2AAMA

Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 a resolution
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
285
structure length
285
Chain Sequence
EGWFMPFDNWLYQLQNADPVEISSSGFEIAVIDYSKDGSESGEYSPEEIKIMVDAGVVPVAYVNIGQAEDYRFYWKESWYTNTPEWLGEEDPAWPGNYFVKYWYNEWKEIVFSYLDRVIDQGFKGIYLDRIDSFEYWAQEGVISRRSAARKMINFVLEIAEYVRERKPDMLIIPQNGENILDFDDGQLASTVSGWAVENLFYLKTIPLEENETKSRLEYLIRLNRKGKFILSVDYVDDGSDSFENISRILDYYEKAKRNGCIPYAARSDLELDEMNVIEGIQPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (tm1410) from THERMOTOGA MARITIMA at 2.20 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Hypothetical protein TM1410
total genus 114
structure length 285
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03537 Glyco_hydro_114 Glycoside-hydrolase family GH114
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2aamA00
1AW5A 4OU1A 3TUUA 1WOAA 5D37A 3B05A 1TPWA 1H5YA 2DZUA 3C6CA 3HBLA 2WO5A 4LS1A 1ICQA 1T99A 5KTLA 1KLZA 5EYWA 1X1ZA 3OVRA 1X6UA 4FX8A 1LCOA 3LHTA 3C8FA 4HSNA 1EA0A 3W83A 3NQ7A 1QOPA 4UMAA 2J88A 3UY7A 1H1YA 1EP2A 2ZCGA 4AEOA 3PSWA 2VEPA 1HG3A 1TREA 2YYUA 5LGZA 4FNTA 1XBYA 3KRSA 1UCWA 2JGQA 1QWGA 2Q3RA 3R5EA 4XKYA 2OMAA 1XKYA 2QCMA 3EWBX 4O54A 4UMBA 4CCEA 4IMFA 3A9IA 3MI6A 1GEQA 4POCA 3IIPA 5K4XA 2ZRVA 1VR6A 1ALDA 3M1ZA 4O15A 3WK0A 4LWWA 1GZGA 2CLEA 2FB3A 2Q3OA 3KRUA 1A5BA 3VE9A 5LHEA 2C1HA 3LCHA 3MHFA 3SGUA 1TRDA 3SI9A 3O16A 2A21A 4IX0A 3BK0A 3PF3A 2ISVA 2CZEA 2QJHA 3UD6A 2KZHA 4PCFA 3EB2A 2C18A 3TW6A 1U83A 5H91A 1PIIA 1VZWA 4EVZA 3IIOA 5AFDA 3B4UA 3LCXA 3W1MA 5FF7A 4RZ4A 3TJXA 1XBVA 3TKFA 3CPRA 4JX4A 3M5ZA 1CI1A 5D32A 2F7FA 2GJLA 3U8GA 2DZWA 2ZA2A 2ZDRA 3NL3A 1N8FA 3W76A 4MLRA 3W7GA 1FWWA 3UWYA 2OT1A 3PY2A 2VELA 1F5ZA 2QR6A 4FNPA 4MFEA 2GJNA 1PHWA 3RFAA 4AF0B 5BMWA 4IMDA 1JCNA 1LLZA 3VFLA 2EGZA 3BGJA 1TPB1 5I3KA 2W79A 3N19B 3NM1A 4NQ1A 4CQ9A 4O1DA 1MEHA 4YL2A 3ZWTA 1BWKA 2X30A 2V2CA 5DXXA 2IQTA 3T44A 3NQMA 3W7PA 1DQWA 3S1VA 3W9ZA 5MHBA 4FHAA 2E6YA 4XQ6A 3CHVA 3G1HA 4UCGA 5HULA 3NZRA 1FWRA 3E12A 1H7XA 1TPFA 3B8DA 3JRKA 2FJKA 3TR2A 3N9RA 2VKZG 5EBUA 3BG5A 2CLMA 4FIQA 1K7EA 3F4WA 4S2BA 3EX6A 3UPWA 3DGRA 4RZ6A 1ME8A 3BW4A 1K02A 2ZZ6A 1IF2A 1G6CA 3H53A 1O60A 3P8IA 4GUFA 5AHLA 1GG1A 3EEGA 3NQCA 5D33A 4RCXA 3PM6A 4HPJA 4Z0JA 3HMJG 3QF0A 2BXVA 1H7WA 5LNVA 2QCEA 1H61A 3UYCA 4O12A 4IXHA 3C52A 5LNWA 5HJLA 4M6QA 4RZ5A 3C56A 4NU7A 4IGHA 4CNNA 1OYBA 3TU9A 3CEPA 3P81A 3I65A 3O15A 4NX0A 1ZAJA 3S9YA 3TQVA 4WOQA 4ADUA 3NQVA 3FS2A 1ME9A 3DI1A 1XL9A 4O28A 3TAOA 2ZTKA 2YFOA 3CTLA 3BW3A 3UZJA 1KBIA 3W72A 3BG3A 4M7TA 2A7RA 4HNTA 1Z42A 3EWXA 4GWEA 2G95A 4JX6A 1TPH1 1GOXA 1ZJIA 3AJXA 2GUUA 5I3HA 3HPSA 5CZSA 3GK0A 3PUOA 3S6DA 3QQ1A 4LVGA 2A7NA 2I1OA 4K39A 1RR2A 5KSWA 3OG3A 4CNOA 3WJZA 4E2DA 1LRNA 4FNRA 4C1LA 1KFEA 4KFOA 1TPVA 4ADTA 1P1XA 1TV8A 4XKYB 3HGSA 3U6WA 5KZEA 1DJQA 2PRLA 1TPUA 1OABA 3TIMA 2TSYA 4KKXA 3FOKA 1X1OA 1ZHAA 4MIMA 3G3MA 4UTTC 4YXGA 2J9XA 3IIXA 4HIBA 3EX3A 4FEZA 1NF0A 2YX0A 1DJNA 4R7JA 2FPVA 2ISWA 3OBKA 4KWVA 4FX6M 4R34A 4TMCA 1AL7A 3MP3A 3USBA 3HGJA 2W6RA 1LOLA 5CZJA 5D2YA 2DZSA 2NLIA 2RDWA 3W1PA 3I6RA 4LC8A 2ZA3A 1F6PA 5CZ0A 3SECA 1ME7A 1YPIA 3TA6A 2X16A 2VEMA 3A22A 4NJJA 4JIQA 1ICPA 1XDMA 3O63A 1OFAA 4K8HA 4TU1A 5F4SA 2NX3A 4ZVJA 4WY0A 3CLMA 4IQLA 3EX2A 4PL2A 4GUGA 1KM1A 2FDSA 8TIMA 2Z6IA 3PUDA 3GXNA 3VCRA 3HPXA 4UC5A 4NJIA 4L4LA 2VFFA 2R8WA 5DBUA 3LB0A 3W7QA 2QAFA 4UFKA 2CLFA 3W7CA 4A22A 4Q4KA 4DPPA 3TAKA 1OVDA 2TMDA 1L2UA 5F2MA 3KAOA 3PAJA 1OK4A 1KFCA 4N6EA 2ZTJA 4MY9A 4K38A 4ZZ9A 1DV7A 3C2EA 3I68A 5FEXA 4CNPA 4O1BA 1EEPA 3C0JA 4DF0A 5E93A 3T4CA 3TFXA 2X1SA 1QO5A 2GVLA 3GXPA 1FWSA 3LBMA 4NZFA 2GVJA 1RQBA 3UWWA 3IRDA 1HTIA 3W7HA 1B4KA 4H3DA 1K3UA 4UXDA 1R46A 5AHFA 3PBUA 2YZRA 2CLKA 2V8ZA 1THFD 1KTBA 4JICA 2CZFA 3C2FA 5LZLA 3RNDA 4DO6A 4NVTA 2XN0A 1TJRA 3MP5A 1VLWA 3NQDA 2QEZA 5C54A 4UNLA 1SO4A 3NDOA 1C8VA 1JCXA 2RFGA 4JTEA 3H54A 2ZFAA 1P4CA 1SZFA 1OK6A 1B57A 2QCGA 3S5OA 2R91A 3DFPA 3V75A 2XN2A 4B5NA 4M7SA 4P2VA 3UPBA 3R89A 4PH6A 3G1VA 5EY5A 4GE8A 1B9BA 4JY8A 3GKFA 5EPDA 2C6QA 3HQ1A 3LV6A 1FBAA 4AVFA 2VOMA 3TK7A 3BO9A 3EWWA 2A0NA 4FX7A 4XBSA 3B03A 2P10A 2ABBA 3GVGA 3GNDA 1FUYA 1FCVA 3BVJA 1VJIA 3E02A 1KM3A 2OT0A 3G1AA 5CPOA 1T96A 5BOOA 2ZRYA 3M41A 3WJWA 3FA5A 4PL1A 1L9WA 1XFBA 1SO3A 4XBKA 2QUVA 4LVBA 4O17A 5AOUA 2YFNA 5D30A 3M6YA 2WJZA 4IMGA 1YXDA 5AC7A 5HUPA 3FIGA 4A29A 1PV8A 3O6CA 1JRBA 2FB2A 1VS1A 4LVAA 4QAIA 4JYDA 2YW4A 1PVNA 3NQ6A 4DO4A 5DCDA 4TMBA 3LX9A 1KTNA 3G1FA 5J5RA 2QAPA 3P80A 3T78A 5AC6A 2O7SA 2PC4A 4UTWA 3W84A 2Z2UA 3DFSA 3NQEA 5BNKA 2E68A 1KM5A 3LRMA 3W2UA 4X2RA 4N6FA 3UWQA 5LNSA 4A21A 3GKAA 4MYXA 1SW0A 3NAVA 3OA3A 2WNNA 7TIMA 1QFEA 1TV7A 3PC0A 4X3ZA 3T7VA 2QCLA 1WQ5A 2HMCA 2J9YA 3E49A 4M19A 4EOUA 3NPVA 1LDCA 4MOZA 2Y70A 4XTIA 2V81A 5HWNA 4K37A 3P7YA 3LDVA 4EWND 1PHQA 3NQGA 2HS8A 2V82A 4UFHA 2V0TA 5C5YA 1ZALA 3W71A 1KFLA 1DOSA 1QPNA 1SR9A 2EF9A 3H55A 4IMCA 4NX5A 3L0GA 4DF2A 5D2TA 1J5TA 2QCHA 5K4ZA 1G7VA 2GQ9A 3MMTA 3ABRA 2V5BA 4OHQA 3B04A 1WYIA 1XBZA 4O52A 3B0PA 5D04C 1W5NA 3LHVA 5BMXA 2B7NA 5F4XA 2BZNA 4UTKA 3WK2A 1VYRA 3G1YA 3EKZA 4QITA 1YPFA 4N02A 4EIVA 2YYTA 3FJ6A 1DHPA 3A5VA 3NEVA 1I2QA 5D02A 3UXAA 1GVSA 3INPA 2BTMA 5CGQA 1N7KA 3AO0A 5G4WA 1H63A 1PCKA 2Y63A 1LOSA 5HUOA 2TYSA 4AXKA 3I7QA 1A53A 1TB3A 3W2KA 4PA8A 1GYLA 3QMRA 1WXJA 3W7JA 1U5JA 1O95A 1TTIA 4JD4A 2EKCA 3RK8A 2QJGA 4ICNA 1YTKA 3I7RA 5K9XA 3STFA 4UTTA 2QCDA 3C3NA 4GBUA 3TQ0A 1OYAA 2XN1A 1WBJA 1M7PA 1Y0EA 4AAJA 1R2SA 4O0KA 1HO1A 5IBXA 3NQFA 2Y7EA 4JR5A 4AH7A 2E77A 1OX6A 5EMUA 1ADOA 3PBYA 3UWUA 1H7NA 1RD5A 1BEUA 2FLIA 2A6LA 3PR2A 5D38A 4FF7A 1H51A 3NQ8A 4NZJA 2EPHA 1ZNNA 4CQ8A 3G8EA 4MPQA 1UBSA 5AC8A 4D2JA 4GUIA 1SU5A 3NL6A 1SZGA 3C4UA 3W7RA 5A8GA 6TIMA 3QRHA 1MO0A 1EP1A 1I45A 3LTPA 1W8SA 4UTUA 1TJPA 1FX6A 3Q37A 2H3DA 3S42A 5K9DA 4BF9A 3STEA 2CLOA 3G8RA 5FEWA 4WY0F 2VEKA 5EKYA 1K7FA 4JTLA 1KLYA 1FQ0A 3TQKA 1FY6A 1TTQA 2AGKA 1I2NA 1OFRA 3L66A 1YTEA 4LV9A 2ISSA 3S5ZA 3M7WA 4A2SA 3EWZA 4JX5A 4WXYA 4DXVA 4MZYA 5FF3A 5FF0A 2Y7DA 3LCGA 1OFBA 3PS7A 3TSDA 3S1WA 4E0CA 4LU0A 1ZY9A 3L0KA 3F1QA 5EL1A 1O4UA 3F4NA 1LBLA 1H7PA 1TTPA 2VFIA 1PE1A 3ZS4A 4IMEA 1VCVA 3MP4A 1OYCA 3P61A 4O0ZA 4Z1DA 5FEPA 4LRTA 1JQXA 2NXGA 5G4EA 3NVTA 3NGJA 4J9JA 3W88A 1G4PA 1GQNA 2HTMA 2P1FA 3S1XA 4BI6A 2DZXA 2CWNA 2X1TA 5DLCA 1Z48A 4MJMA 1EIXA 6ALDA 2A7PA 3LI1A 4OV4A 2J24A 4O16A 5AN7A 3GXTA 1I8JA 1S3HA 1A50A 3C2RA 3MBFA 4O8RA 4XUGA 5A5WA 4FIRA 3VI2A 1A5AA 1R2RA 4JGDA 5HQEA 1NEYA 3W7OA 3W6YA 2E5BA 3M43A 3CEUA 3LXBA 3GDMA 3TH6A 3O07A 1S5WA 2VC6A 2CLLA 4RXGA 1OFQA 2ZBTA 1JRCA 1VPXA 5HR7A 5CPNA 3G1SA 1SZNA 3LXAA 1R30A 5E0KA 4XTDA 5D2WA 3TROA 1NF7A 3TMQA 1OF8A 5BRBA 3BARA 2GOUA 4ZQMA 3LBCA 3MHUA 1H50A 1SO6A 1SSGA 1LBFA 5TBOA 1W37A 4DELA 3LHUA 3A24A 2A1YA 5CSRA 2E6AA 1F76A 5AHMA 2NUXA 3QPYA 1FCUA 2Z1BA 3STCA 3W2JA 2ZRZA 1TIMA 2CLHA 3UY8A 3VNDA 3GX9A 3WK3A 1VYPX 4N9EA 4O57A 3W73A 4NNCA 4LVDA 2WPBA 4O4WA 4XZ9A 1IIGA 3GDTA 3M9YA 1GYNA 2QDGA 1UUOA 3LHZA 1K8ZA 1JCYA 3KVLA 4YWIA 1QMLA 2E09A 2FIQA 3ELFA 3KHJA 1RV8A 2ZZ2A 2YDAA 1KV5A 4JTGA 3WJSA 2B0MA 3T55A 4ADSA 5TIMA 4DPQA 3M0ZA 4YCOA 3DFQA 3E9AA 3W7LA 5LGXA 1XUZA 3CIWA 3CT7A 4UTMA 5IM51 5I3GA 2OCZA 4C1KA 4FB7A 5KITA 1BKSA 5FESA 3P60A 4MFDA 3MO7A 4ML9A 4U4MA 3BW2A 3UQNA 5KZDA 1OFDA 3MBDA 2G96A 1ZFJA 3KXQA 4K7YA 4ALDA 4AWTA 1EWDA 3HOJA 3S1UA 2RH9A 5F2LA 3NOEA 1LORA 4DQWA 3NYZA 3NXFA 2FFCA 2BLEA 2QF7A 5DELA 2XFWA 1FDJA 2J6XA 4UFLA 1NVMA 3QPZA 3B06A 2HSAA 4UTHA 4JIPA 3ABOA 1GTEA 4BWLA 1JULA 1AK5A 3W1LA 4Z1CA 1IXOA 1CX9A 2WSRA 1SZEA 2C15A 4CCDA 1B3OA 3FFSA 1KW1A 3UNDA 3PB0A 1IGSA 1EP3A 2FPYA 3FYPA 5G2IA 1Q3NA 4BR1A 2A2IA 5FI8A 1PS9A 3YPIA 4DF1A 2NXIA 2X2GA 1SFLA 2JBMA 5LNRA 1W3NA 4OT7A 3PVFA 5D2XA 1JQVA 3W2NA 5IBXC 5U4NA 3CU2A 2DU2A 1IIHA 2ZQ0A 1ZCOA 5AYYA 4N4PA 1NFBA 3L5MA 4TO8A 3LV5A 1D3HA 4NJKA 5AB3A 1KV8A 3A5FA 4OBTA 3TC6A 5CKSA 4E38A 3GIYA 2H8XA 3DAQA 1VCGA 1SO5A 1C9DA 1KFJA 3GNNA 2AAMA 5L6UA 2WQPA 3DH7A 1KM0A 3G1DA 4K6AA 4QJ1A 1F2JA 2G5WA 2O7QA 4LS0A 1LOQA 3MUXA 3G0UA 2Y7GA 1OFPA 3GZ3A 2CW6A 3W1XA 2NX1A 1MXSA 3FKKA 1KTCA 2V5LA 1DL3A 2I9EA 4HSOA 2RKXA 3S5YA 4JTFA 1TRIA 4S2CA 2H3BA 1RVGA 4UR7A 3W2MA 1QDSA 1YYAA 1XM3A 1LLWA 2E1DA 3L5LA 4PODA 1XC4A 3KVJA 3B0UX 1FCQA 1FDYA 3GDRA 3KVMA 2VENA 1K8YA 3QSRA 4R53A 3QZEA 1TSIA 4IPIA 2HS6A 4OQVA 1H1ZA 1OF6A 4MJZA 3DHFA 4JN6A 5C6MA 1W5OA 1FXQA 3SSJA 1H7OA 1TPC1 3L68A 3L9CA 4QNEA 4MVAA 4UMCA 1FCBA 3ABQA 4JTSA 2R14A 4MYAA 5G1TA 5I3JA 3SR7A 4N9BA 3NL2A 4IPJA 1M5WA 4A2RA 3BLFA 1TTJA 2E6DA 4HT3A 1ZENA 5LNUA 2A6NA 4YLWA 1EUNA 1HL2A 2LLEA 3ATZA 1VCFA 3KX6A 4MUZA 1DQXA 5AHIA 3W7IA 1VYSX 1VLIA 1V7YA 1WAUA 3IVSA 2VFEA 1JCJA 3O06A 3MI2A 2VXNA 1W31A 4JYFA 3I7SA 5I3FA 1H60A 3SGZA 1P0NA 3FLUA 1XCFA 4WQ6A 3M44A 2A5HA 4UFIA 3M16A 2WV8A 3N9SA 1AL8A 1BWLA 3OEXA 4O10A 4RK8A 3TE9A 3G24A 3G22A 3R13A 2PRHA 1FDZA 4O18A 5G2WA 3WJYA 2BWGA 1EX5A 2NXHA 3BGGA 2JKAA 1F74A 1O5KA 2F84A 4Y8FA 4RXFA 4YMZA 4O50A 3GYEA 3NR0A 4FNUA 1F73A 3CM4A 3DENA 3W86A 5DXYA 1XUUA 1W54A 2J27A 4X22A 3P84A 3BLIA 3IGUA 3TXZA 1W0MA 4FO4A 3LM7A 4O1CA 5J5DA 2JGYA 2NWSA 1JR1A 4GJ1A 1FWNA 2C3ZA 4IXXA 3CIXA 3TSMA 4WOZA 3L21A 4JTKA 5D03A 1QR7A 1GVFA 4KWWA 5F1UA 3LGEA 2R94A 1UJPA 1D9EA 1G7UA 1QCWA 3TC7A 2E6FA 4O19A 3W3OA 4UTJA 4GXMA 2YGYA 2QCCA 4MZ1A 3NPWA 1YXCA 2NZLA 1B4EA 4LUIA 4X9SA 5K2ZA 1YTDA 1QNVA 3QYQA 3O8AA 1GVQA 3RU6A 3P82A 4IWWA 4LT9A 1HO4A 1I4NA 1LYXA 4L4MA 1DORA 4OV9A 3SZ8A 2Y85A 3EXRA 3ZR4A 1HUVA 1LROA 2H90A 1X8FA 3OHIA 5CSSA 1MEIA 4O1AA 3CQ0A 5EA9A 1TPDA 3WK1A 4A3UA 1GJPA 3EWUA 3SFKA 5FEZA 1WOBA 2QCNA 1N55A 3DFNA 4AHQA 3LHWA 5HNRA 3VKJA 3CWOX 4XWUA 1F7BA 2NV1A 4KFNA 5K7JA 3N14A 4M5PA 3NPUA 1VH7A 4JNMA 1GPWA 4GFSA 2DP3A 3QEZA 3V1PA 5HR6A 2YSWA 4AMAA 4UNKA 2ZRXA 4FXSA 4Z1BA 2QCDB 3LCIA 3M5YA 2H8ZA 4M6VA 3HJZA 1GT8A 1KM6A 4QNWA 3TW7A 4K36A 3N3MA 4MY8A 2NX9A 4TIMA 5I3IA 3ANYA 3HO8A 1OJXA 3LTSA 1XDLA 3HPZA 1GVRA 4Y96A 4LRSA 1L6SA 2AQWA 3DI0A 3HG2A 3K30A 4N9CA 1ICSA 3TSBA 4GUJA 1WX0A 3OVPA 3L65A 3S5NA 3P67A 4DBEA 2PRMA 4AWSA 4CCCA 2V2HA 4IUOA 2VFDA 3TV8A 3QC3A 4O14A 1RPXA 4OGZA 4DEFA 4OE7A 4JXCA 3W1AA 4NNAA 3GR8A 3L67A 1QO2A 2V30A 1SW7A 1GVOA 3QSTA 5G1YA 3W7DA 3W87A 3CB8A 1OX4B 1Q6RA 3GDLA 3LXCA 4HHPA 5G5IA 3P62A 5K9CA 2Y61A 3W7EA 3E96A 4HN4A 3BG9A 4NJHA 3G0SA 1NAL1 1K8XA 1LRQA 3JR2A 1A5SA 1P0KA 3THAA 1GWJA 2B4GA 3PSVA 3S8HA 4Y90A 1Q45A 4NXSA 1TQJA 1P5BA 4JDYA 2JKPA 1LZOA 2ZRUA 3W1TA 2B7QA 1V5XA 2QUTA 1WV2A 2J9ZA 4HKPA 3FJLA 3PUEA 4GRSA 4DBDA 3IV3A 4MLJA 3L0NA 2Q8ZA 3IGSA 3O6DA 2VFGA 3A23A 1G67A 4JTHA 4UIOA 3RLUA 3HB9A 4LS2A 1UUMA 2CZDA 2V9DA 5D2VA 2I14A 2OJPA 1LM1A 4GC4A 3DKLA 4JTTA 3W85A 3N2XA 4Y9AA 2GVGA 5LKYA 4UFJA 3SW6A 1TQXA 2ZZ4A 2QKFA 4QM1A 5HWMA 4BK9A 5CPLA 2PE4A 1G69A 3W1QA 3DU0A 3RLVA 3W7NA 5CZTA 3W74A 1MSSA 2WOQA 5F2IA 2ATSA 4O4VA 1A5CA 3W1UA 3LRLA 2C16A 2C19A 2EHHA 3IVUA 4I9AA 4ZQNA 4NT0A 4JTIA 2WSYA 1JUKA 4UTIA 2NV2A 1SFJA 2CLIA 4PC8A 3RMJA 1Q6OA 1FWTA 3MYOA 3N2MA 4NJGA 5D05A 5DN1A 1DKWA 1ONRA 4BFAA 1K7XA 5HINA 1MZHA 2DJLA 3DBPA 1DBTA 3M5VA 1M7OA 5F2GA 3P8JA 3EX4A 1OFEA 1SUXA 4LNYA 1VHCA 4WJEA 1OX5A 3LLDA 1AG1O 1F05A 3PG8A 5LSMA 3OIXA 1Z44A 2C0AA 3F03K 1IXPA 5GVJA 5U7SA 1LRTA 2VEIA 1RZMA 3SIZA 1XI3A 3DZ1A 3DXIA 4RX0A 4S1FA 3TXVA 3ATYA 4WXZA 4JS3A 4PFMA 3R8RA 4ONVA 1OHLA 4IOTA 4K7VA 4WUIA 4Q33A 3FYOA 4IJBA 4AF0A 3EXTA 3L5AA 1D3GA 3QJAA 4RR4A 3UWZA 5DCEA 1XXXA 5DY3A 5C2XA 2PCQA 3EX1A 3O1NA 1JCLA 1KBJA 2JK2A 1I2PA 4DO5A 2NWRA 3HGRA 1KA9F 4N4QA 1UB3A 4O53A 4EF8A 1TO3A 4PEKA 1SW3A 1SQ7A 3PB2A 3CC1A 3G3DA 3W1RA 3W1NA 4LC6A 5TQLA 1M6JA 3TCEA 2GPTA 2ZZ3A 4JTJA 2QCFA 1EUAA 3NNTA 4CLMA 1R47A 3Q58A 4UTLA 3IGXA 1H62A 1YLVA 3UXDA 2Z6JA 3VE7A 3EWYA 4BWLC 3QW4B 1F6KA 2ALDA 3TFCA 5H2ZA 4QISA 1OX4A 4MZ8A 2FQIA 2H6RA 1W5QA 3PULA 4I7UA 1I2RA 3S0CA 1Q6LA 1IXNA 2Z0IA 3PG9A 4LW7A 3ABSA 4CQAA 3HG3A 4MKNA 2A4AA 3LCFA 1O5XA 3C2OA 4EF9A 2GQAA 3ZFHA 2DORA 5F1VA 1J4EA 1PL9A 3KVKA 1WDWA 1L6WA 4G1KA 3C2VA 2FPTA 3MI3A 1PCWA 1HFBA 2Y6ZA 1SPQA 3CWNA 2BX7A 5KMYA 2NUYA 2ZZ1A 3QMTA 4I7VA 3QM3A 1YDNA 2Y88A 3BPWA 2OX1A 1YXYA 3OVQA 3ZWSA 2QDHA 2QUUA 2JKEA 3W22A 1YDVA 2YPIA 1GTHA 4W9TA 3O05A 3MWAA 3TJLA 3BV4A 3E0IA 2VFHA 1YADA 2Q8LA 3SY5A 4JY9A 5D09A 3EXSA 2Y62A 4FNQA 3KRZA 2YCEA 3LRKA 1LTDA 2RHGA 3P74A 1VHNA 4LY8A 3UWVA 4AWUA 4LOCA 3KFTA 3LCWA 3EKLA 1J2WA 4K8EA 4WZHA 2A85A 3GB6A 3DFTA 4QIUA 1YDOA 4BI7A 1QOQA 4O11A 5K3VA 4Z0SA 1FXPA 3GLCA 3R12A 1AMKA 4ORMA 1CW2A 2DZTA 1OFOA 2EAWA 3NM3A 1VQTA 3LHYA 2YW3A 1TCDA 1QPRA 3QQ0A 3GAKA 3Q2DA 1KFKA 1TPEA 4R33A 3FKRA 5LHFA 4BI5A 4JEQA 2CZ5A 1UASA 4WY0B 3HG5A 1JUBA 1KM4A 1T8XA 2WSQA 2QJIA 1WBHA 5ABTA 4OWGA 4ZL1A 2TRSA 3GDKA 2YR1A 1EWEA 1OG0A 3NPXA 4N9DA 1AW2A 2PURA 3C61A 3DHDA 5T26A 2P0OA 5F4WA 3TDFA 4I7WA 3HG4A 1C29A 3MJYA 3RF9A 1VC4A 4WD0A 3PWAA 2DZPA 5HWJA 3MHGA 1LP6A 5KINA 5DY2A 2WNQA 4E2BA 5KZMA 2ZZ5A 3PBVA 4Q32A 1EPXA 3THQA 2CFFA 4UTWC 2ATMA 4P61A 2C14A 4AB4A 3MYPA 4RJEA 3R2GA 5L9FA 1QPQA 3HF3A 4O13A 3W70A 2NUWA 2RDTA 3NZ1A 3L2IA 2V2DA 2X1RA 3QW3A 4M6PA 4LTSA 4RLIA 4UFMA 2Y89A 3STGA 1ZAIA 1E51A 2X1UA 2W0UA 2BSLA 1G4TA 3GR7A 3IIVA 3SJ3A 4NUWA 1ML1A 3QFEA 4TR9A 4HNUA 5HMSA 1VRDA 2ZZ7A 1W1ZA 3U2OA 3IIZA 1LBMA 1O94A 1S5VA 4LVFA 1H7RA 1KFBA 4ZQCA 4LUJA 3LTYA 3IEBA 4ZMGA 3NO5A 4H4IA 1T0OA 4AHPA 4QQ3A 1G4SA 3KOFA 2G97A 5G2HA 3NQ2A 4HPXA 3HGOA 4KFPA 3LLFA 3G1XA 1SSDA 4JTUA 2FTPA 3A21A 1RQHA 3DFOA 3W75A 2C13A 5BW6A 4GNJA 4JDBA 3P5ZA 1TMHA 5CG7A 1S5TA 2DJXA 4Z08A 3TMLA 1WA3A 4ZQOA 2Y7FA 4H6KA 3GAYA 4PTNA 4GUHA 1KM2A 5E1QA 4UR8A 1I2OA 2E5DA 4WX2A 5DBTA 3JS3A 3QMSA 1R2TA 1W5PA 3G0XA 4RV8A 3TX9A 4ZQPA 3G18A 4RKAA 4JYEA 1K03A 2OZ0A 3LERA 3NG3A 4UUIA 5C55A 1BTMA 3T40A 1XBXA 4LV4A 5CPMA 4MY1A 4ZQRA 3NL5A 3UZ5A 5FF2A 4YCPA 1DVJA 3MW7A 5AYZA 3WJXA 1Q6QA 4N2YA 1W3IA 3M47A 4Z1AA 1QPOA 1IXQA 2ABAA 3Q94A 3LCLA 3WFAA 1VGAA 3P5YA 5SWUA 5DCBA 3BLEA 2DZVA 5FF4A 1W56A 3N73A 5AHNA 2ZA1A 2E5CA 3DKJA 2B7OA 3IVTA 4HNNA 4QSHA 3B0VC 1EB3A 3W7KA 1L6YA 2TPSA 4ORIA 3W07A 3N34A 1JVNA 2CU0A 4NNBA 4FXRA 1JCMP 3O6YX 3QH2A 4FNSA 2YXGA 3FEMA 3W2LA 1MEWA 3NQAA 1AW1A 2ZYFA 4U28A 1X7FA 4HNVA 4Y6GA 4NXKA 1G4EA 1RQEA 3NA8A 2B7PA 2GQ8A 4IX2A 3LOTA 2D73A 3LI0A 1TYGA 1JUEA 1TV5A 3HIJA 5AHEA 1Z41A 1W3TA 1ZAHA 1NSJA 1QAPA 3TNOA 1GG0A 3D0CA 1JJKA 1W5MA 2UV8G 2WNZA 2ZRWA 3PBWA 2WKJA 3W23A 2RDUA 5AYXA 4TX9A 4AHOA 3M5XA 3W7MA
chains in the Genus database with same CATH superfamily
3H2MA 2PBOA 4CD5A 4DN1A 1W17A 3CZGA 3VNLA 3K1GA 3SBFA 4KEZA 2V3EA 1X1ZA 1L8PA 4GI8A 3RJXA 3QXBA 4FX8A 3LHTA 2BXYA 3H7UA 7XIMA 4GKTA 2BY3A 4LANA 1H1YA 2VEPA 1HG3A 5FSEC 1E71M 3KRSA 3WDHA 4JCLA 4XKYA 3GC4A 1F9CA 1XKYA 4GISA 3MI6A 5HATA 3B9DA 2PF0A 2ZRVA 3WH8A 3BTNA 3WK0A 1OD8A 2F6KA 1ZTVA 4LWWA 1GZGA 2FB3A 4WSJA 5LHEA 1XLJA 3U5YA 5DT5A 4F2TA 1TE6A 2CHNA 4G7EB 3CHDA 2X0YA 3F4VA 3KBJA 5ECUA 3MKCA 2CZEA 3PZMA 4IFKB 3UD6A 4RW3A 3J7HA 4PCFA 2WJDA 2C18A 2HXUA 5H91A 4RUBA 5LIWX 3B4UA 2YBTA 3BOLA 3LCXA 4EXBA 1TR1A 4UOJA 3GD6A 5FF7A 1TWIA 1I60A 3TCSA 2F7FA 3BSHA 2XH7A 2ZDRA 1HIZA 2EG7A 4IPPA 1B3XA 2QXWA 2ZUMA 2VELA 1F5ZA 2QR6A 2VGBA 4TV5A 4H01A 4MFEA 1PHWA 5BMWA 4IMDA 4XO7A 2Z1SA 2NQHA 2ACUA 4YTRA 2XHYA 2W79A 3N19B 4NQ1A 1HX0A 2PPGA 3ICJA 1FHLA 5GNYA 1BWKA 3A9BA 1W32A 1DQWA 4LBRA 3S1VA 4KGLA 3W9ZA 4XQ6A 3CHVA 2GZXA 4UCGA 1UWQA 2HDJA 2FVMA 4PTWA 1NU5A 4GCAA 4ZSTA 4HA4A 1JZ7A 2DVXA 1J10A 3BG5A 1C90A 5T91A 3TLQA 4LCQA 4FIQA 3ZJ8A 4CVUA 4PUDA 2V63A 4HNOA 4RZ6A 1GQIA 1PTGA 1IF2A 2Z28A 3PN8A 4GYJA 1O60A 3QKEA 3EEGA 4QDPA 3PM6A 2VI0A 5G4HC 4D6JA 1H61A 4OUIA 5LNWA 1EJVC 3E38A 3TEVA 4B90A 4I5XA 2YL9A 2OX4A 3P81A 4OUEA 3O15A 3S9YA 4WOQA 2ONEA 6REQA 3JZUA 3TAOA 3BW3A 3UZJA 2FFIA 2BOEX 3DHPA 4M7TA 2A7RA 1UR3M 3BCJA 4JAWA 3GBDA 5I3HA 2GUBA 2OSYA 4C6LA 2DV0A 4P7RA 2I1OA 5KSWA 1EQPA 3WJZA 3WD1A 1KFEA 4KFOA 1TPVA 4FLQA 3HGSA 2PRLA 4MWAC 1X1OA 3WLRA 2QJMA 2J9XA 3HMCA 3EX3A 4FEZA 4ENLA 4S3KA 1IGWA 3OBKA 2ISWA 1QNSA 1ELSA 3IJ9A 5CZJA 5D2YA 2NLIA 3FAXA 1JXKA 4ICCX 4GOAA 3W1PA 3MZ2A 3SECA 3PJUA 2BNJA 2X16A 2VEMA 2ZX6A 1PX4A 2YB1A 1XDMA 1JI1A 4Y9MA 1ENUA 4WY0A 3CLMA 4IQLA 1HXJA 1E9IA 4JPGA 2V6AA 2Z6IA 3PUDA 3UG5A 3VK5A 3WH6A 5A2BA 3GXNA 3VCRA 2EKGA 3HPXA 4FALA 4UC5A 1XYFA 3MVIA 4HZ7A 3TTYA 5DBUA 3LB0A 3BJFA 1BQGA 3D46A 2V67A 3TTOA 2HBXA 1WKDA 1I1XA 1PUDA 3PZUA 3PAJA 3GFYA 3W38A 1KFCA 4HVXA 2WVVA 1L6GA 5B7YA 1XP3A 5I3DA 5D9OA 3AS0A 1OZQA 4DF0A 4JQ1A 3VMNA 1QWKA 1V08A 2WMIA 4ZB2A 3MSGA 3ZIZA 3MT1A 2FHFA 4NAEA 2E9LA 2R6OA 3DUGA 6ENLA 3IRDA 1IEXA 3GW0A 1DXIA 2VCBA 1B4KA 4EAMA 4H3DA 3RCNA 2VR5A 3MY9A 2V8ZA 5DQPA 3TZNA 4OKDA 3E2QA 3ME3A 1GZ1A 3A3XA 2C91A 2QPXA 5I7GA 4JICA 3F5JA 5LZLA 3OP2A 5CBJA 2QLYA 4Q4SA 2VVSA 3AJ7A 4UNLA 3NDOA 1JCXA 1SZFA 1T40A 1B57A 2QCGA 3DFPA 3VOHA 4P2VA 3UPBA 3G1VA 1WCGA 3GTIA 4JY8A 5CC5A 3DFHA 3WYZA 2OXNA 4CD6A 3WMSA 1KXQA 2CLPA 2C1GA 1E4NA 1S2WA 4IP5A 2ABBA 3N2BA 5LXEA 3GNDA 1FUYA 1IWBA 4H8HA 4H9UA 4XD6A 1T96A 3UYIA 1GUVA 1EEXA 2HVMA 2GSJA 3WDIA 3FA5A 4PL1A 1L9WA 4O17A 5AOUA 3ZOAA 2WJZA 4J7RA 3WZ0E 5AC7A 5FJUA 3OU8A 1T5AA 3FIGA 5E9XA 1WDPA 2GVEA 1MNZA 1VBHA 5D9PA 3O6CA 1JRBA 2WMJA 3SRHA 1XS2A 3VYLA 1PVNA 3BAXA 1EHAA 4U31A 4DLFA 4TMBA 3LX9A 3REQB 1PDYA 3WQVA 1JDDA 2QUNA 5LIKX 3S2NA 2PC4A 3T2OA 2YCLA 5H8UA 3NQEA 2INFA 4B5WA 1TCMA 2E68A 2GJPA 1KC7A 3MU7A 4DWDA 5LNSA 2L5HA 1UPMB 1VFUA 4AYSA 2CXGA 1SM9A 3NXLA 1GHRA 3RUBL 4KPLA 5JBEA 4M19A 4MOZA 4CCZA 2V81A 3LDVA 4FI4A 4N7QA 2V82A 4V15A 5C5YA 3K1DA 1KFLA 4FOJA 3B9NA 4NX5A 2SFPA 4DF2A 5D2TA 2QCHA 2W62A 3MMTA 2V5BA 4UZSA 4OHQA 4WJ8A 1UP2A 3B0PA 4UTKA 3UXLA 3WK2A 3O7UA 1VYRA 1WZLA 3CNYA 3E2VA 4N02A 3ARWA 4YHGA 3VDGA 1OC6A 3NEVA 5D02A 4GGBA 3U7VA 3FW6A 1GVSA 3PTMA 2ACQA 4XIAA 3SUVA 5CGQA 2R1NA 1N7KA 3DEQA 1I0DA 5G4WA 3BLKA 1D7KA 2WM0A 4S3JA 1W1TA 1GYLA 2WCAA 4E4PA 3NURA 3W7JA 5ENLA 1TTIA 3RK8A 2QJGA 2QCDA 3K13A 3TQ0A 3WBAA 2XN1A 1HKMA 1M7PA 3N25A 1Y0EA 1T8QA 4CKQA 4O0KA 5IBXA 2E77A 4KETA 3RM9A 3PBYA 3R79A 1EXBA 3SEPA 2A6LA 5I06A 2MNRA 3ABZA 2VD8A 2EPHA 3V0UA 3G8EA 4REQB 4MPQA 5AC8A 1SU5A 2HNEA 5CLTA 3W7RA 6TIMA 4CEUC 5HOSA 6CGTA 3P93A 1UD3A 1DYSA 1U2YA 1K4GA 3IK2A 1QI0A 3QRHA 1EP1A 3LTPA 4Z2JA 5A3HA 2P88A 1TJPA 1FX6A 1OQFA 3H2EA 3Q37A 3S42A 4BF9A 3W28A 2WKGA 1PZ3A 3OLEA 4FXJA 1TX0A 2X05A 1RUSA 3WLNA 5EKYA 2O4MA 1XD1A 1UWIA 1UD4A 3TQKA 5I79A 1OCNA 1OFRA 4C90A 2HPMA 2ISSA 1K9FA 5I0DA 4A2SA 3T8QA 1AZ1A 3EWZA 1PAMA 4DXVA 1DXEA 2Q09A 5LA2A 1TZZA 3TYEA 1CBGA 3TSDA 3UP8A 4GC3A 1QJWA 1LBLA 1H7PA 2Z24A 1VCVA 3QV6A 4AFYA 3MP4A 3LS9A 5JIWA 3KWSA 1RHCA 2NXGA 5G4EA 3NVTA 4EPEC 3NGJA 3QY7A 4C6CA 2HTMA 3ITGA 2P1FA 4BI6A 2VGGA 2VGFA 5JMUA 2NLYA 2X1TA 1CXFA 1JGMA 4MJMA 1IT0A 1W6TA 3CV7A 4EKJA 4IG2B 4GPNA 4E8DA 1E0TA 6ALDA 4B3ZA 1NH6A 4PSRA 1VBUA 2J24A 3BOFA 4GVIA 3MV11 1E43A 3GTFA 1I8JA 5FACA 3T81A 3SURA 3PZVA 3MKKA 4BQ5A 3POHA 4WGXA 4CVWA 4O8RA 2W9MA 3RU8X 1OINA 4FK9A 4XUGA 5A5WA 4A3QA 3VI2A 1A5AA 3E5PA 3W7OA 4IICA 2FDMA 3KOWA 3M43A 3LXBA 4UZUA 4PB3A 3O07A 5FA5A 4RXGA 4QJ4B 1EHNA 2I56A 4AY8A 1EJTC 3B8IA 4F0HA 4B5TA 4H7CA 3AIQA 4MKVA 1GZJA 1H11A 1OF8A 1EDGA 2ZE3A 1SSGA 1LBFA 5TBOA 4MB5A 5XIMA 1F76A 3W2JA 4C7GA 2CLHA 3BQ5A 3WG6A 2J47A 3VNDA 4Q3MA 4ERIA 3WBYA 1RXOB 3CL6A 1FH7A 4O4WA 3FSUA 1WKYA 3GDTA 2Y8VA 2F6UA 1D8WA 3DDMA 1UUOA 1V6WA 1JCYA 4YWIA 1QMLA 3CZJA 3M0MA 2FIQA 4B91A 2YDAA 1KV5A 3WJSA 4IGMA 1XGZA 4DPQA 1F4AA 4YCOA 1XLLA 1Z7AA 3W7LA 5XIAA 2YDQA 3U7BA 1G1YA 4IJRA 2OCZA 1BKSA 1QASA 4LEFA 3ARRA 3NUKA 3TONA 1CENA 3S9ZA 1V0NA 3UQNA 1OFDA 1OC7A 2IKHA 3D3FA 4M29A 1TZ7A 1ZFJA 3KXQA 4ALDA 1EWDA 3NOEA 3KWXA 3WLKX 2BLEA 2VO5A 2BVTA 1FDJA 2J6XA 1CGUA 4UFLA 1QNQA 4DI9A 1JULA 2Y8KA 4Z1CA 1IXOA 5REQA 5FIPA 4AMCA 4CCDA 1KW1A 1EJUC 3CS2A 3WQEA 4K68A 4S38A 4BF7A 1ISXA 4BR1A 2IPWA 2CBJA 2NXIA 2X2GA 1SFLA 1E1CB 2JBMA 5JBDA 5EFFA 1W3NA 3PVFA 4MB4A 3VOFA 1E4IA 2WMIB 3M4HA 3QOKA 5U4NA 3OYXA 4IM4A 2P3ZA 2PC8A 3SCWA 2ZQ0A 1QBBA 1OWQA 2NVAA 4NJKA 3A5FA 1VB9A 1AH3A 1PZ0A 3DAQA 1VCGA 2CNCA 4ZFCA 3VUPA 4H6RA 2G5WA 4D9PA 4LS0A 1PTAA 4AD3A 5A6MA 3JU2A 1SMAA 2ZX8A 1PBGA 3VZYA 1MXSA 3FKKA 3EA2A 1DL3A 4M51A 2GJRA 1YKWA 3DIPA 3W2MA 1UMLA 4OBRA 3KVJA 2Q01A 1FDYA 2YLLA 2VENA 1K8YA 4R53A 3UJSA 2HS6A 3EEZA 1H1ZA 3WF4A 1OF6A 5C6MA 4JN6A 4AVNA 3L9CA 2OKTA 3L68A 4QNEA 1QW9A 4JTSA 2R14A 1RCQA 1E4MM 1M5WA 3HM7A 4D6EA 5LIUX 3T07A 2X42A 3EA3A 2XVLA 1R3SA 1V03A 1HL2A 3OZYA 3VU2A 4QBXA 1VCFA 3KX6A 1GQJA 3WLQA 2UY5A 1WAUA 4Z42C 5D8ZA 4QP0A 2VXNA 3T08A 2VZVA 3VKKA 1RALA 1W31A 4JYFA 2AKMA 1XCFA 2XFFA 2ZXQA 4WQ6A 4UFIA 3M16A 1U5VA 3WMLA 2WMHA 1AL8A 4WLCA 3OEXA 2PTXA 4DO7A 1F3TA 4J40A 3G22A 3KBMA 2BWGA 1ZS2A 3BGGA 1BYDA 4Q6XA 4U3AA 2XJ7A 4RXFA 3TZFA 4O50A 3GYEA 3NR0A 4FNUA 2PDMA 1BTCA 1XDJA 3U4AA 1VFLA 4D6HA 1XUUA 1W54A 3ZR5A 2YJQA 3P84A 3IGUA 1W0MA 4DNHA 3LM7A 3L4VA 2HVNA 2VNCA 2NWSA 1F6YA 1W1IE 2NQZA 3IUDA 3FHAA 1VRXA 1FWNA 4WOZA 4NYYA 3BMXA 3LGEA 3HZ3A 1D9EA 3ANVA 4BF5A 4IIBA 4WF7A 2X0HA 2E6FA 4UTJA 4GXMA 5A8OA 2EPOA 3UT0A 3RLGA 4X9SA 1E5NA 1YTDA 4LF2A 4B9ZA 4MNKA 3O8AA 4JIEA 3P82A 1EKOA 1I4NA 2GK1A 2DIJA 5I07A 3N12A 3I3BA 5HNUA 2Y85A 3OIHA 1QRQA 3L7RA 1HUVA 1TWZA 1X8FA 3OHIA 4O1AA 3OZOA 5EA9A 3BWWA 3WCZA 1QK2A 2QCNA 4M3PA 2EJ1A 3S2LA 4BQ2A 4YVXA 4Q4MA 3MDUA 3WH9A 4C6NA 1PZ1A 1BSLA 3UVAA 1RVKA 2IKGA 4YTUA 3NPUA 1VH7A 2G8ZA 3QEZA 4I6KA 3WD4A 3WUEA 2ZRXA 4X63A 4F0RA 3C3UA 2BY2A 2VX7A 4L1WA 4AD2A 3TW7A 2XIBA 4PTDA 2ADAA 3GW3A 4AG0A 4IMAA 1YBQB 3BSGA 3LTSA 3HPZA 1GVRA 1SFTA 3AMGA 1VEOA 4BEUA 4GQRA 1F3EA 4DNMA 2J6VA 1ICSA 4JNYA 2J7CA 4OFCA 5HNNA 4DBEA 4CCCA 2V2HA 4CU8A 2VFDA 1Q4NX 3QC3A 4JHZA 4JXCA 4WKFA 2D2GA 4NNAA 3GR8A 1H5VA 1WZMA 1ONXA 3M0XA 1SW7A 1NOWA 3WFLA 4C7FA 5G1YA 3OGRA 1XG4A 1YDYA 5G1MA 1MI3A 3G2GA 2HE8A 2OWXA 3GDLA 3FA4A 2WCGA 3P62A 1B31A 3E96A 4MNMA 4HN4A 1KQYA 3BG9A 4J3UA 3GQYA 4K2SA 1F8IA 1LF1A 3LZ5A 1A5SA 1WKFA 1P0KA 3THAA 1GWJA 3VFCA 4WK9A 4AZIA 3VGGA 2PDXA 1TQJA 3W53A 4J35A 4NAFB 4J3XA 4E5TA 3RR4A 1IEWA 2P3EA 1A4LA 1DJYA 2C79A 2J9ZA 4EPKA 3GHRA 3CV1A 3IV3A 1WZAA 3WDQA 2Q8ZA 4ZTYA 3ZM8A 1E0VA 3WEMA 2DIEA 5ABEA 4RDVA 3SM0A 5CJNA 2CZDA 2CC0A 1HL9A 2O0TA 3DKLA 4UFJA 2ZZ4A 4QX4A 4BK9A 3VIJA 3BAYA 1RA5A 3JUGA 3DU0A 3RLVA 3W7NA 3W74A 1ZJAA 5F2IA 4S3EA 4QS5A 1HP5A 3TN4A 1NP2A 4HPGA 4NZ4A 4JFTA 1C8XA 1JPIA 2C19A 4XZWA 5I03A 4KCVA 5CPTA 5IRPA 1B30A 3IVUA 2Z26A 4JTIA 5AZ1A 1RLCL 2WSYA 1V6UA 2PWHA 4FR6A 3E74A 4F48A 3VXGA 3AWNA 2YIHA 2Q8XA 1ONRA 1K7XA 4X2PA 3L4ZA 1IEQA 1MRQA 3WN6A 1DBTA 3IJ7A 1M7OA 1JF5A 3CZKA 3WUFA 1CCWB 2Z1WA 1FWGC 3EKGA 2Y24A 3T2QA 4PBEA 1UJQA 4GQGA 3DZ1A 2YA0A 3M0VA 4JS3A 3R8RA 4ONVA 1OHLA 3I6EA 2J13A 4IOTA 3W27A 4IJBA 3L5AA 2IPGA 4RE2A 4TUFA 3QZ6A 4WR3A 2PCQA 2ZXBA 2A3BA 3O1NA 1AD4A 1Q7ZA 4LAMA 3HGRA 3SDOA 2J75A 1KA9F 1RK5A 4O53A 4EF8A 3CV6A 1SW3A 2X7VA 2R1KA 3UG8A 2PZNA 4PTMA 4AYGA 4KERA 2GPTA 3GVVA 3DX5A 1XYZA 4DM1A 1R47A 2TODA 3RM4A 4UTLA 2O55A 5HDRA 5TF0A 1E9LA 4MGGA 2ALDA 1R86A 1LT7A 3IGHX 3CHFA 4CD4A 1OSEA 3W37A 2WVTA 3PK7A 4I7UA 1IXNA 4W7VA 2Z0IA 1ITUA 2B31A 1A5MC 4F9JA 4LW7A 4L6OA 4CQAA 3HG3A 2P0IA 3MCMA 2Q71A 4GIEA 1O5XA 2GQAA 3AS2A 1R3TA 1X6NA 3GVRA 3KVKA 1WDWA 1E4LA 4K8GA 3MI3A 1HFBA 2Y6ZA 4PYSA 3VVGA 2OSWA 5CAKA 3QM3A 2Y88A 4EXQA 2V5KA 2BGQA 2OLSA 2G3JA 2PD5A 2BASA 2QDHA 1M65A 1UPPA 3AHTA 5E0FA 1GTHA 4W9TA 1RK6A 2ZUNA 4PTXA 3WNPA 1CEOA 2VFHA 2ANUA 2O4QA 3U4FA 2BFGA 2YCEA 1SVDA 4PBFA 1LTDA 1VKFA 3UWVA 4AWUA 4LOCA 3EKLA 4WZHA 2A85A 4QIUA 4IJCA 4NIRA 4O11A 4XSMA 2QULA 2XSAA 4R7OA 3ZVIA 5AY7A 1V6TA 4ORMA 1CW2A 3WF0A 3GG7A 2W63A 1QNOA 3LHYA 3KDOA 1W1A1 2OYLA 4WSHA 2YW3A 1TCDA 3ABXA 1KFKA 1RH9A 3FKRA 5LHFA 1XW8A 3KL0A 4DHGA 4BI5A 4CQCA 4D71A 2CZ5A 4ZO9A 1HKKA 4ZOAA 3U9IA 3HG5A 1JUBA 3ID7A 3TWAA 3PWIA 1WBHA 1QK0A 4UTFA 3UESA 4ZL1A 5D8WA 2P0OA 5F4WA 1C29A 3WF1A 3MJYA 3GH5A 1P1MA 2DZPA 4XISA 2XG9A 4E2BA 4IF2A 1CDGA 3PBVA 4KCUA 1XGEA 3AI0A 1FWIC 3ZVHB 2C14A 3MYPA 1I1WA 2FMNA 2HE5A 3F7JA 1W1YA 2WSPA 2X8RA 1FH8A 1A47A 1A49A 1ZAIA 1J9YA 4L5ZA 1E51A 4L7ZA 4QE4A 4J5NA 1G4TA 1ZP4A 2YBVA 2P76A 3SJ3A 3ZJKA 3VD5A 4RNJA 1ML1A 3WQ4A 2D0GA 2R82A 4U3CA 4HCDA 5HMSA 3LPPA 1W1ZA 1C7SA 2PWVA 2WBKA 4LVFA 5CQ1A 1KFBA 2VR2A 3SCPA 4ZMGA 3NO5A 3MUY1 2HVOA 1T0OA 2DUZA 4AHPA 5G2HA 3NQ2A 3PPGA 1Z9AA 2VD9A 3C0LA 3N15A 3BLOA 2DT2A 1TVNA 4HYWA 3KP1A 4GXWA 2Z1VA 4HCLA 1JNEA 2Y7FA 4H6KA 4XZLX 4KIEA 2A3AA 1IE7C 4UR8A 1XX1A 2YB4A 2E5DA 5DBTA 4A8NA 1BVWA 1R2TA 3FGCB 4GG9A 4ZQPA 1GOQA 3T42A 2QGYA 1O6IA 4M24A 4RPQA 4UUIA 4HTYA 3IAPA 2RUSA 3UZ5A 3NL5A 3TYZA 1JDFA 4KEUA 3L23A 3CASA 3WKZA 4N2YA 4S3GA 4LNCA 1VFOA 1NDWA 4DLMA 4Z1AA 3QC0A 2DW7A 1P7TA 1QPOA 1IXQA 1LUCA 3LCLA 3U48A 2A3EA 3P6LA 3LBOA 5SWUA 3EZ4A 3KRBA 5MKGB 4DRSA 2C1IA 3DKJA 2PDKA 1PXGA 3WBXA 4QLLA 1L6YA 3FCPA 2R24A 2I5IA 2DT3A 3GXDA 4PTVA 1JVNA 1GKRA 2VQUA 4H7ZA 3TC3A 3UGRA 2YXGA 4AY1A 3AYRA 3ARQA 1VJZA 2PWEA 1C8QA 3S1GA 1PKYA 4JTRA 1MZRA 2XGZA 2GQ8A 4IX2A 3LOTA 3AROA 4Q8TA 3LI0A 4IQDA 2ODOA 2OODA 2QVNA 1VBJA 2XVPA 4XG1A 2WK2A 5AHEA 4Z2LA 3MVTA 5DT7A 2DT0A 3TNOA 1BRLA 1GG0A 1MXDA 3TN6A 2X0SA 1EC8A 4TX9A 3M5XA 3VD4A 3LUTA 4OU1A 3TUUA 5D37A 3B05A 1Q6EA 3WNLA 4JOMA 1VBGA 2WO5A 3UJRA 1H09A 4LS1A 1T99A 5KTLA 5EYWA 3VKCA 2GUYA 1QI2A 3GFZA 3UETA 5I00A 3GY1A 3PSWA 4XZMX 2WBGA 2WXDM 4FNTA 1JZ8A 1XBYA 2JGQA 4P7LA 2QCMA 3EWBX 4UMBA 1YPXA 4HU4A 3A9IA 4HYRA 1JNDA 5LA0A 3IIPA 1MUMA 9CGTA 2EPKX 1X6LA 4H9XA 1VR6A 1ALDA 4O15A 4CU7A 2CBVA 3W25A 3IANA 3AXIA 3VE9A 1A5BA 2C1HA 2INEA 3MHFA 4KWUA 3RPDA 3SGUA 1TRDA 3TW9A 3SI9A 1KCLA 3F4DA 2A21A 3BK0A 5CBIA 3PZOA 3SUUA 3WBEA 3FEQA 2GVYA 4ZO8A 1AZ2A 4FLSA 4XBJA 4MWAD 2WC7A 1PIIA 1VZWA 3MKVA 4UQ9A 5PTDA 1GJUA 4UNIA 1CB7B 4S39A 3TJXA 1CTNA 1X7IA 1KRCC 2VRJA 2PU0A 2DZWA 1O5RA 1N8FA 3WD0A 4OBSA 5T9CE 2E67A 2INZA 3BV7A 1O12A 3PY2A 3CAQA 1MFUA 5TNVA 4FNPA 4Z2HA 3RFAA 3RDKA 3WQPA 3WX7A 4EXAA 4ATWA 1PKMA 3BGJA 1S2CA 3QHOA 3M0LA 2CERA 2WVUA 3ZWTA 3PFRA 3NWRA 3WNNA 1AQFA 3KCLA 2IQTA 3NQMA 4JCMA 4W85A 2G4JA 3FDKA 1JPHA 3SCQA 4F40A 5C9ZA 1C7TA 3NZRA 4AZ5A 1FWRA 2XIJA 3E12A 3W4RA 4A6GA 3B8DA 3DERA 3JRKA 3V5FA 2BVWA 1ZU8A 2FJKA 4C6KA 3N9RA 2VKZG 5EBUA 4ERAA 4H04A 1LG2A 1UR8A 1XIFA 2QV4A 2YXXA 1IT8A 4BHYA 1G0CA 3USZA 3UPWA 1UP0A 4F9DA 3H53A 5AVNA 5AHLA 5C8BB 4H7VA 1V4YA 4PMNA 1OY0A 5AECA 4UB9A 2WVSA 4Z0JA 3WDPP 1XJBA 5LNVA 4IXHA 3DYOA 4M6QA 3ECQA 1XV8A 1UH4A 2PDYA 1OYBA 1B3VA 4QG6A 3I65A 4NX0A 3T0AA 3TQVA 1SJBA 4ADUA 1PX8A 1ME9A 4DUOA 4HBKA 3SUWA 4O28A 2ZTKA 3WH7A 3CTLA 3PZNA 1UQYA 3W72A 4GWEA 1B1YA 2G95A 1DIDA 2YZ5A 1TPH1 1OEPA 2KAUC 1J0ZA 4DY1A 3AMLA 2GUUA 3GIPA 2EJAA 1R9XA 1AH4A 3P14A 3QQ1A 2A7NA 4RE4A 4QDMA 1EDQA 4CNOA 1LRNA 4FNRA 2G41A 4J3ZA 1DJQA 1AUSL 1OABA 3AU6A 2TSYA 3G6LA 4KKXA 4X60A 3N2OA 3G3MA 5CAHA 3E3HA 4UTTC 5EFDA 4HIBA 1NF0A 2YX0A 2FPVA 2PLCA 3BMWA 2V68A 2BOGX 3UJ2A 1OZMA 4AD5A 3REQA 3USBA 1LOLA 2RDWA 1YHTA 4GXPA 3I6RA 2ZA3A 4JQ4A 1S2VA 3TA6A 4NJJA 1ICPA 2F38A 3O63A 4K8HA 5A8QA 2ZOXA 4GKLA 1KM1A 3SRDA 5EMYA 3QV8A 2PDIA 4PCNA 4UQBA 2GGHA 3LN3A 2R8WA 3BUVA 2QAFA 2CLFA 3W7CA 4D6CA 1TVLA 4G1NA 4A22A 4DPPA 2BVDA 2G3NA 2YCJA 1VD6A 1L2UA 2ZXDA 2HWGA 3KAOA 1OK4A 4PRTA 4N6EA 1J01A 3WY1A 4MY9A 2BHZA 4D1IA 2V3FA 2NSOA 5HJYA 5FEXA 4CNPA 3GUGA 1R8LA 3C0JA 4FP1A 5E93A 4XK2A 3TFXA 3WEZA 1UH2A 2EPMX 3LBMA 4NZFA 1TX2A 1RQBA 3UWWA 2CXEA 3VIGA 1R46A 3PBUA 2YZRA 1UMYA 4YPJA 9RUBA 1KTBA 3DG3A 4UWMA 2CZFA 1V8EA 1DWHM 4DO6A 3R43A 1OM0A 2RFGA 3WQ5A 3H54A 2DSVA 3ONCA 3S5OA 4B5NA 3SCVA 1EOMA 3POCA 4PH6A 2X41A 3C8NA 5EPDA 4AVFA 1D3CA 1Z32X 4WDWA 3BZJA 3EWWA 4RE3A 2WZIA 1Q2RA 3B03A 4WDTA 3CZEA 4AZCB 3GVGA 5C9XA 4LALA 4GIAA 3V3WA 2OG9A 1KM3A 1ZB5A 1KRMA 3M41A 3LZ3A 4X0VA 3FGCA 3E2RA 4TX6A 3WMCA 1XFBA 2XM1A 1EO7A 5HMDA 1UKPA 1BGGA 5D30A 3M6YA 3S2CA 4D8AA 5C7VA 5HUPA 5C2GA 1M04A 1ISZA 3GTXA 4PN2A 3QHNA 3NDYA 1EO5A 3RLHA 2E3ZA 3I6TA 3H12A 2FB2A 1VS1A 2XH0A 2VWTA 4QAIA 4JYDA 2YW4A 3NQ6A 1XCWA 1CECA 1E1FA 4W93A 4ZR8A 3G1FA 2PAJA 1IR1A 2QAPA 3DFYA 5AC6A 3S6OA 2GYIA 1JYVA 2O7SA 1BD0A 3DFSA 2ZX9A 4IPNB 1KM5A 2DPEA 2E28A 3W2UA 2I9UA 3K46A 4Q7IA 1XLAA 2PBGA 4N6FA 4YHEA 4N0RA 3UWQA 4A21A 1W1B1 4PUUA 4MYXA 2PDNA 2IQ0A 4G7FA 4GJJA 3NAVA 1QFEA 1TV7A 4IG2A 3T7VA 5GNZA 1WQ5A 2HMCA 1Q63A 3E49A 5A6TC 1ISVA 1LDCA 4C6EA 4FSAA 2XPKA 4XTIA 3NQGA 1B90A 2HS8A 4UFHA 2V0TA 2WSKA 2CKSA 1QOXA 1QPNA 4IMCA 3H22A 3R7MA 2FTYA 2QQ6A 3BJTA 4A3YA 1BF2A 1XBZA 4DUVA 5D04C 1EYEA 5BMXA 3BICA 2PZ0A 5JH1A 3TOPA 1DQUA 1ZL1A 4MAZA 5A8NA 1DJHA 2YYTA 1ONWA 4PBGA 4FF5A 3FJ6A 3A5VA 3RHGA 1I2QA 5ABGA 2V38A 4GI9A 3UXAA 3AWOA 3AZSA 2BTMA 5BZAA 1PCKA 4HK6A 3QQWA 2TYSA 4Q8OA 4AXKA 3V5CA 3I7QA 1TB3A 2XM2A 1IZJA 4J28A 4MWAA 5M17A 3AIBA 3UZYA 4ZE4A 4PUWA 5K9XA 3UF9A 1OYAA 4HD5A 1XRTA 3TN5A 3A4AA 4ROQA 1QXLA 1R2SA 4C65A 3NQFA 4JR5A 1XD0A 5TD4A 4GQBA 1C92A 4V1XA 3EGJA 1D8CA 4F0MA 1H7NA 3AIEA 4TOQA 3WD2A 5DMLA 3TJIA 3PR2A 1BG4A 4HMCA 5IFPA 3NQ8A 1OT2A 3IJQA 1PPIA 1NELA 4RDWA 2O9PA 3NGFA 1SZGA 1Q5MA 3C4UA 4M6UA 2WMGA 5A8GA 4HZMA 3Q4DA 3R25A 3W0KA 5M3WA 4JKMA 2PI6A 1JDCA 1MO0A 2Z2AA 1W8SA 3DBNA 1UWRA 5K9DA 4CQBA 2FMOA 2PGWA 4R27A 3CPGA 3HPAA 9XIMA 4WY0F 2DZBA 4HSHA 2VZTA 3MO4A 1KLYA 2CKRA 2VX5A 4XKMA 2AGKA 1I2NA 1YTEA 4C6QA 5REQB 4GGHA 4JX5A 1M01A 1E6QM 1XIMA 2Y7DA 3LCGA 5FF0A 2OOGA 3PS7A 4E0CA 3IS4A 2IQDA 1EJRC 5EL1A 4JFWA 4AXNA 5JQ9A 4QFUA 2VFIA 2OLAA 3CQJA 2W66A 3KS5A 1CWYA 5AKQA 3ARTA 3P61A 4PB4A 4L6HA 3B8VA 5D9NA 1GQNA 4I9MA 1GORA 5BWFA 1W3LA 2DZXA 2CWNA 4OJYA 1EIXA 2VZSA 3GIQA 4YTQA 1KR1A 2A7PA 2EEXA 3AOFA 4M81A 2XVGA 4OV4A 2JFEX 1KCKA 3MSRA 1HL8A 3MQTA 4L9YA 4KMQA 1S3HA 3EDDA 7ODCA 2PODA 4LEQA 4QE1A 4NZ1A 2W92A 3VOCA 2WZHA 3LY0A 4U5KA 1S5WA 2R1LA 4MJ4A 4C6IA 3TTEA 2I17A 2ZBTA 4W86A 1VPXA 4XSLA 5CPNA 3KCJA 5C71A 3UR2A 3OA5A 3EDJA 5E0KA 3AC0A 3BAKA 1SZRA 4JHMA 1NF7A 4BQ3A 2OWWA 1QHPA 3H2AA 3HTWA 3MHUA 2GWGA 1DXFA 3FHQA 2PDWA 1W37A 4ZOEA 1C93A 2E6AA 5CSRA 4KT2A 4LY4A 3QPYA 3U2CA 2UY2A 4DI8A 1TIMA 3DYMA 1IWAA 1JDAA 2FZ8A 4N9EA 1Z89A 4O57A 3W73A 3ARSA 4LVDA 1O66A 3M9YA 3ARPA 3MCNA 4IISA 2QMJA 2ZIDA 2E09A 3S3GA 5GNXA 3L4UA 2IXUA 3ELFA 3VCNA 1S5MA 4B5XA 4F2BA 4UQAA 2D69A 2NSXA 5LA1A 1W9UA 4W7WA 3CIWA 3N4EA 4UTMA 5IM51 4QS6A 2REQA 4FB7A 5KITA 1M41A 5FESA 4MB1A 4MFDA 3VNJA 1GEHA 4JFSA 1KQZA 2DDXA 3BXWA 5KZDA 2G96A 4W8LA 4DBSA 1J0YA 1BG9A 4PRRA 4GFIA 3HOJA 4CNUA 3S1UA 4BS0A 3NYZA 1RBOB 3NXFA 2FFCA 1VIWA 4EK7A 3BAJA 3B0YA 3GNPA 4FR1A 2HRWA 4B2DD 4NSBA 4BWLA 2DEPA 3SN4A 2AKZA 3W1LA 3CLWA 1SZEA 1JZ2A 4GK8A 1M03A 2D22A 2CHOA 3UXIA 3FFSA 3PB0A 3H8AA 2WJEA 5G2IA 3ONBA 5FI8A 2PP1A 5JU6A 5LNRA 2J4GA 4XZBA 1JQVA 4IHCA 3OGSA 1REQB 2O9TA 1V02A 1IIHA 4AEEA 1ZCOA 5AYYA 2QPUA 4B4FA 1NFBA 3PTKA 3L5MA 2X09A 1UD8A 1KV8A 1A0CA 3TC6A 4E38A 5CC6A 5IDZA 1C9DA 3ITTA 3DH7A 1DIKA 2QIWA 3G1DA 4K6AA 2OZTA 1XIGA 3MUXA 1AD1A 2Y7GA 1OFPA 3G0UA 3TN3A 2CW6A 3UCCA 2NX1A 4G5DA 3EYPA 4AIUA 1TRIA 1I9CB 2XISA 1QDSA 1LLWA 1J93A 1XC4A 1HKIA 4L64A 2VRKA 3TYBA 1FCQA 3GDRA 1RBAA 3QSRA 3RM8A 1US2A 3URAA 4E2OA 1FXQA 2PGFA 1H7OA 1JL8A 3GNXA 2YCIX 1FCBA 4GX8A 4MYAA 1AQHA 5I3JA 4DUWA 4N9BA 3NL2A 4NF7A 4A2RA 1RSCA 1NDZA 3EBVA 5ABHA 1ZENA 4K1WA 4Y9OA 3Q45A 3T9PA 2ACSA 1EUNA 2LLEA 3ATZA 3AALA 5AHIA 2PCEA 1S3TC 3VOIA 1V7YA 4U2ZA 3IVSA 3N17A 4LUYA 1JCJA 2GDVA 3I7SA 5I3FA 1H60A 3EOUA 5AYBA 3BE7A 4GQQA 3UG3A 4DBWA 3M44A 1P43A 4GINA 2Z1XA 2WV8A 3SQSA 4NAFA 3UZZA 2PRHA 4O18A 2NXHA 2ZC1A 3VNYA 2PS2A 1F07A 2JKAA 2YA2A 3VMPA 4XB3A 4WCJA 3MZNA 1XLIA 4Y8FA 4YMZA 2I16A 1UBPC 4UQCA 3W86A 2J27A 3S83A 3WQDA 1GOMA 4JTAA 2OSXA 3E0VA 5DMNA 1JR1A 4G6CA 5ECVA 3AXMA 2C3ZA 2J8GA 5TAOA 4IXXA 3CIXA 1RP9A 2NQJA 5BXTA 5D03A 3CL8A 3UR8A 4KWWA 1FFQA 3KTXA 2IKIA 2VM8A 3QR3A 4ECLA 3N6JA 2YGYA 2QCCA 4MZ1A 3SRFA 4HQVA 1LLOA 1WZKA 4AEFA 4BJHA 1AH0A 4D1JA 3AUOA 2R9RA 1HO4A 1CGWA 1HF6A 3SZ8A 5C9RA 1JD9A 4WDXA 4R5EA 1R3RA 1W2PA 1LROA 4JN8A 1MEIA 3WK1A 3EWUA 3BLPX 4ZA0A 1IZCA 1WOBA 3ANUA 2AAAA 1N55A 3CMJA 3VD9A 4GBDA 1X96A 2EQDA 4W7UA 5T9BG 3N14A 4JNMA 2ICSA 1GPWA 5IOBA 4GFSA 4NILA 1V79A 2YSWA 2OYMA 4YS1A 5C70A 3U3HA 4ZTXA 1O5QA 4ACZA 4FXSA 4LJ3A 3MTWA 2QCDB 3M5YA 1PDZA 4M6VA 3BLDA 3GS6A 4A05A 4YU1A 1GT8A 1V3JA 4YVPA 5FOOA 1XIJA 2PFHA 1FHDA 1XPGA 5E5CA 3WQWA 2NX9A 2WW5A 1OJXA 4J3TA 1XDLA 3EDEA 2VDHA 3ARVA 3T1GA 3DI0A 2Z4GA 1UP3A 1UKTA 1J12A 1WX0A 3TYUA 1KKOA 3L65A 3S5NA 3P67A 4UCFA 2W27A 1NM9A 4IUOA 4I9JA 1JCTA 1UOKA 4OGZA 4DEFA 4OE7A 4NKCA 3W1AA 2WYSA 4HMEA 3CGTA 2V30A 1GVOA 1FHUA 3N13A 3PZQA 3W7DA 4GYPA 3CB8A 4LUTA 2OYKA 2PEVA 2OO6A 5FJPA 3S9IA 3TWBA 3W26A 1U1JA 1JAKA 6TAAA 1NQ6A 3LPGA 3VX0A 1BAGA 3G0SA 5BXRA 3LU2A 2HISA 3S8HA 3BCDA 3CMGA 1K9TA 1P5BA 4IZGA 2JKPA 3SQMA 1PEZA 4PCPA 2ZRUA 3W1TA 2B7QA 4IIFA 2QIIA 4GRSA 1TWSA 3UR7A 4GACA 1TA3A 3IARA 4S3AA 2VFGA 3RLUA 4LS2A 5GQBA 5JVLA 3SADA 1LM1A 3A3HA 4HNLA 4DZHA 3W85A 1IHIA 5I23A 3WNMA 4HU0A 3M0YA 2QKFA 3H2FA 4QM1A 1R6WA 3UCDA 1UYQA 3KDNA 2FZDA 2PE4A 2Z27A 3BURA 5CZTA 5BOFA 4H6QA 1JZ5A 2F2HA 2AQOA 2Z7KA 2HCVA 2VT0A 4ZQNA 2WC3A 4NT0A 1HVQA 3FAWA 1HJUA 2QJNA 1JUKA 4UTIA 1BKHA 1A5LC 4OVXA 4PC8A 1TR9A 3N2MA 4NJGA 5DN1A 2BS9A 8XIAA 1A5UA 1DKWA 1K8CA 1WXZA 1UH3A 1ZZMA 1HGWA 2DJLA 4KEMA 3R1ZA 2J7GA 3M5VA 5F2GA 3P8JA 3EX4A 1SUXA 1V02E 3QR1A 1EZWA 1QHZA 2YXOA 3PG8A 3MMDA 2Q02A 2VEIA 2HJPA 2UWFA 4RX0A 4S1FA 3ATYA 3HFTA 4WXZA 4K7VA 4WUIA 4GX9A 5BRPA 3EXTA 2VC7A 1D3GA 1QU4A 4RR4A 3R58A 4QEEA 3EX1A 5XINA 2Y5SA 7A3HA 4DO5A 1VP5A 1YRRA 1LWHA 1UB3A 1M9HA 1WKEA 1TO3A 2OQHA 2CHRA 3GC5A 1SQ7A 4ZO7A 3G3DA 3W1RA 1CXHA 3B9EA 4TXEA 1BHGA 5TQLA 3EB3A 4HHMA 1QW7A 4KS0A 1W91A 1R3WA 2RAGA 1EUAA 4CLMA 5ABFB 3Q58A 1A5NC 1JPKA 1H62A 4NZ3A 1YLVA 3E2SA 1PO9A 3EWYA 4QXIA 1T7LA 2XZ9A 5E70A 3PWGA 3ARYA 3LSCA 3NEHA 2XINA 1B5TA 4DJDC 1OX4A 3IWPA 1U22A 2FQIA 2H6RA 1GOOA 2PDCA 2PTYA 3F4CA 4JIRA 1P0DA 3S0CA 4L4OA 1TWWA 3ABSA 4PR4A 3LCFA 4EF9A 4DAFA 3M0JA 1UR9A 4GZ7A 1L6WA 3C2VA 1PCWA 3BH4A 1SPQA 2NUYA 4Q4OA 2FVKA 3BPWA 2E0PA 3GTHA 4I3GA 3SN1A 2J7FA 3W22A 1XIEA 1HJWA 2ZE0A 3GU2A 4FS9A 2YPIA 5HK4A 1H3GA 3L4YA 1YADA 1QNRA 3SY5A 1FWJC 4WDUA 4PFHA 1VFMA 1XLBA 3QLDA 3KRZA 4FNQA 2ZVRA 1GKQA 1TKKA 2RHGA 1RY8A 1S2TA 1VHNA 5HQLA 4DJFA 3LCWA 1K6WA 3NTYA 2W4XA 3OTRA 3DFTA 1JYXA 4BI7A 1YDOA 2GJXB 4GVHA 1UW9A 4AISA 5MKGA 4Z0SA 3IUHA 2EPLX 4LSBA 3GLCA 1XWYA 3URQA 1K1DA 1XPYA 1OFOA 3NM3A 3SY8A 1QPRA 3IJLA 3QQ0A 4FPSA 3TYDA 1TPEA 3UZWA 2VL4A 3WLOA 1A3WA 1UASA 3UPMA 1US3A 1T8XA 1KXTA 4DWSB 3NCOA 3QTPA 1YNQA 1EJSC 3P3BA 2IUZA 1ZGDA 2YR1A 3SCOA 4AZBA 4GA8A 1OG0A 2XFRA 4N9DA 1AW2A 3C61A 3DHDA 4GH1A 3UU0A 3V4BA 1GYMA 2BY0A 3CZLA 2CYGA 3EMZA 4KH2A 2BV9A 1ONEA 1VC4A 1UG6A 5HWJA 1GOIA 2WNQA 5KZMA 4HPHA 2ZZ5A 3N2CA 4Q32A 3AYVA 1UHVA 4P61A 3VPLA 3IJIA 3QV7A 1FVPA 3CZ8A 4RJEA 4TV6A 1QPQA 1GW1A 3SGGA 3ZMRA 3W70A 2NUWA 1RAKA 3PPFA 3L2IA 4GZIA 2DSKA 4UFMA 2Y89A 2X1UA 3HN3A 1POJA 4PMRA 1DWGM 1UA7A 2WPGA 2OPJA 3CAWA 2GLKA 5A6JA 2EG8A 1TZ9A 4W4QA 1UC5A 4ILSA 3LLXA 2F8QA 2ISFA 3H4GA 1ZJBA 5FAGA 1O94A 1NJJA 3WLHA 2QDEA 3NJ3A 2R1MA 2GK1B 4H8NA 3HURA 4H1ZA 1E0XA 3CXOA 4QSFA 4C7DA 3CUZA 4HPXA 4TVCA 3D5HA 4GYFA 4JTUA 3UA4A 3DFOA 5BW6A 4GNJA 3U57A 1A80A 1BGAA 3TMLA 1WA3A 1TG7A 3THDA 3GAYA 3LA4A 3T0BA 1LWJA 3W6LA 5CJMA 2NQ9A 1JYNA 2RGLA 4RV8A 3TX9A 3EDKA 1Q13A 2OZ0A 1BYBA 3LD5A 3OHMB 1BTMA 3T40A 1XBXA 4IP7A 4MY1A 1JIBA 3WQ6A 5FF2A 3A4JA 1R85A 5A6KA 3MW7A 3NZGA 5AYZA 1VEMA 5JUVA 3OQEA 1JZ3A 3WJXA 3S6TA 2FYMA 1W3IA 4WGHA 4LYPA 1OCBA 2ABAA 3WFAA 3P5YA 4LCSA 3M64A 1W56A 2E5CA 1W3KA 2W67A 3IVTA 4HNNA 1RD6A 1TJ2A 1EB3A 2IXVA 2TPSA 1EF2A 1J96A 1Z3NA 4MADA 3W07A 3N34A 1V51A 4NL1A 4FXRA 4L80A 5HPOA 4NP7A 4V28A 2JF6A 4G9PA 4P8VA 2FVLA 3NQAA 4D6GA 4LAUA 2FGLA 1X7FA 1G4EA 3WLPA 1RQEA 3NO1A 1UD5A 4GO8A 1BQCA 3T2PA 4C1NA 3DECA 1Q6GA 1JUEA 1FWFC 1Z41A 1W3TA 2OGYA 1NSJA 4X9YA 1F61A 2Y8UA 3KBNA 4BEQA 2PUZA 1FWAC 4Q8UA 1X39A 3PBWA 2RDUA 4GO9A 5AYXA 1SJCA 1AW5A 1AA1B 1ADSA 1WOAA 3SCSA 4MSSA 1YIXA 3MV01 4AW7A 3WBWA 5I24A 2DZUA 4H19A 3T8LA 3C6CA 3SUSA 3HBLA 5FL0A 1LCOA 3C8FA 1FWDC 1JPDX 1KRAC 1QOPA 3HJEA 4FXFA 3PJWA 4O1EA 4WIWA 2BP1A 1EP2A 2ZCGA 3UY7A 4AEOA 1TREA 2YYUA 2BVYA 1UCWA 3R5EA 4Z17A 4GNKB 4O54A 3QFWA 3UERA 4IMFA 1GEQA 4POCA 2CLEA 2DY3A 2Q3OA 3KRUA 4XAGA 1AQMA 4DIAA 2JEPA 3FYYA 1MXGA 3O16A 4N42A 5I02A 4IX0A 4MMWA 2PGEA 2ISVA 2QJHA 3EB2A 3TW6A 1U83A 1ITXA 2VC9A 3VGFA 2J8FA 1W3JA 3W1MA 2BHYA 3WDJA 3M5ZA 4RPPA 3WNKA 3CK5A 5D32A 4DAIA 3MUZ1 1OD0A 3ZZ1A 3U8GA 2NV9A 4R9XA 3TVAA 2ZA2A 1GOWA 4H8UA 1AMYA 3W7GA 1Y8BA 3VGHA 4R88A 1FWWA 3UWYA 2OT1A 4DYKA 4Q8WA 3DYPA 5AVHA 5EMJA 4RL3A 2GJNA 3ZLGA 2PMQA 4AX6A 4GVGA 3VFLA 3W00A 1BVNP 2QMKA 3BAIA 3SN0A 2FGZA 5I3KA 3VD7A 3NM1A 3LENA 4CQ9A 4YL2A 1LQ0A 5A2CA 3TJ4A 2DQXA 5DXXA 3T44A 5LXXA 4D6FA 3W7PA 4QGCA 5C2CA 4NY2A 4PMDA 3ITCA 3JVAA 3R4IA 2E6YA 3G1HA 4O0QA 3ZJ7A 1H7XA 3O6AA 2A3LA 1TPFA 4AIBA 2JIEA 3I10A 5ABFA 4IGNA 1JPMA 2CLMA 3CT2A 1K7EA 3F4WA 4S2BA 3EX6A 2OQLA 1ME8A 3BW4A 2XGBA 1K02A 2ZZ6A 3ARUA 1G6CA 1GQKA 4HMNA 3EAUA 4UBPC 1NWTA 4H9MA 3VABA 5D33A 4HPJA 3VIKA 4DJEC 3HMJG 4YNGA 1H7WA 4AQLA 2QCEA 4AIOA 3C52A 5HJLA 2QDDA 1O1HA 4C6PA 4IGHA 4YTSA 2F6XA 3CEPA 1J11A 2VJXA 4ZENA 1ZAJA 4A35A 3CQKA 3NQVA 3FS2A 2D3LA 1OT1A 1TMQA 1KBIA 3BG3A 5DANA 4HNTA 1T6MA 5CLWA 3EWXA 1CGTA 4JX6A 1ZJIA 3AJXA 1G01A 1V7AA 4XZNX 3PUOA 4HA1A 4LVGA 4K39A 4D8ZA 3NSMA 2BB0A 1P1XA 2FTWA 4XKYB 5KZEA 1XIIA 2J77A 5IDIA 1KFWA 1ZHAA 4NZ5A 1W8GA 4YXGA 1KWKA 3P2VA 4UQDA 4PMYA 1DJNA 3SQLA 3RPTA 4R34A 4AD0A 3MP3A 4G7EA 1N8WA 2W6RA 4LC8A 2BODX 1FA2A 1F6PA 4IFKA 5CZ0A 4BKNA 3B97A 3LMYA 3ISIX 4LQ1A 1QI4A 1OGBA 4JIQA 5KZ6A 5C7HA 5F4SA 3VO0A 3VIPA 4YN5A 2POTA 3EX2A 3RGTA 4PL2A 4GUGA 3VCCA 3KP0A 2W3ZA 8TIMA 3GXMA 1B3YA 2PP0A 5A6BD 1ODZA 1TFVA 3VGDA 1A3XA 3AHVA 4L4LA 1UKQA 4NJIA 4KWOA 2XZ7A 3W7QA 3WL0A 4IIEA 2FJUB 1NDVA 1XLDA 4XAFA 3JW7A 4KBXA 3QPEA 2TMDA 2FZBA 1YE6A 1ZRQA 4EX4A 2R1PA 2IPFA 2ZTJA 4LYQA 4DM2A 4K38A 2HK0A 4IL0A 2FZNA 1DV7A 3NO3A 3C2EA 3OBEA 3I68A 1FP9A 3RRAA 1ZBCA 1EEPA 2BHUA 4P5UA 3T4CA 3ITOA 2F9RA 3QZAA 3PANA 1QO5A 4MUPA 2GVLA 3KZSA 4PULA 2GVJA 3N4AA 1HTIA 3QLLA 4C6FA 1K3UA 4UXDA 2CLKA 4FOUA 4DUXA 3GU9A 2OTDA 5A2AA 4DZIA 1XQKA 4INFA 2RGMA 1VLWA 4O8AA 3AQUA 2QEZA 1WPCA 4G8TA 2E9BA 3F5KA 3GU1A 1C8VA 4JTEA 1P4CA 1TVPA 1OK6A 2FZMA 2R91A 1I75A 2PLJA 3VOJA 1CB2A 3V36A 4M7SA 3R89A 1U33A 2ZX7A 2J7DA 1SFSA 2V5JA 3QVQA 5EY5A 4AWEA 4GE8A 4XIMA 4UQEA 2HROA 2C6QA 3HQ1A 3LV6A 1FBAA 3QV9A 4HJWA 3TK7A 3BO9A 2A0NA 2FHCA 4FX7A 4RDZA 5FJOA 2UZ9A 2Z00A 4D6IA 1FCVA 4Q8MA 2ZUSA 4J4KA 1VJIA 3LQLA 3G1AA 4QDWA 2DFAA 4Z2KA 2ZRYA 1V3IA 4MWAE 4F79A 5B7ZA 3WJWA 4JFVA 3WLJA 1CGVA 1FKXA 1SO3A 2VGIA 2YFNA 1A4MA 2JE8A 1YXDA 3OVGA 1GW9A 4A29A 3S2MA 2AMGA 1JFHA 2FKPA 1XYLA 1YQ2A 2OLHA 3SFWA 3HQOA 1RLDA 3BOXA 4Y2WA 2QPSA 2DIKA 3KOXA 4B3LA 4IP4A 4DO4A 1Y5WA 5DCDA 2HXTA 1KTNA 1R9ZA 3H23A 3VNMA 3T78A 4MJ2A 4JKKA 4ZGYA 1Q6FA 5BCAA 3ZJ6A 4AC1X 3W84A 2PDLA 2Z2UA 3AHXA 3F2CA 4Y8EA 2C8NA 3VKAA 5EU9A 4E3VA 1GHSA 2C71A 2QVHA 4Q4PA 5FKYA 4FAMA 3GKAA 1SW0A 2WNNA 7TIMA 1IQ8A 4X3ZA 3COTA 5IXEA 3PPHA 2QCLA 3AXHA 4JQAA 1X38A 2J9YA 4EOUA 1KGXA 2Y70A 1EPVA 2QHAA 4K37A 3P7YA 4EWND 1PHQA 5CH9A 1KGUA 3CAVA 1KBKA 4Q22A 1X1NA 1DJGA 3W71A 1DOSA 1SR9A 2EF9A 3H55A 1W3HA 3L0GA 4P8XA 3RJYA 1G7VA 2GQ9A 4B15A 1EDTA 3W82A 3VDCA 2PDJA 4MDOA 4O52A 1Q7MA 1W5NA 2Y0FA 3FVMA 1J0JA 4G2DA 5DMYA 1E0UA 2MUCA 3CYJA 4QITA 3VMOA 4EIVA 4LYKA 4HOXA 3IUIA 2FH8A 1DHPA 2CETA 2DUXA 1FFRA 3INPA 1YMYA 3SCRA 3BC9A 1KR0A 4I5UA 2Y63A 1LOSA 5HUOA 4HTBA 1E73M 4XD3A 3R0UA 4GY7A 4PA8A 3URBA 2HBVA 1R7AA 4GI6A 3FNDA 1U5JA 1VF8A 1O95A 1OB0A 3IK4A 2WQDA 5EMKA 4JD4A 2EKCA 4DJFD 4ICNA 3V16A 1YTKA 3I7RA 3A47A 4GBUA 3K8LA 4GZEA 2D24A 2PWFA 3FJNA 1KBBA 4AAJA 8RUCA 1HO1A 2Y7EA 1FRBA 1ADOA 1PJ9A 3B4YA 1BEUA 1VFSA 4FLOA 5A6SA 1VIZA 4P7OA 3MS8A 4RDYA 4NZJA 4V1YA 1ZNNA 4CQ8A 5GJNA 3NZPA 3VOGA 4GHRA 3KBWA 1UBSA 4D8LA 4GUIA 3NL6A 3C0QA 2P50A 4HK5A 1MW2A 2J7EA 4RV3A 1XH1A 3I4EA 4A3HA 1XYMA 3CIVA 4KRUA 4UTUA 2H3DA 4F66A 1FHVA 1CGYA 3STEA 2CLOA 3G8RA 4B5UA 5FEWA 4GCXA 2VTFA 4DJDD 4JTLA 1RJPA 2VVNA 1R0MA 2GDUA 4HOZA 4IIDA 1TTQA 1ESWA 3L66A 1QATA 4LV9A 2VOTA 1L2QA 1W1PA 4MZYA 2AQVA 5FF3A 2OQYA 2Z25A 3S1WA 4S3DA 4LU0A 1IEVA 1PKLA 1ZY9A 3LNMA 3F1QA 2IW0A 1O4UA 3LGDA 1PE1A 1US0A 3ZS4A 4IMEA 2HK1A 4ATDA 4O0ZA 4Z1DA 3BLLA 1JQXA 3RCMA 4J9JA 1AJZA 3W88A 4ZODA 1G4PA 5EB8A 3S1XA 3VGBA 2JQXA 3E0LA 1FP8A 1TUXA 4QAWA 3RYSA 4FA3A 1NTHA 4YYCA 3UCQA 4KF1A 2VEGA 3CUJA 3G6MA 1KXHA 4LBUA 1KB3A 4HU8A 4O16A 3ARXA 4U5IA 1DIOA 1XRSA 4W84A 2I57A 1E56A 2P8CA 4FZIA 4FIRA 1NARA 4F0LA 1MQPA 1R9YA 1R2RA 5HQEA 2QNEA 2V5CA 3W6YA 2IMRA 1J5SA 2J62A 2GSHA 3RO8A 3MJMA 4HJFA 4B3KA 3D6NA 2D23A 4S23A 5MF5A 2VC6A 2O9RA 1OFQA 4IQEA 4F0SA 1JRCA 1DWJM 3VTRA 4TQTA 4Q8VA 3G1SA 3GE7A 1SZNA 1AJ0A 2D1ZA 3R11A 1R30A 4C6DA 2DSWA 3H2OA 4HMDA 4XTDA 1V77A 5D2WA 1B2YA 3AXKA 4LYRA 4WHBA 1TJ0A 3TMQA 1M7JA 5BRBA 1BXCA 3UXKA 3E5BA 1H50A 1SO6A 4JEJA 1ZJHA 1ZBWA 1GQLA 1DJWA 4PGLA 3FXYA 1FCUA 2Z1BA 4AD1A 1N82A 1JFXA 3UG4A 4OIFA 2ZRZA 3E0FA 4PMOA 4ROPA 2BGSA 4ZOCA 3GX9A 3AU2A 4NNCA 4L9ZA 4KIRA 2WLYA 1XQLA 3W81A 3OB8A 4AZ7A 4RE0A 3LHZA 5LIYX 4HU3A 2JIWA 1XICA 2XUCA 1RV8A 2ZZ2A 3CJPA 3DOPA 1C8YA 4JTGA 2J7HA 2B0MA 3T55A 1MUCA 5TIMA 1V93A 4NRRA 2Z29A 4JFUA 4CNTA 2P5NA 1K9DA 1XUZA 3CO8A 4XAZA 2H9AB 1W9XA 3AUJA 2QUMA 5CZKA 4C1KA 3BAWA 1U1UA 3P60A 5HA7A 1E6RA 2YL6A 1XIBA 5JH2A 4ML9A 3VZXA 1JF6A 3E0WA 2GDQA 3FVDA 3AISA 4K7YA 1E6ZA 2RH9A 4L61A 4JIIX 4DQWA 4DZAA 2QF7A 3L2LA 4M1RA 1NVMA 1P6BA 2HSAA 3B06A 4UTHA 2DSUA 4JIPA 4B2DA