2AAEA

The role of histidine-40 in ribonuclease t1 catalysis: three-dimensional structures of the partially active his40lys mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPKKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of histidine-40 in ribonuclease T1 catalysis: three-dimensionalstructures of the partially active His40Lys mutant.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
total genus 25
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2aaeA00
1LRAA 3BU4A 2SARA 1UCIA 2GSPA 1RN1A 5BU4A 1BGSA 1B3SA 1R4YA 1UCJA 3SYUA 1FUTA 2BU4A 1I2GA 4GSPA 4J5GA 1RHLA 1JBTA 1SARA 1FW7A 1BNIA 1JBSA 1RMSA 1BUJA 1BRKA 1BSDA 1BNRA 2KF6A 1BSBA 1I3FA 1GMPA 2AADA 2F56A 3AHWA 1B27A 1I3IA 1RGCA 1X1UA 1RTUA 1BRGA 4RNTA 3D5IA 1ZGXA 1B2XA 1BRSA 1JBRA 3WR2A 1BANA 4HOHA 1GOYA 8RNTA 1I2EA 1PY3A 2RBIA 1B2MA 2KF4A 1RGHA 1BNGA 1B2SA 4BU4A 1TTOA 1RDSA 1BRIA 3BIRA 1RGFA 1YNVX 2RNTA 1RNBA 1BNJA 1I8VA 5BIRA 1IYYA 1LOVA 1YVSA 3Q3FA 5GSPA 2F5MA 1BIRA 1X1YA 2ZA4A 1GMRA 1GOVA 1RGGA 1BRNL 1RN4A 1BVIA 1BNFA 1RGLA 3RNTA 1RGKA 3WHOA 1X1WA 1B21A 2HOHA 1RCKA 1YGWA 3D5GA 1T2HA 1Q9EA 1RGAA 1FZUA 1GSPA 1C54A 3HOHA 1I0XA 2KF3A 1UCKA 1MGWA 6GSPA 2KF5A 5HOHA 4HAAA 4J5KA 1BNEA 1FYSA 6RNTA 1LOYA 1B2ZA 1BRHA 1LOWA 1T2IA 2AAEA 2F5WA 7GSPA 5RNTA 1A2PA 3DGYA 4BIRA 1RCLA 4GHOA 1B20A 1FUSA 1BAOA 1RNTA 3AGOA 1AQZA 3KCHA 1LNIA 1TRQA 1AY7A 1HYFA 7RNTA 3AHSA 1RSNA 3A5EA 9RNTA 2KAAA 1PYLA 1I70A 3AGNA 1MGRA 1BNSA 1BRJA 2C4BA 1X1XA 1BSAA 3D4AA 1I0VA 1DETA 1BU4A 1G02A 1GMQA 2F4YA 1DE3A 1B2UA 3GSPA 1GOUA 1UCLA 1RGEA 3URPA 3DH2A 1BSCA 1I2FA 1HZ1A 1TRPA 1RLSA 1BOXA 1BSEA 1CH0A 2BIRA
chains in the Genus database with same CATH superfamily
3G8ZA 2SARA 5BU4A 2GSPA 1RN1A 2WGQA 4K1VA 1BGSA 1R4YA 1UCJA 2RFRA 1O7NB 3ECFA 3GRDA 2CFKA 4NPBA 4MMXB 3X3ZA 1Z1SA 3SLUA 3RDEA 4IT7A 3FG1A 4ORLA 3ZG0A 1QVG2 1E97A 1KQS2 4XB5A 1JBSA 1G96A 3WDGB 1NJI4 3HK4A 1BNRA 3X41A 3MYTA 1NWWA 3NV0B 2MC8A 1EQKA 5M18A 3OWSA 1OCVA 3OXAA 4HKVB 5IEPA 5IW9A 3PZWA 4EBGA 2C11A 1RRHA 2BT3A 3JUNA 4KVHA 3A76A 5KP3A 2WO0A 1RGCA 3UNLA 2HMLB 1UUWB 3EBTA 4RNTA 4L8PA 3T8UA 2LQVA 2W04A 2PZVA 1N5HA 1YJN3 2D1WA 4NREA 4IPBA 1WMNA 1N5PA 1BRSA 3MPHA 1VQ53 2XH9A 4HOHA 4RNZA 1WQLB 3RGRA 3CPOA 1PY3A 2RBIA 2XGNA 1MWTA 1OHPA 2KF4A 4J8TA 3S5CA 1B2MA 1YVBI 3N8BA 1TTOA 1IDPA 1RDSA 3GZYB 1OGXA 2IA7A 2FGTA 3EQQB 1Q40B 1W02A 4HZ9B 3CCV3 3FH1A 3FKAA 4MMYB 3OWUA 4KFFA 4XDWA 1RNBA 1U8CB 2CC3A 1IYYA 4EXRA 4LSOA 1CYUA 1LOVA 3FGYA 4FMAA 3EBYA 2F5MA 1OUNA 1YJW3 2ZA4A 1FGQA 1GMRA 2WOHA 1RGGA 1BRNL 2HMJB 1UUVB 1RGKA 3WHOA 2OCTA 2K54A 1HKXA 5G1LA 4CCVA 4HM6B 6STDA 3LT8A 5CXOA 1RCKA 1YGWA 3LTCA 5JPUA 3FF2A 1T2HA 3ROBA 3G4S3 1Q9EA 1RGAA 5A0OB 1FZUA 4FCMA 4RBNA 5HGRA 1V57A 3CCL3 4X2OA 1C54A 4CPKA 1TIJA 2KF3A 5BVBA 3HX8A 3D3LA 3MSOA 3VF1A 1DVCA 1ZS7A 3D79A 3IPTA 1T3BA 4J5KA 1IQYA 1GY5A 3MWZA 1VQQA 3X3YA 4AEQA 5IENA 2OOVA 1SIHA 2JQ5A 3PGBA 3CPW2 3OW22 4BIRA 2SBLA 4KFDA 3CCU3 4IIAA 3KN4A 1RNTA 1O7MB 3KIIA 1LNHA 3NXJA 4ILFA 1HYFA 3WMDA 3BLZA 1LQMB 2XFSA 1RSNA 3AHSA 3A5EA 3AMOA 2I9WA 5CLKA 2HMMB 9RNTA 3WODG 1BNSA 3FCSB 2OTL3 2XSHB 4HM4B 5JBSA 1S5AA 4LMIA 3AMOB 5IEOA 1DMNA 1OHOA 1E3RA 4O3VA 1EKMA 4OK0A 5AYSC 1AVKA 1G02A 1GMQA 1E3VA 3MKIA 4HM7B 1FGRA 1OACA 1RRLA 1WNHA 1BUQA 2R4IA 3FG3A 1BSCA 2CFLA 1HZ1A 3EC9A 1OHSA 3GAXA 5AEUB 3EN8A 1IT8A 1CH0A 2BIRA 1LRAA 5IG0A 1VQK3 1UCIA 1K28A 3EN1B 4N6NB 3LZAA 1OGZA 3TDGA 2CX0A 4N3VA 3S27A 1Q7Y4 1MNLA 1JB4A 2E2TA 1NO3A 3SYUA 2H0IA 1VQ73 3T8NA 4J5GA 4KT3B 1SARA 2BMQB 2RCDA 2W56B 2Z76A 1BNIA 5AIIA 3JUQA 2JDIH 3BB9A 1GY7A 1Y4KA 1ISKA 1IQXA 1N8R4 1BSDA 5FGOA 8CHOA 1Q864 1G0TA 1O7GB 2KCDA 2HMNB 2CFGA 1KSIA 5M19A 1JN5B 1I3FA 3KE7A 1GMPA 4HZBB 5IERA 2F56A 3AHWA 4AKYA 3HIGA 3PCSA 1UGHI 1JJ22 5BXQA 4LZIA 3I0YA 3SEDA 3WOEB 1OH0A 3D5IA 1ZGXA 3NBRA 5IG4A 4K90B 2GXFA 3LXUX 1W4NA 1A2VA 4N6OB 1BANA 1D6ZA 4HM5B 3ER7A 1HU9A 2RSXA 1LOXA 4XM4A 1RGHA 1BNGA 5AIGA 1K734 3DGOA 2XEPA 3DXOA 4I4KA 4EC6A 7STDA 3MG1A 1KC84 1VQO3 2Z77A 1V58A 1OF5A 1W5ZA 2INXA 2RNTA 3IMAB 3X40A 3I553 1BNJA 5BIRA 4RNYA 3WA3A 3QK9A 5GSPA 4BTYA 1VQL3 1BIRA 3KKGA 1WMPA 1YI23 3LTBA 4MJDA 3DUKA 3NV0A 1IV9A 1EA2A 2HMOB 3RNTA 2RGQA 2QIYA 1GD3A 1QJGA 1UUGB 4FMBA 1TFKA 1IT7A 2CKFB 1DMMA 5JPPA 2ML5A 5DRVA 2O3OA 5D82A 4HM3B 3F7SA 1RN7A 5IG3A 4TX4A 3NBBA 2CG0A 1IU7A 4L7KA 1US1A 1EUIC 3EE1A 1W2ZA 6GSPA 2LYXA 3NM7A 3VGNA 1FYSA 1FA3A 2IY2A 4EW5A 1LOYA 2UX0A 1T2IA 4WWUC 4LGQA 1FGTA 5RNTA 3F9SA 1CQSA 4LYLB 3DGYA 1K41A 3NQZA 4XBXA 1RCLA 2F98A 2PNCA 2WGOA 1NDOB 4K1UA 3PYJA 1BAOA 3B4OA 1LQGC 1AQZA 1Q40A 4BL2A 7RNTA 4HJLB 5CF2A 3RGAA 3HIIA 3UJMA 1QMAA 1DYUA 1OF5B 2L4VA 5ELJA 5IG5A 1J2BA 2W03A 1A90A 3OX9A 2XSOB 1ULIB 3SOAA 1RKYA 1DVDA 1BRJA 2C4BA 3L0RA 1X1XA 1GYBA 4Q53A 3O8YA 1ULJB 1BSAA 3JUPA 1UW1A 1QVF2 1AR0A 3DM8A 3D4AA 3CCM3 1NU3A 2F4YA 1BU4A 3Q1CA 1B2UA 3FLJA 3CNMA 2CK3H 1GOUA 2UGIA 1RGEA 3KFQC 3DH2A 1Q42A 1I2FA 2H0GA 1JNQA 1JKGB 2W0QA 1TRPA 1CYVA 1RLSA 3QRDA 3IJEB 1BSEA 3EF8A 3BU4A 3FSDA 5CK6A 4R4KA 5EVHA 3KSED 3DMCA 2A15A 4WP5A 2Y74A 2GEXA 4XBTA 2CFWA 2V1LA 3N9HA 3Q2PA 4R1KA 3CXC2 4K61A 3JVCA 4O2HA 2CWVA 1FUTA 2BU4A 1NNVA 4KZ1A 1JBTA 1S723 2W56A 1MWUA 3CD63 3BNBA 1RMSA 1BUJA 2BO9B 2KXGA 2ZDJA 2CFDA 4FMCA 5D83A 4MEIA 1IK3A 1PU4A 2ML6A 4N6UA 5M1AA 2KF6A 1BSBA 3CCE3 1JZOA 2AADA 3D9RA 1VZZA 1W6GA 3UB1A 2P09A 2GBXB 1X1UA 1RTUA 1BRGA 1UI7A 3MG2A 3MG3A 2XFTA 4EV2A 1OPYA 1R4CA 3CCQ3 3G713 4HM2B 2BMOB 2IUJA 1B2XA 1AVLA 1JBRA 3DGLA 4OUQA 3GZXB 3NQYA 3LMLA 4WYKA 3Q90A 3EHCA 3S29A 8RNTA 3J7Yd 1I2EA 3V92A 4O8SA 3G6E3 2MF7A 2Z6BA 1UDII 3BIRA 2H0HA 1YNVX 1W00A 2KRTA 1W2B2 4RZMA 4OVMA 1I8VA 4EV5A 3F40A 4U13A 5G1KA 3CU3A 1YVSA 4LEHA 1A2KA 3F8XA 1GS3A 3K9MC 1QALA 5FW5A 3UL6A 2QEX3 3CC23 3CMA3 1ASKA 1IVWA 2CWUA 1JN5A 3EX9A 1M904 1B21A 1TU5A 1D6UA 2HOHA 2C10A 3ALAA 4MMZB 2BMRB 1YJ93 1K9M4 3BNDA 3BNCA 1A67A 1SPUA 4N6V0 2IMJA 5LC7A 2HMKB 2XGLA 3GZRA 2GU1A 1I0XA 3K5TA 2O9UX 1MGWA 2KF5A 3G0KA 2YFLB 3HZPA 2STDA 3FG4A 5HOHA 1KD14 4HAAA 1BNEA 5IF6A 4X2HA 5AI1A 2D42A 1TJDA 1W6CA 2F5WA 7GSPA 2AAEA 3CCS3 4XDVA 5AIFA 1NB5I 1GD4A 3GWRA 5DREA 3SXXA 1VQP3 1FGOA 2CIUA 1EG9B 1O7HB 3CCR3 1K8A4 2YFJB 4AKZA 2OQEA 1STFI 2L1SA 4XBYA 3ZG5A 2CWTA 1FUSA 3G16A 5STDA 2OWPA 4STDA 3JUOA 1W7CA 1MGRA 3X42A 3CC43 1YIT3 2W6JH 1N8QA 4KFEA 1MOLA 1L5GB 3VSYA 1TP6A 1TFOA 4FCJA 4BTWA 3NHXA 3K63A 1O7PB 1I0VA 1AV4A 3FZWA 1DETA 2FNQA 3GSPA 1JRQA 2P0XA 4FCZA 5ELUA 1UI8A 2E2UA 1M9GA 3PCRA 3LTAA 3CC73 3CNXA 4R80A 3B4PA 1ROVA 1BOXA 3B8LA 2UUGC 4HM0B 2Z7AA 5AYRB 3PXMA 3LTDA 3SOYA 4BL3A 4BTXA 2OTJ3 1B3SA 3DGMA 1VQ83 2ZHXB 1I2GA 4GSPA 3DZLA 1RHLA 1RJOA 1JZDA 2YX9A 3X3XA 3S67A 4CDLA 4CJNA 1FW7A 4WFOA 1BRKA 1KWIA 1Q824 1Q7HA 3CCJ3 4N6MA 4DKIA 4I5QA 3S28A 1YGEA 3OV4A 2XR8B 5LC6A 1B27A 1I3IA 2W9PA 3BNEA 1MWSA 3LH4A 1IVVA 3N54B 4HBRA 1ROAA 2GU3A 1YIJ3 2XF3A 1N9EA 2BNGA 2CHCA 1W01A 1STDA 1WTHA 4HM8B 1W6YA 3WR2A 4QWTA 3JUMA 1NB3I 2CW9A 4G1MB 3WOFB 3NBJA 1GOYA 2M7OA 3LOYA 5CF1A 4WYKB 2K3DA 3NM2A 5EEOA 1PFPA 1VQN3 3ZFZA 1B2SA 4BU4A 3NUVA 2W9QA 1BRIA 1VQ63 2Q07A 1QAKA 1RGFA 3NX0A 4N6TA 3UL5A 1M1K4 4PEJA 1LXEA 1O7WB 1SQWA 3DY5A 2F99A 3HI7A 3LT9A 5EQLA 3Q3FA 1MWRA 1X1YA 3KZTA 3F8HA 3CME3 2R41A 1GOVA 3K7CA 1RN4A 1BVIA 1BNFA 2IYJA 1RGLA 4EYCA 1IVUA 2OOVC 1JV2B 2CX1A 1C7HA 1X1WA 1ZX2A 2IUKA 4L8OA 4NHFA 2CH9A 3DGNA 3U97A 3H3HA 2P0MA 2WOFA 3D5GA 4R9LA 1V74A 3GZBA 5AIHA 1LVNA 2FXTA 2Y73A 3K0ZA 3OWYA 4FMDA 1GSPA 1D6YA 4O02B 4HM1B 2QGUA 5D81A 3V98A 1VQ93 3HOHA 1IVXA 2P05A 1UCKA 1TUHA 3I563 1VQ43 1QAFA 2BHMA 3SX1A 1N9JA 4JF8A 2J8XB 1JB5A 6RNTA 3EB8A 3LYGA 3MHEA 1YHQ3 1B2ZA 1BRHA 1JKGA 1LOWA 3F14A 5AEWB 1CEWI 1A2PA 2QA43 3EJVA 3H51A 4R9KA 2E2VA 3F7XA 5TGNA 2GBWB 1F8NA 4GHOA 4GB5A 2XRXB 1B20A 5G2GA 2B24B 2CG1A 2ZL8A 1IQ8A 2W2CA 3AGOA 3KCHA 1LNIA 4JRFA 1TRQA 1AY7A 1SIIA 4HVNA 3T0UA 3M8CA 1JB2A 1VQM3 4J9AA 2KAAA 1PYLA 1IV7A 1UGIA 1I70A 2GEYA 2F86B 3AGNA 2K0MA 3B7CA 3V99A 3SVAA 1SJWA 1FGMA 1GY6A 1T5YA 2YFIB 4WHAA 3U1WA 2P38A 5I97A 1DMQA 4H61A 2OQEC 4ZM8A 1EEJA 1U5OA 5KP4A 3STDA 3E99A 1DE3A 4GL6A 1ZO2A 2B1XB 1Q814 1FUWA 3PS8A 3FF0A 1WMOA 1UCLA 3URPA 5KP1A 3KSPA 4H3UA 3WA2X 1M1XB 4HYZA 4N6LA 4FR9A
chains in the Genus database with same CATH topology
1LRAA 3BU4A 2SARA 1UCIA 2GSPA 1RN1A 5BU4A 1BGSA 1B3SA 1R4YA 1UCJA 3SYUA 1FUTA 2BU4A 1I2GA 4GSPA 4J5GA 1RHLA 1JBTA 1SARA 1FW7A 1BNIA 1JBSA 1RMSA 1BUJA 1BRKA 1BSDA 1BNRA 2KF6A 1BSBA 1I3FA 1GMPA 2AADA 2F56A 3AHWA 1B27A 1I3IA 1RGCA 1X1UA 1RTUA 1BRGA 4RNTA 3D5IA 1ZGXA 1B2XA 1BRSA 1JBRA 3WR2A 1BANA 4HOHA 1GOYA 8RNTA 1I2EA 1PY3A 2RBIA 1B2MA 2KF4A 1RGHA 1BNGA 1B2SA 4BU4A 1TTOA 1RDSA 1BRIA 3BIRA 1RGFA 1YNVX 2RNTA 1RNBA 1BNJA 1I8VA 5BIRA 1IYYA 1LOVA 1YVSA 3Q3FA 5GSPA 2F5MA 1BIRA 1X1YA 2ZA4A 1GMRA 1GOVA 1RGGA 1BRNL 1RN4A 1BVIA 1BNFA 1RGLA 3RNTA 1RGKA 3WHOA 1X1WA 1B21A 2HOHA 1RCKA 1YGWA 3D5GA 1T2HA 1Q9EA 1RGAA 1FZUA 1GSPA 1C54A 3HOHA 1I0XA 2KF3A 1UCKA 1MGWA 6GSPA 2KF5A 5HOHA 4HAAA 4J5KA 1BNEA 1FYSA 6RNTA 1LOYA 1B2ZA 1BRHA 1LOWA 1T2IA 2AAEA 2F5WA 7GSPA 5RNTA 1A2PA 3DGYA 4BIRA 1RCLA 4GHOA 1B20A 1FUSA 1BAOA 1RNTA 3AGOA 1AQZA 3KCHA 1LNIA 1TRQA 1AY7A 1HYFA 7RNTA 3AHSA 1RSNA 3A5EA 9RNTA 2KAAA 1PYLA 1I70A 3AGNA 1MGRA 1BNSA 1BRJA 2C4BA 1X1XA 1BSAA 3D4AA 1I0VA 1DETA 1BU4A 1G02A 1GMQA 2F4YA 1DE3A 1B2UA 3GSPA 1GOUA 1UCLA 1RGEA 3URPA 3DH2A 1BSCA 1I2FA 1HZ1A 1TRPA 1RLSA 1BOXA 1BSEA 1CH0A 2BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LRA A;  3BU4 A;  2SAR A;  1UCI A;  2GSP A;  1RN1 A;  5BU4 A;  1BGS A;  1B3S A;  1R4Y A;  1UCJ A;  3SYU A;  1FUT A;  2BU4 A;  1I2G A;  4GSP A;  4J5G A;  1RHL A;  1JBT A;  1SAR A;  1FW7 A;  1BNI A;  1JBS A;  1RMS A;  1BUJ A;  1BRK A;  1BSD A;  1BNR A;  2KF6 A;  1BSB A;  1I3F A;  1GMP A;  2AAD A;  2F56 A;  3AHW A;  1B27 A;  1I3I A;  1RGC A;  1X1U A;  1RTU A;  1BRG A;  4RNT A;  3D5I A;  1ZGX A;  1B2X A;  1BRS A;  1JBR A;  3WR2 A;  1BAN A;  4HOH A;  1GOY A;  8RNT A;  1I2E A;  1PY3 A;  2RBI A;  1B2M A;  2KF4 A;  1RGH A;  1BNG A;  1B2S A;  4BU4 A;  1TTO A;  1RDS A;  1BRI A;  3BIR A;  1RGF A;  1YNV X;  2RNT A;  1RNB A;  1BNJ A;  1I8V A;  5BIR A;  1IYY A;  1LOV A;  1YVS A;  3Q3F A;  5GSP A;  2F5M A;  1BIR A;  1X1Y A;  2ZA4 A;  1GMR A;  1GOV A;  1RGG A;  1BRN L;  1RN4 A;  1BVI A;  1BNF A;  1RGL A;  3RNT A;  1RGK A;  3WHO A;  1X1W A;  1B21 A;  2HOH A;  1RCK A;  1YGW A;  3D5G A;  1T2H A;  1Q9E A;  1RGA A;  1FZU A;  1GSP A;  1C54 A;  3HOH A;  1I0X A;  2KF3 A;  1UCK A;  1MGW A;  6GSP A;  2KF5 A;  5HOH A;  4HAA A;  4J5K A;  1BNE A;  1FYS A;  6RNT A;  1LOY A;  1B2Z A;  1BRH A;  1LOW A;  1T2I A;  2AAE A;  2F5W A;  7GSP A;  5RNT A;  1A2P A;  3DGY A;  4BIR A;  1RCL A;  4GHO A;  1B20 A;  1FUS A;  1BAO A;  1RNT A;  3AGO A;  1AQZ A;  3KCH A;  1LNI A;  1TRQ A;  1AY7 A;  1HYF A;  7RNT A;  3AHS A;  1RSN A;  3A5E A;  9RNT A;  2KAA A;  1PYL A;  1I70 A;  3AGN A;  1MGR A;  1BNS A;  1BRJ A;  2C4B A;  1X1X A;  1BSA A;  3D4A A;  1I0V A;  1DET A;  1BU4 A;  1G02 A;  1GMQ A;  2F4Y A;  1DE3 A;  1B2U A;  3GSP A;  1GOU A;  1UCL A;  1RGE A;  3URP A;  3DH2 A;  1BSC A;  1I2F A;  1HZ1 A;  1TRP A;  1RLS A;  1BOX A;  1BSE A;  1CH0 A;  2BIR A; 
#chains in the Genus database with same CATH topology
 3G8Z A;  2SAR A;  5BU4 A;  2GSP A;  1RN1 A;  2WGQ A;  4K1V A;  1BGS A;  1R4Y A;  1UCJ A;  2RFR A;  1O7N B;  3ECF A;  3GRD A;  2CFK A;  4NPB A;  4MMX B;  3X3Z A;  1Z1S A;  3SLU A;  3RDE A;  4IT7 A;  3FG1 A;  4ORL A;  3ZG0 A;  1QVG 2;  1E97 A;  1KQS 2;  4XB5 A;  1JBS A;  1G96 A;  3WDG B;  1NJI 4;  3HK4 A;  1BNR A;  3X41 A;  3MYT A;  1NWW A;  3NV0 B;  2MC8 A;  1EQK A;  5M18 A;  3OWS A;  1OCV A;  3OXA A;  4HKV B;  5IEP A;  5IW9 A;  3PZW A;  4EBG A;  2C11 A;  1RRH A;  2BT3 A;  3JUN A;  4KVH A;  3A76 A;  5KP3 A;  2WO0 A;  1RGC A;  3UNL A;  2HML B;  1UUW B;  3EBT A;  4RNT A;  4L8P A;  3T8U A;  2LQV A;  2W04 A;  2PZV A;  1N5H A;  1YJN 3;  2D1W A;  4NRE A;  4IPB A;  1WMN A;  1N5P A;  1BRS A;  3MPH A;  1VQ5 3;  2XH9 A;  4HOH A;  4RNZ A;  1WQL B;  3RGR A;  3CPO A;  1PY3 A;  2RBI A;  2XGN A;  1MWT A;  1OHP A;  2KF4 A;  4J8T A;  3S5C A;  1B2M A;  1YVB I;  3N8B A;  1TTO A;  1IDP A;  1RDS A;  3GZY B;  1OGX A;  2IA7 A;  2FGT A;  3EQQ B;  1Q40 B;  1W02 A;  4HZ9 B;  3CCV 3;  3FH1 A;  3FKA A;  4MMY B;  3OWU A;  4KFF A;  4XDW A;  1RNB A;  1U8C B;  2CC3 A;  1IYY A;  4EXR A;  4LSO A;  1CYU A;  1LOV A;  3FGY A;  4FMA A;  3EBY A;  2F5M A;  1OUN A;  1YJW 3;  2ZA4 A;  1FGQ A;  1GMR A;  2WOH A;  1RGG A;  1BRN L;  2HMJ B;  1UUV B;  1RGK A;  3WHO A;  2OCT A;  2K54 A;  1HKX A;  5G1L A;  4CCV A;  4HM6 B;  6STD A;  3LT8 A;  5CXO A;  1RCK A;  1YGW A;  3LTC A;  5JPU A;  3FF2 A;  1T2H A;  3ROB A;  3G4S 3;  1Q9E A;  1RGA A;  5A0O B;  1FZU A;  4FCM A;  4RBN A;  5HGR A;  1V57 A;  3CCL 3;  4X2O A;  1C54 A;  4CPK A;  1TIJ A;  2KF3 A;  5BVB A;  3HX8 A;  3D3L A;  3MSO A;  3VF1 A;  1DVC A;  1ZS7 A;  3D79 A;  3IPT A;  1T3B A;  4J5K A;  1IQY A;  1GY5 A;  3MWZ A;  1VQQ A;  3X3Y A;  4AEQ A;  5IEN A;  2OOV A;  1SIH A;  2JQ5 A;  3PGB A;  3CPW 2;  3OW2 2;  4BIR A;  2SBL A;  4KFD A;  3CCU 3;  4IIA A;  3KN4 A;  1RNT A;  1O7M B;  3KII A;  1LNH A;  3NXJ A;  4ILF A;  1HYF A;  3WMD A;  3BLZ A;  1LQM B;  2XFS A;  1RSN A;  3AHS A;  3A5E A;  3AMO A;  2I9W A;  5CLK A;  2HMM B;  9RNT A;  3WOD G;  1BNS A;  3FCS B;  2OTL 3;  2XSH B;  4HM4 B;  5JBS A;  1S5A A;  4LMI A;  3AMO B;  5IEO A;  1DMN A;  1OHO A;  1E3R A;  4O3V A;  1EKM A;  4OK0 A;  5AYS C;  1AVK A;  1G02 A;  1GMQ A;  1E3V A;  3MKI A;  4HM7 B;  1FGR A;  1OAC A;  1RRL A;  1WNH A;  1BUQ A;  2R4I A;  3FG3 A;  1BSC A;  2CFL A;  1HZ1 A;  3EC9 A;  1OHS A;  3GAX A;  5AEU B;  3EN8 A;  1IT8 A;  1CH0 A;  2BIR A;  1LRA A;  5IG0 A;  1VQK 3;  1UCI A;  1K28 A;  3EN1 B;  4N6N B;  3LZA A;  1OGZ A;  3TDG A;  2CX0 A;  4N3V A;  3S27 A;  1Q7Y 4;  1MNL A;  1JB4 A;  2E2T A;  1NO3 A;  3SYU A;  2H0I A;  1VQ7 3;  3T8N A;  4J5G A;  4KT3 B;  1SAR A;  2BMQ B;  2RCD A;  2W56 B;  2Z76 A;  1BNI A;  5AII A;  3JUQ A;  2JDI H;  3BB9 A;  1GY7 A;  1Y4K A;  1ISK A;  1IQX A;  1N8R 4;  1BSD A;  5FGO A;  8CHO A;  1Q86 4;  1G0T A;  1O7G B;  2KCD A;  2HMN B;  2CFG A;  1KSI A;  5M19 A;  1JN5 B;  1I3F A;  3KE7 A;  1GMP A;  4HZB B;  5IER A;  2F56 A;  3AHW A;  4AKY A;  3HIG A;  3PCS A;  1UGH I;  1JJ2 2;  5BXQ A;  4LZI A;  3I0Y A;  3SED A;  3WOE B;  1OH0 A;  3D5I A;  1ZGX A;  3NBR A;  5IG4 A;  4K90 B;  2GXF A;  3LXU X;  1W4N A;  1A2V A;  4N6O B;  1BAN A;  1D6Z A;  4HM5 B;  3ER7 A;  1HU9 A;  2RSX A;  1LOX A;  4XM4 A;  1RGH A;  1BNG A;  5AIG A;  1K73 4;  3DGO A;  2XEP A;  3DXO A;  4I4K A;  4EC6 A;  7STD A;  3MG1 A;  1KC8 4;  1VQO 3;  2Z77 A;  1V58 A;  1OF5 A;  1W5Z A;  2INX A;  2RNT A;  3IMA B;  3X40 A;  3I55 3;  1BNJ A;  5BIR A;  4RNY A;  3WA3 A;  3QK9 A;  5GSP A;  4BTY A;  1VQL 3;  1BIR A;  3KKG A;  1WMP A;  1YI2 3;  3LTB A;  4MJD A;  3DUK A;  3NV0 A;  1IV9 A;  1EA2 A;  2HMO B;  3RNT A;  2RGQ A;  2QIY A;  1GD3 A;  1QJG A;  1UUG B;  4FMB A;  1TFK A;  1IT7 A;  2CKF B;  1DMM A;  5JPP A;  2ML5 A;  5DRV A;  2O3O A;  5D82 A;  4HM3 B;  3F7S A;  1RN7 A;  5IG3 A;  4TX4 A;  3NBB A;  2CG0 A;  1IU7 A;  4L7K A;  1US1 A;  1EUI C;  3EE1 A;  1W2Z A;  6GSP A;  2LYX A;  3NM7 A;  3VGN A;  1FYS A;  1FA3 A;  2IY2 A;  4EW5 A;  1LOY A;  2UX0 A;  1T2I A;  4WWU C;  4LGQ A;  1FGT A;  5RNT A;  3F9S A;  1CQS A;  4LYL B;  3DGY A;  1K41 A;  3NQZ A;  4XBX A;  1RCL A;  2F98 A;  2PNC A;  2WGO A;  1NDO B;  4K1U A;  3PYJ A;  1BAO A;  3B4O A;  1LQG C;  1AQZ A;  1Q40 A;  4BL2 A;  7RNT A;  4HJL B;  5CF2 A;  3RGA A;  3HII A;  3UJM A;  1QMA A;  1DYU A;  1OF5 B;  2L4V A;  5ELJ A;  5IG5 A;  1J2B A;  2W03 A;  1A90 A;  3OX9 A;  2XSO B;  1ULI B;  3SOA A;  1RKY A;  1DVD A;  1BRJ A;  2C4B A;  3L0R A;  1X1X A;  1GYB A;  4Q53 A;  3O8Y A;  1ULJ B;  1BSA A;  3JUP A;  1UW1 A;  1QVF 2;  1AR0 A;  3DM8 A;  3D4A A;  3CCM 3;  1NU3 A;  2F4Y A;  1BU4 A;  3Q1C A;  1B2U A;  3FLJ A;  3CNM A;  2CK3 H;  1GOU A;  2UGI A;  1RGE A;  3KFQ C;  3DH2 A;  1Q42 A;  1I2F A;  2H0G A;  1JNQ A;  1JKG B;  2W0Q A;  1TRP A;  1CYV A;  1RLS A;  3QRD A;  3IJE B;  1BSE A;  3EF8 A;  3BU4 A;  3FSD A;  5CK6 A;  4R4K A;  5EVH A;  3KSE D;  3DMC A;  2A15 A;  4WP5 A;  2Y74 A;  2GEX A;  4XBT A;  2CFW A;  2V1L A;  3N9H A;  3Q2P A;  4R1K A;  3CXC 2;  4K61 A;  3JVC A;  4O2H A;  2CWV A;  1FUT A;  2BU4 A;  1NNV A;  4KZ1 A;  1JBT A;  1S72 3;  2W56 A;  1MWU A;  3CD6 3;  3BNB A;  1RMS A;  1BUJ A;  2BO9 B;  2KXG A;  2ZDJ A;  2CFD A;  4FMC A;  5D83 A;  4MEI A;  1IK3 A;  1PU4 A;  2ML6 A;  4N6U A;  5M1A A;  2KF6 A;  1BSB A;  3CCE 3;  1JZO A;  2AAD A;  3D9R A;  1VZZ A;  1W6G A;  3UB1 A;  2P09 A;  2GBX B;  1X1U A;  1RTU A;  1BRG A;  1UI7 A;  3MG2 A;  3MG3 A;  2XFT A;  4EV2 A;  1OPY A;  1R4C A;  3CCQ 3;  3G71 3;  4HM2 B;  2BMO B;  2IUJ A;  1B2X A;  1AVL A;  1JBR A;  3DGL A;  4OUQ A;  3GZX B;  3NQY A;  3LML A;  4WYK A;  3Q90 A;  3EHC A;  3S29 A;  8RNT A;  3J7Y d;  1I2E A;  3V92 A;  4O8S A;  3G6E 3;  2MF7 A;  2Z6B A;  1UDI I;  3BIR A;  2H0H A;  1YNV X;  1W00 A;  2KRT A;  1W2B 2;  4RZM A;  4OVM A;  1I8V A;  4EV5 A;  3F40 A;  4U13 A;  5G1K A;  3CU3 A;  1YVS A;  4LEH A;  1A2K A;  3F8X A;  1GS3 A;  3K9M C;  1QAL A;  5FW5 A;  3UL6 A;  2QEX 3;  3CC2 3;  3CMA 3;  1ASK A;  1IVW A;  2CWU A;  1JN5 A;  3EX9 A;  1M90 4;  1B21 A;  1TU5 A;  1D6U A;  2HOH A;  2C10 A;  3ALA A;  4MMZ B;  2BMR B;  1YJ9 3;  1K9M 4;  3BND A;  3BNC A;  1A67 A;  1SPU A;  4N6V 0;  2IMJ A;  5LC7 A;  2HMK B;  2XGL A;  3GZR A;  2GU1 A;  1I0X A;  3K5T A;  2O9U X;  1MGW A;  2KF5 A;  3G0K A;  2YFL B;  3HZP A;  2STD A;  3FG4 A;  5HOH A;  1KD1 4;  4HAA A;  1BNE A;  5IF6 A;  4X2H A;  5AI1 A;  2D42 A;  1TJD A;  1W6C A;  2F5W A;  7GSP A;  2AAE A;  3CCS 3;  4XDV A;  5AIF A;  1NB5 I;  1GD4 A;  3GWR A;  5DRE A;  3SXX A;  1VQP 3;  1FGO A;  2CIU A;  1EG9 B;  1O7H B;  3CCR 3;  1K8A 4;  2YFJ B;  4AKZ A;  2OQE A;  1STF I;  2L1S A;  4XBY A;  3ZG5 A;  2CWT A;  1FUS A;  3G16 A;  5STD A;  2OWP A;  4STD A;  3JUO A;  1W7C A;  1MGR A;  3X42 A;  3CC4 3;  1YIT 3;  2W6J H;  1N8Q A;  4KFE A;  1MOL A;  1L5G B;  3VSY A;  1TP6 A;  1TFO A;  4FCJ A;  4BTW A;  3NHX A;  3K63 A;  1O7P B;  1I0V A;  1AV4 A;  3FZW A;  1DET A;  2FNQ A;  3GSP A;  1JRQ A;  2P0X A;  4FCZ A;  5ELU A;  1UI8 A;  2E2U A;  1M9G A;  3PCR A;  3LTA A;  3CC7 3;  3CNX A;  4R80 A;  3B4P A;  1ROV A;  1BOX A;  3B8L A;  2UUG C;  4HM0 B;  2Z7A A;  5AYR B;  3PXM A;  3LTD A;  3SOY A;  4BL3 A;  4BTX A;  2OTJ 3;  1B3S A;  3DGM A;  1VQ8 3;  2ZHX B;  1I2G A;  4GSP A;  3DZL A;  1RHL A;  1RJO A;  1JZD A;  2YX9 A;  3X3X A;  3S67 A;  4CDL A;  4CJN A;  1FW7 A;  4WFO A;  1BRK A;  1KWI A;  1Q82 4;  1Q7H A;  3CCJ 3;  4N6M A;  4DKI A;  4I5Q A;  3S28 A;  1YGE A;  3OV4 A;  2XR8 B;  5LC6 A;  1B27 A;  1I3I A;  2W9P A;  3BNE A;  1MWS A;  3LH4 A;  1IVV A;  3N54 B;  4HBR A;  1ROA A;  2GU3 A;  1YIJ 3;  2XF3 A;  1N9E A;  2BNG A;  2CHC A;  1W01 A;  1STD A;  1WTH A;  4HM8 B;  1W6Y A;  3WR2 A;  4QWT A;  3JUM A;  1NB3 I;  2CW9 A;  4G1M B;  3WOF B;  3NBJ A;  1GOY A;  2M7O A;  3LOY A;  5CF1 A;  4WYK B;  2K3D A;  3NM2 A;  5EEO A;  1PFP A;  1VQN 3;  3ZFZ A;  1B2S A;  4BU4 A;  3NUV A;  2W9Q A;  1BRI A;  1VQ6 3;  2Q07 A;  1QAK A;  1RGF A;  3NX0 A;  4N6T A;  3UL5 A;  1M1K 4;  4PEJ A;  1LXE A;  1O7W B;  1SQW A;  3DY5 A;  2F99 A;  3HI7 A;  3LT9 A;  5EQL A;  3Q3F A;  1MWR A;  1X1Y A;  3KZT A;  3F8H A;  3CME 3;  2R41 A;  1GOV A;  3K7C A;  1RN4 A;  1BVI A;  1BNF A;  2IYJ A;  1RGL A;  4EYC A;  1IVU A;  2OOV C;  1JV2 B;  2CX1 A;  1C7H A;  1X1W A;  1ZX2 A;  2IUK A;  4L8O A;  4NHF A;  2CH9 A;  3DGN A;  3U97 A;  3H3H A;  2P0M A;  2WOF A;  3D5G A;  4R9L A;  1V74 A;  3GZB A;  5AIH A;  1LVN A;  2FXT A;  2Y73 A;  3K0Z A;  3OWY A;  4FMD A;  1GSP A;  1D6Y A;  4O02 B;  4HM1 B;  2QGU A;  5D81 A;  3V98 A;  1VQ9 3;  3HOH A;  1IVX A;  2P05 A;  1UCK A;  1TUH A;  3I56 3;  1VQ4 3;  1QAF A;  2BHM A;  3SX1 A;  1N9J A;  4JF8 A;  2J8X B;  1JB5 A;  6RNT A;  3EB8 A;  3LYG A;  3MHE A;  1YHQ 3;  1B2Z A;  1BRH A;  1JKG A;  1LOW A;  3F14 A;  5AEW B;  1CEW I;  1A2P A;  2QA4 3;  3EJV A;  3H51 A;  4R9K A;  2E2V A;  3F7X A;  5TGN A;  2GBW B;  1F8N A;  4GHO A;  4GB5 A;  2XRX B;  1B20 A;  5G2G A;  2B24 B;  2CG1 A;  2ZL8 A;  1IQ8 A;  2W2C A;  3AGO A;  3KCH A;  1LNI A;  4JRF A;  1TRQ A;  1AY7 A;  1SII A;  4HVN A;  3T0U A;  3M8C A;  1JB2 A;  1VQM 3;  4J9A A;  2KAA A;  1PYL A;  1IV7 A;  1UGI A;  1I70 A;  2GEY A;  2F86 B;  3AGN A;  2K0M A;  3B7C A;  3V99 A;  3SVA A;  1SJW A;  1FGM A;  1GY6 A;  1T5Y A;  2YFI B;  4WHA A;  3U1W A;  2P38 A;  5I97 A;  1DMQ A;  4H61 A;  2OQE C;  4ZM8 A;  1EEJ A;  1U5O A;  5KP4 A;  3STD A;  3E99 A;  1DE3 A;  4GL6 A;  1ZO2 A;  2B1X B;  1Q81 4;  1FUW A;  3PS8 A;  3FF0 A;  1WMO A;  1UCL A;  3URP A;  5KP1 A;  3KSP A;  4H3U A;  3WA2 X;  1M1X B;  4HYZ A;  4N6L A;  4FR9 A; 
#chains in the Genus database with same CATH homology
 1LRA A;  3BU4 A;  2SAR A;  1UCI A;  2GSP A;  1RN1 A;  5BU4 A;  1BGS A;  1B3S A;  1R4Y A;  1UCJ A;  3SYU A;  1FUT A;  2BU4 A;  1I2G A;  4GSP A;  4J5G A;  1RHL A;  1JBT A;  1SAR A;  1FW7 A;  1BNI A;  1JBS A;  1RMS A;  1BUJ A;  1BRK A;  1BSD A;  1BNR A;  2KF6 A;  1BSB A;  1I3F A;  1GMP A;  2AAD A;  2F56 A;  3AHW A;  1B27 A;  1I3I A;  1RGC A;  1X1U A;  1RTU A;  1BRG A;  4RNT A;  3D5I A;  1ZGX A;  1B2X A;  1BRS A;  1JBR A;  3WR2 A;  1BAN A;  4HOH A;  1GOY A;  8RNT A;  1I2E A;  1PY3 A;  2RBI A;  1B2M A;  2KF4 A;  1RGH A;  1BNG A;  1B2S A;  4BU4 A;  1TTO A;  1RDS A;  1BRI A;  3BIR A;  1RGF A;  1YNV X;  2RNT A;  1RNB A;  1BNJ A;  1I8V A;  5BIR A;  1IYY A;  1LOV A;  1YVS A;  3Q3F A;  5GSP A;  2F5M A;  1BIR A;  1X1Y A;  2ZA4 A;  1GMR A;  1GOV A;  1RGG A;  1BRN L;  1RN4 A;  1BVI A;  1BNF A;  1RGL A;  3RNT A;  1RGK A;  3WHO A;  1X1W A;  1B21 A;  2HOH A;  1RCK A;  1YGW A;  3D5G A;  1T2H A;  1Q9E A;  1RGA A;  1FZU A;  1GSP A;  1C54 A;  3HOH A;  1I0X A;  2KF3 A;  1UCK A;  1MGW A;  6GSP A;  2KF5 A;  5HOH A;  4HAA A;  4J5K A;  1BNE A;  1FYS A;  6RNT A;  1LOY A;  1B2Z A;  1BRH A;  1LOW A;  1T2I A;  2AAE A;  2F5W A;  7GSP A;  5RNT A;  1A2P A;  3DGY A;  4BIR A;  1RCL A;  4GHO A;  1B20 A;  1FUS A;  1BAO A;  1RNT A;  3AGO A;  1AQZ A;  3KCH A;  1LNI A;  1TRQ A;  1AY7 A;  1HYF A;  7RNT A;  3AHS A;  1RSN A;  3A5E A;  9RNT A;  2KAA A;  1PYL A;  1I70 A;  3AGN A;  1MGR A;  1BNS A;  1BRJ A;  2C4B A;  1X1X A;  1BSA A;  3D4A A;  1I0V A;  1DET A;  1BU4 A;  1G02 A;  1GMQ A;  2F4Y A;  1DE3 A;  1B2U A;  3GSP A;  1GOU A;  1UCL A;  1RGE A;  3URP A;  3DH2 A;  1BSC A;  1I2F A;  1HZ1 A;  1TRP A;  1RLS A;  1BOX A;  1BSE A;  1CH0 A;  2BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...