1CYVA 1RCKA 1TP6A 1OHPA 1JBSA 3CCS3 4ORLA 4HKVB 1B2XA 2UX0A 5M1AA 3KSED 3CCV3 4GB5A 2E2VA 2XFSA 2YX9A 4AKZA 3AMOA 5IG3A 1UUVB 1E3RA 2QA43 3BB9A 2BMOB 3X40A 4XB5A 3CD63 4LGQA 4LZIA 1YVSA 3FF0A 3PCRA 2IY2A 4KFDA 1QMAA 6GSPA 1LRAA 1SQWA 3JUPA 5LC7A 4EV5A 3T0UA 4X2HA 1UGHI 2O9UX 1BNSA 3G713 4AEQA 5IEOA 2BU4A 2W03A 3WODG 4R9KA 3PZWA 5ELJA 1SIHA 3NUVA 5JPPA 3A5EA 1FYSA 3LMLA 2GEYA 2F4YA 2W04A 1ROAA 1I0VA 5G1KA 1STFI 2HMJB 2OQEC 2H0IA 4LYLB 1EA2A 2CKFB 3F7XA 5CXOA 1M904 3MKIA 3WOFB 4RNYA 5BIRA 3A76A 4WFOA 3SOYA 3WHOA 3GZBA 1HKXA 3GZXB 4HM5B 1NWWA 1DYUA 1TTOA 2GXFA 4IPBA 4XBXA 3DGLA 3X3ZA 7RNTA 1M9GA 4NPBA 3BNDA 5TGNA 1I0XA 1GS3A 1D6UA 1BRJA 3CPW2 1KD14 1IV7A 2XSOB 2BMQB 3BNCA 1RGGA 1IU7A 2FXTA 3SLUA 3EE1A 4EYCA 3SOAA 4R4KA 4EXRA 4OK0A 8RNTA 1I3IA 1AY7A 3JVCA 4RNTA 2ML5A 1UI8A 1UDII 1ROVA 2B1XB 3FF2A 4KT3B 1S5AA 3RGRA 1TRQA 1RGCA 3X42A 1YI23 2A15A 2CWTA 2XF3A 3IMAB 5EVHA 1W2B2 1YGWA 2INXA 3MYTA 3CCR3 1BRHA 3OV4A 5AIGA 2L1SA 2KF5A 2OOVA 4EC6A 3KKGA 3S29A 1JZOA 1TIJA 2KF4A 1BSDA 1D6YA 1MGWA 2CWVA 2L4VA 3G16A 3NQYA 1J2BA 3UNLA 1WMNA 3NBJA 3LOYA 4HM4B 1BNIA 4I4KA 2XRXB 2FGTA 4N6NB 3HK4A 1QVF2 3EN1B 1A67A 3HZPA 1RGHA 2XR8B 3PS8A 3S27A 2J8XB 2XEPA 1O7NB 2WO0A 1IK3A 3ECFA 1YJW3 2P0XA 1QAFA 3NV0B 4FCJA 5D83A 5KP4A 1I2GA 1RHLA 1G02A 3RGAA 1FGMA 3I553 4XBYA 3CCL3 4KFFA 1VQO3 2PZVA 1N8R4 1KQS2 1BUJA 1SJWA 2CFWA 3V92A 5GSPA 1JBTA 3D3LA 2BT3A 3T8NA 1DMNA 3QK9A 3OW22 5LC6A 3D4AA 1K41A 1UCLA 3LZAA 3FG1A 4MEIA 3VGNA 3DH2A 2ML6A 2OQEA 1BSCA 2CX1A 4KVHA 1US1A 4N6V0 1IDPA 3Q90A 1X1UA 3CU3A 4STDA 3F14A 3KIIA 3EJVA 2XSHB 4FCZA 1C54A 3KSPA 4BIRA 2CFGA 2HMMB 4Q53A 1MGRA 4WYKB 3PCSA 1M1XB 1A2VA 3DMCA
chains in the Genus database with same CATH topology
3AGNA 1YVSA 1YNVX 6GSPA 1LRAA 3KCHA 1B27A 1RTUA 1RSNA 1BSBA 1GMPA 1B2UA 1B21A 1BNJA 1BNSA 3DGYA 1HZ1A 2RNTA 3GSPA 2BU4A 1RGLA 1UCKA 1T2HA 1X1YA 2GSPA 1RGAA 1PY3A 1BANA 3A5EA 1FYSA 1BIRA 2HOHA 1BVIA 7GSPA 1BNFA 2F4YA 1I0VA 1RGFA 1RN1A 1UCIA 1CH0A 2AAEA 4HOHA 2F5WA 4GSPA 5BU4A 3WR2A 1GOUA 1BU4A 5BIRA 1BRGA 1BRIA 2KF6A 2KAAA 9RNTA 3WHOA 3AGOA 1RCLA 1BNRA 1RN4A 1TTOA 1HYFA 1R4YA 1BRKA 7RNTA 4BU4A 1ZGXA 1I0XA 2KF3A 1BRJA 1BSEA 4GHOA 1FZUA 1FUTA 1DE3A 1RGGA 1FW7A 1X1WA 8RNTA 4J5GA 1B20A 1I3IA 1DETA 1AY7A 1BAOA 4RNTA 1I2EA 1BNEA 3RNTA 1PYLA 1TRQA 1RGCA 2ZA4A 1AQZA 1B3SA 1YGWA 1B2ZA 1BRHA 3SYUA 1LOVA 1I70A 1B2MA 1T2IA 2KF5A 1RGEA 1GSPA 3Q3FA 3URPA 2KF4A 1BSDA 2SARA 3HOHA 1MGWA 1RGKA 4HAAA 1GOVA 1TRPA 2F56A 1BNIA 5HOHA 1RNBA 1BGSA 2F5MA 1RLSA 2BIRA 1RGHA 1LOWA 1Q9EA 1BSAA 1B2SA 1UCJA 4J5KA 1GMQA 1SARA 3AHSA 1BRNL 3AHWA 5RNTA 1I2FA 1I3FA 2C4BA 1X1XA 1BRSA 1I2GA 1RHLA 1G02A 1IYYA 1LOYA 1BUJA 1BOXA 1JBTA 5GSPA 1A2PA 3D5GA 1JBRA 3D4AA 1RMSA 3BIRA 1UCLA 1LNIA 3DH2A 1RCKA 1BSCA 1I8VA 1JBSA 2AADA 1GOYA 1B2XA 1X1UA 1FUSA 1C54A 6RNTA 3BU4A 3D5IA 4BIRA 1BNGA 1MGRA 1RDSA 1GMRA 2RBIA 1RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGN A;  1YVS A;  1YNV X;  6GSP A;  1LRA A;  3KCH A;  1B27 A;  1RTU A;  1RSN A;  1BSB A;  1GMP A;  1B2U A;  1B21 A;  1BNJ A;  1BNS A;  3DGY A;  1HZ1 A;  2RNT A;  3GSP A;  2BU4 A;  1RGL A;  1UCK A;  1T2H A;  1X1Y A;  2GSP A;  1RGA A;  1PY3 A;  1BAN A;  3A5E A;  1FYS A;  1BIR A;  2HOH A;  1BVI A;  7GSP A;  1BNF A;  2F4Y A;  1I0V A;  1RGF A;  1RN1 A;  1UCI A;  1CH0 A;  2AAE A;  4HOH A;  2F5W A;  4GSP A;  5BU4 A;  3WR2 A;  1GOU A;  1BU4 A;  5BIR A;  1BRG A;  1BRI A;  2KF6 A;  2KAA A;  9RNT A;  3WHO A;  3AGO A;  1RCL A;  1BNR A;  1RN4 A;  1TTO A;  1HYF A;  1R4Y A;  1BRK A;  7RNT A;  4BU4 A;  1ZGX A;  1I0X A;  2KF3 A;  1BRJ A;  1BSE A;  4GHO A;  1FZU A;  1FUT A;  1DE3 A;  1RGG A;  1FW7 A;  1X1W A;  8RNT A;  4J5G A;  1B20 A;  1I3I A;  1DET A;  1AY7 A;  1BAO A;  4RNT A;  1I2E A;  1BNE A;  3RNT A;  1PYL A;  1TRQ A;  1RGC A;  2ZA4 A;  1AQZ A;  1B3S A;  1YGW A;  1B2Z A;  1BRH A;  3SYU A;  1LOV A;  1I70 A;  1B2M A;  1T2I A;  2KF5 A;  1RGE A;  1GSP A;  3Q3F A;  3URP A;  2KF4 A;  1BSD A;  2SAR A;  3HOH A;  1MGW A;  1RGK A;  4HAA A;  1GOV A;  1TRP A;  2F56 A;  1BNI A;  5HOH A;  1RNB A;  1BGS A;  2F5M A;  1RLS A;  2BIR A;  1RGH A;  1LOW A;  1Q9E A;  1BSA A;  1B2S A;  1UCJ A;  4J5K A;  1GMQ A;  1SAR A;  3AHS A;  1BRN L;  3AHW A;  5RNT A;  1I2F A;  1I3F A;  2C4B A;  1X1X A;  1BRS A;  1I2G A;  1RHL A;  1G02 A;  1IYY A;  1LOY A;  1BUJ A;  1BOX A;  1JBT A;  5GSP A;  1A2P A;  3D5G A;  1JBR A;  3D4A A;  1RMS A;  3BIR A;  1UCL A;  1LNI A;  3DH2 A;  1RCK A;  1BSC A;  1I8V A;  1JBS A;  2AAD A;  1GOY A;  1B2X A;  1X1U A;  1FUS A;  1C54 A;  6RNT A;  3BU4 A;  3D5I A;  4BIR A;  1BNG A;  1MGR A;  1RDS A;  1GMR A;  2RBI A;  1RNT A; 
#chains in the Genus database with same CATH topology
 3WMD A;  4HM1 B;  4TX4 A;  4U13 A;  1Q40 B;  1OF5 B;  1W00 A;  3VF1 A;  1W6Y A;  4HM7 B;  4XDW A;  1UUG B;  2UGI A;  3KCH A;  2GEX A;  3G4S 3;  1RTU A;  3EBY A;  4RBN A;  4HM0 B;  5AYS C;  1GMP A;  4LMI A;  3S5C A;  3EC9 A;  2CWU A;  3DGY A;  1HZ1 A;  3GSP A;  4H3U A;  1ZO2 A;  2H0H A;  3S28 A;  3UL5 A;  2QEX 3;  1AR0 A;  1VQK 3;  2CFK A;  1T2H A;  4HBR A;  1X1Y A;  2GSP A;  1OGZ A;  1RGA A;  3K63 A;  2P0M A;  5DRE A;  1BVI A;  3EBT A;  3EF8 A;  1YJ9 3;  5CK6 A;  1K28 A;  3X3Y A;  1RGF A;  1UCI A;  1CH0 A;  1N9J A;  4N6L A;  2AAE A;  4HOH A;  5D81 A;  5IEP A;  1VQQ A;  3IJE B;  3LYG A;  2KCD A;  1RRH A;  4GSP A;  1GOU A;  3D9R A;  4KZ1 A;  5EEO A;  5AEU B;  2KF6 A;  1Y4K A;  3NV0 A;  2ZDJ A;  4JRF A;  3QRD A;  4OVM A;  4CCV A;  1BNR A;  1O7M B;  1RN4 A;  2WOH A;  1OHO A;  1KSI A;  1EKM A;  3F9S A;  3WA3 A;  1ISK A;  1ULJ B;  1RKY A;  2CC3 A;  2Q07 A;  4ILF A;  1AVL A;  3G0K A;  4HM2 B;  3ZG5 A;  1VQL 3;  1A2K A;  2Z7A A;  1KWI A;  3B8L A;  1OPY A;  3FH1 A;  5IG0 A;  1UI7 A;  1N8Q A;  4J5G A;  2CFL A;  2MC8 A;  4NRE A;  1I2E A;  1BNE A;  2W56 B;  1G96 A;  3H3H A;  4JF8 A;  3FSD A;  4RZM A;  4CPK A;  1FA3 A;  1OH0 A;  4J8T A;  1AQZ A;  4N3V A;  5AII A;  1CQS A;  1NO3 A;  1SPU A;  1W02 A;  5A0O B;  1DMM A;  1Q42 A;  1V57 A;  5JBS A;  3CXC 2;  2BMR B;  1LOV A;  1B2M A;  5ELU A;  3MG3 A;  1GSP A;  3X41 A;  3HOH A;  3NXJ A;  1O7P B;  4HAA A;  4N6U A;  2I9W A;  3UB1 A;  1GOV A;  3S67 A;  3I56 3;  2W2C A;  1YIJ 3;  2RSX A;  2LQV A;  1TRP A;  2MF7 A;  1LQM B;  3CCJ 3;  3U1W A;  4NHF A;  1FGQ A;  1ULI B;  2F5M A;  3BNB A;  3MG1 A;  3OWY A;  2BIR A;  4K1V A;  2IUJ A;  4BTY A;  1LOW A;  5M19 A;  3FG3 A;  1BSA A;  3DM8 A;  4QWT A;  4N6M A;  4FCM A;  3WOE B;  1EQK A;  1UCJ A;  1RN7 A;  1JB2 A;  4J5K A;  3VSY A;  5CLK A;  1STD A;  3OXA A;  3AHS A;  4X2O A;  1BRN L;  3STD A;  1OHS A;  1TU5 A;  2C4B A;  1AV4 A;  3CME 3;  1IVW A;  1HU9 A;  2XGL A;  3ZG0 A;  1BOX A;  1EG9 B;  1V74 A;  1Q82 4;  1QVG 2;  3KN4 A;  4BTX A;  1QJG A;  3CC2 3;  5KP3 A;  1DVD A;  3LT9 A;  1T5Y A;  1LNI A;  3IPT A;  3CNX A;  2STD A;  1IVX A;  5EQL A;  1VQ9 3;  2AAD A;  3OX9 A;  2W9Q A;  2C10 A;  3WDG B;  1GOY A;  3CCM 3;  1JB5 A;  1OGX A;  1FUS A;  3LTB A;  4HZB B;  1FGO A;  1SII A;  3V98 A;  5KP1 A;  3BU4 A;  2Y73 A;  2W6J H;  4MMZ B;  3D5I A;  1LOX A;  3NX0 A;  1BNG A;  2W56 A;  3SXX A;  1D6Z A;  2CFD A;  2RBI A;  3MHE A;  5JPU A;  1RNT A;  3CC7 3;  3F8H A;  1MWR A;  5CF2 A;  4XBT A;  1YNV X;  4MMY B;  3LXU X;  3ZFZ A;  1LVN A;  1B27 A;  2CG0 A;  3FZW A;  2W0Q A;  3OWS A;  2KXG A;  5AEW B;  1BSB A;  1JRQ A;  1B2U A;  1W2Z A;  3GZY B;  1JN5 B;  1BNJ A;  4K90 B;  4R80 A;  2D42 A;  2RNT A;  3DY5 A;  3EX9 A;  1RGL A;  1UCK A;  2CK3 H;  3KE7 A;  1FUW A;  3CNM A;  1IQY A;  5FW5 A;  3LTC A;  1BAN A;  2HOH A;  1BIR A;  1TJD A;  1JV2 B;  2JDI H;  4ZM8 A;  1BNF A;  7GSP A;  2P38 A;  3B7C A;  1N5P A;  1RN1 A;  4HM6 B;  3TDG A;  3SED A;  1U5O A;  1DMQ A;  2F5W A;  1VQM 3;  2K54 A;  5BU4 A;  5IG5 A;  4K61 A;  1BU4 A;  4HVN A;  1ZX2 A;  1BRI A;  1V58 A;  2R41 A;  3I0Y A;  1W7C A;  2CG1 A;  1RCL A;  1HYF A;  3EN8 A;  1BRK A;  3HI7 A;  3DGO A;  1UGI A;  1IVV A;  1L5G B;  1NDO B;  2KF3 A;  2BNG A;  2FNQ A;  2Z76 A;  3H51 A;  1IT8 A;  1BSE A;  3GWR A;  3HII A;  4K1U A;  2BO9 B;  4IIA A;  1N5H A;  3HX8 A;  4GHO A;  5DRV A;  3V99 A;  5IW9 A;  1DVC A;  1JKG B;  2PNC A;  1GY7 A;  4XM4 A;  1DE3 A;  1W6G A;  2BHM A;  2CHC A;  1X1W A;  3DXO A;  2KRT A;  3ROB A;  1Q81 4;  3G8Z A;  1T3B A;  3FCS B;  3DGN A;  3FG4 A;  1PYL A;  2ZA4 A;  3L0R A;  3UJM A;  1B3S A;  1GYB A;  3LTA A;  3NBB A;  3WA2 X;  2ZHX B;  5AI1 A;  1VQN 3;  1BUQ A;  4R1K A;  1F8N A;  2E2T A;  5G2G A;  4IT7 A;  2K3D A;  1W5Z A;  3PXM A;  6STD A;  1VQP 3;  3SYU A;  2GBX B;  1VQ4 3;  1AVK A;  2CX0 A;  1WNH A;  1T2I A;  4FMB A;  1RGE A;  3URP A;  2QIY A;  2SAR A;  1RGK A;  2CH9 A;  3SVA A;  2K0M A;  5BXQ A;  4LEH A;  3J7Y d;  3MPH A;  1JJ2 2;  1YIT 3;  1Q86 4;  5HOH A;  1K73 4;  3CPO A;  1RRL A;  3N8B A;  3T8U A;  1KC8 4;  2XFT A;  2GBW B;  2O3O A;  1JB4 A;  3CCU 3;  1Q9E A;  2P05 A;  3RDE A;  3OWU A;  2HMN B;  2OCT A;  4N6O B;  1B2S A;  4FMA A;  1TUH A;  4CDL A;  4HZ9 B;  1SAR A;  3GZR A;  1IQX A;  2LYX A;  1O7W B;  1Q7Y 4;  1TFO A;  4WYK A;  5RNT A;  1I2F A;  1I3F A;  1NNV A;  2M7O A;  2XGN A;  1NB3 I;  1IQ8 A;  1X1X A;  1BRS A;  4L7K A;  4MJD A;  1IYY A;  1Q40 A;  1OF5 A;  1MWT A;  1LOY A;  3JUQ A;  5STD A;  1PU4 A;  2Z6B A;  1IVU A;  2ZL8 A;  1QAL A;  2IMJ A;  3LH4 A;  3PGB A;  5IER A;  4HM3 B;  2C11 A;  2YFI B;  2XH9 A;  1JBR A;  4L8O A;  1RMS A;  4FR9 A;  1YHQ 3;  3PYJ A;  1S72 3;  1N9E A;  1I8V A;  2WGQ A;  4CJN A;  3LTD A;  1O7G B;  4G1M B;  1YJN 3;  4EBG A;  2WOF A;  2YFL B;  1W4N A;  3EQQ B;  4L8P A;  4WP5 A;  1JKG A;  3F7S A;  3EHC A;  3B4O A;  4HYZ A;  1E97 A;  1MNL A;  1RJO A;  1MWU A;  1UUW B;  6RNT A;  5IG4 A;  5IF6 A;  2R4I A;  1Q7H A;  1RDS A;  1GMR A;  2F86 B;  1MOL A;  3MSO A;  3BLZ A;  5FGO A;  3AGN A;  3NM2 A;  3ER7 A;  3K0Z A;  3B4P A;  4FMC A;  3E99 A;  3CC4 3;  2HMK B;  4O8S A;  5AIF A;  3O8Y A;  1RSN A;  5D82 A;  4PEJ A;  3Q1C A;  2F98 A;  1U8C B;  3FLJ A;  3LT8 A;  1B21 A;  4DKI A;  1UW1 A;  4MMX B;  2SBL A;  2OWP A;  3N54 B;  2CW9 A;  4KFE A;  2V1L A;  1QAK A;  5BVB A;  2Y74 A;  2CIU A;  1WTH A;  4FMD A;  4AKY A;  4WHA A;  1NU3 A;  4XDV A;  5AYR B;  1PY3 A;  1Z1S A;  3UL6 A;  4HJL B;  3JUN A;  1IV9 A;  1LNH A;  1O7H B;  3WR2 A;  1A90 A;  2IA7 A;  4I5Q A;  2YFJ B;  1EUI C;  1BRG A;  5IEN A;  4O3V A;  3FKA A;  2OTL 3;  1FGR A;  1WQL B;  2KAA A;  5AIH A;  9RNT A;  2D1W A;  3AGO A;  3NBR A;  1C7H A;  1OCV A;  3KZT A;  1VQ7 3;  4O2H A;  1ZS7 A;  1LQG C;  1R4Y A;  1IT7 A;  2RCD A;  2W9P A;  2QGU A;  2E2U A;  4BU4 A;  1ZGX A;  5M18 A;  2OTJ 3;  5CF1 A;  2RFR A;  1GD4 A;  1K9M 4;  4HM8 B;  3G6E 3;  3SX1 A;  1FZU A;  1FUT A;  1FGT A;  3NQZ A;  2UUG C;  3DUK A;  1JNQ A;  4R9L A;  1FW7 A;  4O02 B;  1PFP A;  4GL6 A;  4J9A A;  3MG2 A;  1B20 A;  1YGE A;  2JQ5 A;  1DET A;  4N6T A;  3U97 A;  1BAO A;  1LXE A;  3AMO B;  3D79 A;  3KFQ C;  3RNT A;  3X3X A;  1E3V A;  2IYJ A;  3NHX A;  4OUQ A;  1GD3 A;  1M1K 4;  3MWZ A;  2GU3 A;  3HIG A;  3F40 A;  2Z77 A;  1CYU A;  1B2Z A;  1K8A 4;  8CHO A;  1VQ6 3;  3DZL A;  1VQ8 3;  1I70 A;  3DGM A;  1W6C A;  3JUM A;  3Q3F A;  5HGR A;  4BL2 A;  4WWU C;  2P09 A;  2GU1 A;  1ASK A;  1EEJ A;  3N9H A;  4EV2 A;  2F56 A;  3NM7 A;  4H61 A;  3JUO A;  3K7C A;  1JZD A;  1W01 A;  4RNZ A;  4EW5 A;  2H0G A;  1BGS A;  1NB5 I;  1RNB A;  1RLS A;  1OUN A;  2F99 A;  3BNE A;  2B24 B;  3CCQ 3;  1WMO A;  1GY6 A;  4BL3 A;  3CCE 3;  1NJI 4;  1MWS A;  1GMQ A;  3M8C A;  1G0T A;  3CMA 3;  2WGO A;  3AHW A;  2IUK A;  1VZZ A;  4LSO A;  1GY5 A;  2RGQ A;  5G1L A;  1YVB I;  1R4C A;  2HML B;  3Q2P A;  3ALA A;  1VQ5 3;  3EB8 A;  2HMO B;  1WMP A;  3GRD A;  3GAX A;  5I97 A;  1A2P A;  1TFK A;  3D5G A;  3F8X A;  3K9M C;  4BTW A;  3BIR A;  7STD A;  3K5T A;  2OOV C;  1JN5 A;  1CEW I;  1OAC A;  3FGY A;  1CYV A;  1RCK A;  1TP6 A;  1OHP A;  1JBS A;  3CCS 3;  4ORL A;  4HKV B;  1B2X A;  2UX0 A;  5M1A A;  3KSE D;  3CCV 3;  4GB5 A;  2E2V A;  2XFS A;  2YX9 A;  4AKZ A;  3AMO A;  5IG3 A;  1UUV B;  1E3R A;  2QA4 3;  3BB9 A;  2BMO B;  3X40 A;  4XB5 A;  3CD6 3;  4LGQ A;  4LZI A;  1YVS A;  3FF0 A;  3PCR A;  2IY2 A;  4KFD A;  1QMA A;  6GSP A;  1LRA A;  1SQW A;  3JUP A;  5LC7 A;  4EV5 A;  3T0U A;  4X2H A;  1UGH I;  2O9U X;  1BNS A;  3G71 3;  4AEQ A;  5IEO A;  2BU4 A;  2W03 A;  3WOD G;  4R9K A;  3PZW A;  5ELJ A;  1SIH A;  3NUV A;  5JPP A;  3A5E A;  1FYS A;  3LML A;  2GEY A;  2F4Y A;  2W04 A;  1ROA A;  1I0V A;  5G1K A;  1STF I;  2HMJ B;  2OQE C;  2H0I A;  4LYL B;  1EA2 A;  2CKF B;  3F7X A;  5CXO A;  1M90 4;  3MKI A;  3WOF B;  4RNY A;  5BIR A;  3A76 A;  4WFO A;  3SOY A;  3WHO A;  3GZB A;  1HKX A;  3GZX B;  4HM5 B;  1NWW A;  1DYU A;  1TTO A;  2GXF A;  4IPB A;  4XBX A;  3DGL A;  3X3Z A;  7RNT A;  1M9G A;  4NPB A;  3BND A;  5TGN A;  1I0X A;  1GS3 A;  1D6U A;  1BRJ A;  3CPW 2;  1KD1 4;  1IV7 A;  2XSO B;  2BMQ B;  3BNC A;  1RGG A;  1IU7 A;  2FXT A;  3SLU A;  3EE1 A;  4EYC A;  3SOA A;  4R4K A;  4EXR A;  4OK0 A;  8RNT A;  1I3I A;  1AY7 A;  3JVC A;  4RNT A;  2ML5 A;  1UI8 A;  1UDI I;  1ROV A;  2B1X B;  3FF2 A;  4KT3 B;  1S5A A;  3RGR A;  1TRQ A;  1RGC A;  3X42 A;  1YI2 3;  2A15 A;  2CWT A;  2XF3 A;  3IMA B;  5EVH A;  1W2B 2;  1YGW A;  2INX A;  3MYT A;  3CCR 3;  1BRH A;  3OV4 A;  5AIG A;  2L1S A;  2KF5 A;  2OOV A;  4EC6 A;  3KKG A;  3S29 A;  1JZO A;  1TIJ A;  2KF4 A;  1BSD A;  1D6Y A;  1MGW A;  2CWV A;  2L4V A;  3G16 A;  3NQY A;  1J2B A;  3UNL A;  1WMN A;  3NBJ A;  3LOY A;  4HM4 B;  1BNI A;  4I4K A;  2XRX B;  2FGT A;  4N6N B;  3HK4 A;  1QVF 2;  3EN1 B;  1A67 A;  3HZP A;  1RGH A;  2XR8 B;  3PS8 A;  3S27 A;  2J8X B;  2XEP A;  1O7N B;  2WO0 A;  1IK3 A;  3ECF A;  1YJW 3;  2P0X A;  1QAF A;  3NV0 B;  4FCJ A;  5D83 A;  5KP4 A;  1I2G A;  1RHL A;  1G02 A;  3RGA A;  1FGM A;  3I55 3;  4XBY A;  3CCL 3;  4KFF A;  1VQO 3;  2PZV A;  1N8R 4;  1KQS 2;  1BUJ A;  1SJW A;  2CFW A;  3V92 A;  5GSP A;  1JBT A;  3D3L A;  2BT3 A;  3T8N A;  1DMN A;  3QK9 A;  3OW2 2;  5LC6 A;  3D4A A;  1K41 A;  1UCL A;  3LZA A;  3FG1 A;  4MEI A;  3VGN A;  3DH2 A;  2ML6 A;  2OQE A;  1BSC A;  2CX1 A;  4KVH A;  1US1 A;  4N6V 0;  1IDP A;  3Q90 A;  1X1U A;  3CU3 A;  4STD A;  3F14 A;  3KII A;  3EJV A;  2XSH B;  4FCZ A;  1C54 A;  3KSP A;  4BIR A;  2CFG A;  2HMM B;  4Q53 A;  1MGR A;  4WYK B;  3PCS A;  1M1X B;  1A2V A;  3DMC A; 
#chains in the Genus database with same CATH homology
 3AGN A;  1YVS A;  1YNV X;  6GSP A;  1LRA A;  3KCH A;  1B27 A;  1RTU A;  1RSN A;  1BSB A;  1GMP A;  1B2U A;  1B21 A;  1BNJ A;  1BNS A;  3DGY A;  1HZ1 A;  2RNT A;  3GSP A;  2BU4 A;  1RGL A;  1UCK A;  1T2H A;  1X1Y A;  2GSP A;  1RGA A;  1PY3 A;  1BAN A;  3A5E A;  1FYS A;  1BIR A;  2HOH A;  1BVI A;  7GSP A;  1BNF A;  2F4Y A;  1I0V A;  1RGF A;  1RN1 A;  1UCI A;  1CH0 A;  2AAE A;  4HOH A;  2F5W A;  4GSP A;  5BU4 A;  3WR2 A;  1GOU A;  1BU4 A;  5BIR A;  1BRG A;  1BRI A;  2KF6 A;  2KAA A;  9RNT A;  3WHO A;  3AGO A;  1RCL A;  1BNR A;  1RN4 A;  1TTO A;  1HYF A;  1R4Y A;  1BRK A;  7RNT A;  4BU4 A;  1ZGX A;  1I0X A;  2KF3 A;  1BRJ A;  1BSE A;  4GHO A;  1FZU A;  1FUT A;  1DE3 A;  1RGG A;  1FW7 A;  1X1W A;  8RNT A;  4J5G A;  1B20 A;  1I3I A;  1DET A;  1AY7 A;  1BAO A;  4RNT A;  1I2E A;  1BNE A;  3RNT A;  1PYL A;  1TRQ A;  1RGC A;  2ZA4 A;  1AQZ A;  1B3S A;  1YGW A;  1B2Z A;  1BRH A;  3SYU A;  1LOV A;  1I70 A;  1B2M A;  1T2I A;  2KF5 A;  1RGE A;  1GSP A;  3Q3F A;  3URP A;  2KF4 A;  1BSD A;  2SAR A;  3HOH A;  1MGW A;  1RGK A;  4HAA A;  1GOV A;  1TRP A;  2F56 A;  1BNI A;  5HOH A;  1RNB A;  1BGS A;  2F5M A;  1RLS A;  2BIR A;  1RGH A;  1LOW A;  1Q9E A;  1BSA A;  1B2S A;  1UCJ A;  4J5K A;  1GMQ A;  1SAR A;  3AHS A;  1BRN L;  3AHW A;  5RNT A;  1I2F A;  1I3F A;  2C4B A;  1X1X A;  1BRS A;  1I2G A;  1RHL A;  1G02 A;  1IYY A;  1LOY A;  1BUJ A;  1BOX A;  1JBT A;  5GSP A;  1A2P A;  3D5G A;  1JBR A;  3D4A A;  1RMS A;  3BIR A;  1UCL A;  1LNI A;  3DH2 A;  1RCK A;  1BSC A;  1I8V A;  1JBS A;  2AAD A;  1GOY A;  1B2X A;  1X1U A;  1FUS A;  1C54 A;  6RNT A;  3BU4 A;  3D5I A;  4BIR A;  1BNG A;  1MGR A;  1RDS A;  1GMR A;  2RBI A;  1RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...