2AANA

Auracyanin a: a "blue" copper protein from the green thermophilic photosynthetic bacterium,chloroflexus aurantiacus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
GPVTIEIGSKGEELAFDKTELTVSAGQTVTIRFKNNSAVQQHNWILVKGGEAEAANIANAGLSAGPAANYLPADKSNIIAESPLANGNETVEVTFTAPAAGTYLYICTVPGHYPLMQGKLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords auracyanin A
publication title The Crystal Structure of Auracyanin A at 1.85 A Resolution: Why the Photosynthetic Bacterium Chloroflexus Needs Two Almost Identical 'Blue' Copper Proteins
rcsb
source organism Chloroflexus aurantiacus
molecule tags Electron transport
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2aanA00
3PCYA 5I5MA 4A2FA 3ABKB 4KNUA 1QLEB 2DWTA 3EF4A 5I26A 3ZX1A 1OV8A 2PPDA 4G70B 4HCIA 2PP8A 2PPAA 2XLLA 1J5DA 3PLYA 2CJ3A 4N4YB 3T6XA 5I5IA 2W88A 1OCZB 2FT6A 2XV3A 2DYSB 2HRHA 1PNDA 4DP9X 2VSKB 3AZUA 4CSZA 1XMEB 2IWFA 2BO0A 2UX7A 1BQRA 3AG1B 3QJRB 3UGEA 4E9SA 1SHXA 1W8EA 2CAKA 2YAOA 1J9SA 4ENZA 4RH4A 4UANA 2XV2A 1XB8A 4BDVB 4E9RA 4W9ZA 5B7EA 1WA1X 2DY2A 4HHGA 2BW5A 1J9TA 4F2EA 3FU7A 2IH8A 2EIMB 3ABMB 1AQ8A 1PCSA 2XXFA 1PLAA 1PLCA 3FU8A 3C75A 3QJTB 2Y1AA 1NIDA 4PAZA 2FQGA 4YSEA 4KO7A 2TSAA 4HAKA 4FAAB 5I28A 3FQ2A 2EILB 1AR1B 3UACA 2WO3B 2AZUA 3OM3B 4E9WA 3T9WA 5F7AA 4DP4X 1ILSA 1PMYA 2GB2A 3WKQA 3X1GA 1TKWA 4G7RB 4UAHA 4GP5B 1E65A 3HB3B 1GY1A 1HFUA 5AFAA 1BYOA 1ZPUA 4YSSA 1BQ5A 2VW4A 1BXUA 1EHKB 3QJQB 3NJFA 3OMIB 1V54B 3ABLB 2QDWA 3ASOB 3G5WA 3KW8A 1ZV2A 2CBPA 1OCCB 1QHQA 4DP7X 2MRYA 4GYBA 3NT0A 2RACA 1L9QA 3QJVB 2DYRB 3QPKA 1DZ0A 3DIVA 4KNSA 1ID2A 1DYZA 2BW4A 3FSWA 1CUOA 1ZIAA 3WKPA 2Q9OA 1MG3C 3UADA 2XXGA 6PAZA 2PPEA 4G7SB 2IDFA 4YSUA 3T71A 1FA4A 4YSQA 3QJUB 4DP5X 5LDUA 2I7SA 2BZ7A 2UXVA 1W6LA 1X9RA 2GC7C 2W8CA 1GS6X 2H47C 3D12B 4AKOA 2FT7A 3SQRA 3GXUB 3U25A 2J56A 2DV6A 2QPEB 3T6WA 3SBPA 4PCYA 2H3XC 1PY0A 3QQXA 3GYRA 3FQYA 1OE3A 1WAEA 3FPXA 3PAUA 1NWOA 2HZHA 1VLXA 3FSAA 3RYMA 2J5WA 1M56B 2IDSA 2GHZA 2FQEA 2PPFA 3UAAA 5D4HA 5EHFA 4G71B 4YSRA 4DP8X 1ET7A 2YAQA 1NIAA 1PZCA 1MZZA 2BP0A 1TEFA 1OOWA 3S3BB 2AZAA 4HHWA 1AZCA 1GY2A 2IH9A 1PZAA 4A2DA 4A2EA 2EIKB 2I7OA 3NP3A 4HCFA 2CCWA 4DPBX 2MTAA 1ASQA 1IBZA 2BWDA 3OMNB 1AOZA 2GSMB 1HAWA 2XV0A 2FNWA 1BAWA 4E9VA 5I6OA 4GP4B 1CC3A 1PNCA 4YSPA 1L9RA 2R7EA 1BXAA 1IBYA 1OE1A 2XX1A 1JZHA 5I5JA 1SJMA 1AANA 2P80D 1JXFA 1PAZA 1T5KA 2HLEB 2YXWA 2QDVA 1R1CA 4HCGA 4K9JA 4A2GA 3S8FB 5IY5B 5B7FA 2XVBA 4GY4A 3EH4B 4F2FA 1CURA 3DTUB 1KYAA 3AY2A 4AX3A 3NSFA 2IWKA 5AZUA 1XB3A 4WKXA 2IAAC 5I6NA 1A4BA 2EIJB 1KCWA 1ZDSA 1TU2A 3TBCA 1HAUA 4E9TA 3WI9A 1KV7A 1PZBA 1NTDA 3PXLA 3TASA 1GS7A 2VMJA 2NRDA 2YARA 2IWEA 4DPCX 5I6PA 5I6LA 5F7BA 1JVOA 5PCYA 5PAZA 1M57B 1J9RA 1L9SA 2ZONA 1SFDA 3CDZA 3NJIA 1KBWA 4NERA 1MG2C 1W6WA 9PCYA 1GSKA 1RZPA 4M3HA 1SHWA 3PAZA 3AW5A 1TEGA 4YVUA 1GS8A 3NYKA 2OCCB 4NAJA 3PAVA 1A4AA 5E9NA 2FTAA 2GBAA 3EH3B 1JZEA 1SF3A 7PAZA 1AZUA 6PCYA 3SBRA 3FPYA 1SDDA 5B3SB 4MFHA 4YVNA 1NPNA 1V55B 3TU6A 1JERA 2VW7A 3JT2A 3OQRA 4E9YA 1AG6A 3PPSA 4TXVB 4BWTA 1KDIA 4JKNA 2CUAA 2WO2B 1FWXA 4BWUA 1JZJA 5I6MA 1I53A 1CYXA 1JXGA 1ASOA 2PCFA 1WA2X 3NJHA 5AKRA 1NICA 2YAPA 3MBWB 4BXSV 3IE9A 2VW6A 1L9TA 1NINA 1KGYE 1NIBA 1AG0A 2XX0A 1BYPA 1PLBA 2PPCA 2Y69B 3L45A 1EZLA 2PP9A 4BWWA 1N70A 4M4RB 3NJMA 3FT0A 2VN3A 3S8GB 1RCYA 1MZYA 1JOIA 1ET8A 1OE2A 1SF5A 2PP7A 4BK5C 2BP0B 1A4CA 1JZGA 4AKQA 1ILUA 2AANA 4L0PB 4QKTA 1NIEA 1SFHA 4YSTA 4EF3A 4DP2X 1JXDA 4ZK8A 1KCBA 1JVLA 2XU9A 5D4IA 5B1BB 4N8UA 4CSPA 1WS7A 2BZCA 2R7EB 4Q89A 3ZIYA 3WG7B 4GXFA 4E9XA 1L9OA 1E5YA 1RKRA 3X2QB 5B7MA 3NJGA 3OD3A 2UXTA 2P80A 2ZOOA 3HEIB 1AS6A 2OJ1A 3S3DB 4A2HA 3X1BA 1ET5A 2VSMB 3X1NA 4DP6X 3ZBMA 2XUWA 8PAZA 3FU7B 4KO5A 4G7QB 1AS8A 3EHBB 1ZIBA 1V10A 3IN0A 5B1KA 3DKHA 2IDTA 4E9QA 2BP8A 2LLNA 3NSCA 4HZ1A 2H5UA 1WA0X 3N2JA 4A67A 3NSYA 4YSOA 2EINB 4F7KA 3V9CA 1URIA 2GI0A 3FYIB 1J5CA 1A8ZA 1AZRA 1KBVA 3AG4B 4DP0X 1PF3A 3FS9A 2UXGA 3UAEA 3NSDA 1FFTB 2I85A 5TK4A 4QLWA 3IBOA 2UXFA 3OMAB 2AVFA 1UATA 1NZRA 4DPAX 3CDZB 2FT8A 4W1TA 1E30A 1JZIA 2A3TA 1AACA 5D4JA 5ANHA 3FSVA 4FA7B 3GDCA 3SBQA 2BHFA 1A65A 2XWZA 1OCRB 3T6VA 1AZNA 5B1JC 1IUZA 3WIAA 2DWSA 2JFCA 5B1AB 2GC4C 2JKWA 2YAHA 1ZDQA 2IDQA 2BWIA 3TA4D 2TSBA 2J57A 3CG8A 3CVCA 3WNJA 1SDDB 3FSZA 2WSDA 1KDJA 2Q5BA 3FQ1A 3V9EA 2QPDB 3H56A 1M9WA 1XB6A 4BDVA 3QJSB 2HX8A 3EH5B 2XYBA 1AIZA 3NJKA 2YXVA 2FQDA 4X4KA 4YSDA 3X1FA 3BVDB 1L9PA 2B08A 3ZDWA 2VM3A 5FC9A 1MDAA 3ERXA 3MX0B 4KNTA 1NPJA 2VM4A 1QNIA 3NJLA 2HRGA 4KO6A 2PCYA 5A7EA 2FWLB 2YQBA 4P5SA 1BXVA 4JHUA 3WNIA 1OF0A 4JHVA 1B3IA 1BEXA 4A66A 1IC0A 2ZWNA 4AZUA 2N0MA 3T6ZA 1E67A 1NIFA 2IDUA 3AG2B 3H4FA 1NWPA 4KOCA 2OV0A 3S3CB 4KOBA 1ADWA 3N55A 4G72B 1E5ZA 2X88A 1GW0A 1BQKA 3ASNB 2QT6A 2JXMA 2AFNA 1ETJA 2YAEA 4YSAA 3NJNA 1A3ZA 2FQFA 2CALA 3FU9A 4AKPA 2J55A 5I6KA 1WS8A 1ASPA 1N68A 4YSCA 2HX7A 5TK2A 2PLTA 3JTBA 4BXVA 3NJJA 1GYCA 3CVDA 1JZFA 1IKOP 3CVBA 4DP1X 3ABGA 1CYWA 4A68A 3H4HA 1X9UA 2B3IA 3X1EA 2YAFA 4WTQA 3UABA 1SNRA 1J9QA 1RZQA 2UX6A 4P5RA 2BP8B 5B1JA 3IEAA 4AI7A 2FJSA 4HIPA 1OCOB 4UF7C 3KW7A 3IN2A 3NP4A 1F56A 2HXAA 4NB7A 7PCYA 2YAMA 2GIMA 4KO9A 1AZBA 1GR7A 2HX9A 2X87A 3CZUB 4GP8B 3FYEB 4HALA 1NDTA 1YLBB 2ZXWB 3BQVA 3AG3B 1AAJA 1AS7A 4Q8BA 2E86A 4YL4A 3TBBA
chains in the Genus database with same CATH superfamily
1L5GB 5I5MA 3DRQB 3GSXB 5I26A 3FFDA 4PEEA 4ZXBA 3VI4F 1B6UA 2BC4B 4PN6A 3QBTB 3MRPA 2CJ3A 1KCSH 1QQDB 1CGSL 3P3YA 3SGDH 1T1ZB 4I5BA 4K2UH 2XV3A 5BW7C 4LVOC 5T5FA 4Z95L 1TR7A 4FNRA 1KB9J 5EU6D 1SLWA 3BUDA 2IWFA 2BO0A 1XFPA 2ICWI 1JUFB 1E9OB 3D09A 2CPCA 4XCCH 4UNUA 5DO8A 2Q76B 1CGYA 4NIKB 4PWIA 1DVUA 5GS2H 4AQ8A 3TT1H 3UCRA 1PKQE 5F1NB 4B5EA 3CFCH 1IARB 4RRPM 2VDNL 3CJJA 3OJVC 4AVHA 4RZCA 3MRNB 3MZGB 3HAEA 5DEJA 2W07B 4KNQA 4RDBA 2HVKB 3HE6D 2K3HA 3CQPA 3V55A 3BUPA 3QORB 3JQOB 3MNWB 4HAKA 4WSJA 3ZHFA 4U0QB 3KGTA 1OT1A 1LQSR 2YGNA 3VJ6A 5HHOD 3QCVH 1KLFB 1TTRA 1ZHKB 5EOCJ 5F7AA 2GB2A 1S3KH 3LKSB 2F19H 2ZOUA 4GP5B 2GSGA 3H42H 3VFGH 2VXSH 4U3SA 2DQEL 1HFUA 4OCWH 5AFAA 3K3QA 4KVCH 5LBSH 1QLEL 3QJQB 1HEZB 1EXGA 1KZYA 1RURH 2FB4L 2HJKA 5AW3B 4MAUL 1E4XL 2K6YA 5GGVY 5C3LD 2X2UA 5ESQB 5LBVA 2YHGA 4K8RD 1XAUA 2NXZB 2CLZA 4KK8D 1MRFL 1YZZA 5AOMA 2EIBA 4ONGL 4IOIA 3NT0A 3N41F 4KRLB 4Y4HB 4MQXD 4WV1A 2DYRB 1ZV9A 1W0YT 2DYPA 1JPTH 2OXHB 4JZJA 1UKTA 4JFYA 3PNRB 3QEHB 4D94A 5EB9A 5DA0B 2MMXA 3CVIL 2OSWA 2HWZL 1MG3C 5I0VA 2ZJSL 5IMKA 2KMWA 1OD9A 3S36H 2WD0A 1NMAL 1WITA 4Y4FD 1FA4A 5BZWA 2DQCL 2PUQT 3NFNA 5FKPB 5EEVA 3EYSH 4NC1E 4OLYL 1I1YA 4JX0A 4AVKA 4JPWL 2W8CA 1TVBA 2YSTA 4W9FC 5F8QC 4M8QA 4UINH 4A7GF 1JNHA 1U8QA 2DLHA 5I1IL 4IKNA 1UD4A 4LLQB 3F83A 3A21A 5IREA 3ASWA 5DGQA 1YNKH 5BMFH 4LKCA 4PW3A 4WW1A 1QPXA 2X38A 3U4BH 4GG6B 1MI5B 1DVSA 1SDYA 2D7MA 2GY5A 3P9MB 4Y1SA 4AYSA 1KWKA 3WFBH 3BAXA 3UTQB 3EDDA 2VLKB 5EF0A 1F0LA 3NAAL 3HZMA 2UWEB 4M3KB 1TLKA 4P06A 1VGEL 4DUVA 2M1KA 1QO3B 3U79A 1CLZL 2YMOA 4YNYA 3GNML 3JV4B 4G7VH 1P4LB 4G71B 3QO1B 4IMLA 4APXB 1QUNA 4LHUA 4TNWK 4PTUB 2ENSA 1DEEA 2F53B 1PZCA 4QRPD 4JCLA 4LSTL 4UM9B 3BAYA 4W9GC 2JI1A 5CS7A 4KDVA 1UZ8B 1F4YL 1UXWB 3BDBA 3ZZLA 4LVEA 2EYSB 4DPBX 1BVNT 1G9NL 4G80A 4JPSA 4H8WL 1KELH 2DS4A 4LSSH 3VH8B 1R19A 4Z0BH 3VI3E 3QC6X 2R29L 5IF0B 4WI0A 1IBYA 5JIIA 5DWUH 2V5RA 3ZHLA 4CAGA 1PZ5B 1OVZA 3UAJD 3SDXB 5FA4A 1XT5A 5DYOA 5T1KD 4NC1C 3KGUA 2DLIA 3VFSA 5D1ZB 1UD2A 3B7TA 3U46B 4NHCL 3B9KC 1ZXQA 4FGMA 3LRSB 5E1AA 4FA6A 2XVBA 3EJYD 4NNYB 4M48L 1BLNA 1DR9A 3AY2A 1JN6B 2WWMD 3CLFH 3LIZA 3ARBA 4LEEA 3DARA 4NQVA 1A4BA 2ODIA 4IEFB 3S35X 2Y7QB 3W9EA 2O1AA 1QASA 1NAKH 1YMMA 2PYFA 4KXAA 1A4JB 4PP2A 5E4IA 1XGRB 2BC4A 2VQTA 4QRFA 1QG3A 2UZIL 1QQDA 2JB5H 1TNNA 1JZDC 1NDGB 4MBRA 2KBGA 1WWWX 1T1ZA 3BSZH 3PABA 1JVOA 1B4TA 3B8YA 4WO0A 1VENA 4MJ5A 5CLXA 5K9KB 1J9RA 1CFNA 4NI3A 3CDZA 3NJIA 2FZ3A 1JUFA 4NQQA 1B90A 1T3FB 2AK4D 3BAIA 3CFJB 2OMWB 3WL9B 4D3CL 4QY8B 5JQ6L 1QRND 1OZUA 1S9WB 3C87A 2A6JB 4WHDA 2Z8RA 3QUXA 3NCCB 3ARQA 3VFUA 2WBXA 1J0KA 5DHEA 1Q1JL 3UGXA 2EC9T 2G3MA 4LQFH 1KULA 4PJCE 4IBVA 1U9KA 4JFTA 4MQ7A 1D7CA 5I8EA 3QFDA 3BKML 4FXTA 4GBXA 3WFHB 4F27A 4HEME 5B8CA 1CFBA 4YVNA 4XPAH 1UWYA 5JHDD 2BXZA 4IDJH 4JO4H 4Q9QL 2K1MA 5AENA 3QNZA 2BSRA 1KLFA 2A6IA 2VB5A 1MCKA 3BAEL 3P77A 4PJDB 1FZJA 3HAEH 1KIUB 2NT1A 1JNLL 4Z3JA 3MX0A 3U0WL 2HUEA 4KGLA 4WFGE 3CPLA 4DCQA 3DO7A 3TNMA 4AH2A 4LCCB 3PXHA 3MHZA 3PGFH 3PIQA 1KB5A 1HEZA 4B9ZA 3F7PC 1MN4A 5TF1L 3ZDZF 2VXQL 5ESQA 5BS0A 1DTUA 1DSFL 2XWEA 1J8KA 2F6AA 1L9MA 3VFVB 2P8PA 4NFCA 3NACH 4B0MM 4FQXB 1BV8A 4BK5C 5ABZA 2AHIA 2BP0B 4R90H 2AK1H 2O6EA 5IMLA 3L08A 5JIMA 2WB1A 1DP0A 2H0PA 3QEHA 4W6XB 3KVQA 2MKWA 5C0NC 3V4PH 2HTLD 1N0XH 3L9YA 3ZE2E 2YPLB 2DF3A 4FLRA 4KQ3H 4EXKA 15C8H 5E00B 1UASA 3LN4A 2VC2L 2BDNH 3RX5A 4B9IA 5A2CA 4RMTA 4XWGH 2ZSVA 3EADA 2OCJA 2IBZY 3T2NL 4KMTL 5JQHC 4GSDL 1F5WA 1BD2B 5FHBH 2CO7B 4NJ9L 5GGQL 4JQXA 5T1DL 1LWJA 1LO2H 1KTLB 5FGCB 4ODWB 1K5NA 2I60H 5H2BB 3SE4C 2FEEL 1J1XH 1M7DB 3PFQA 4FXGB 3CUPB 3HVDA 5I17B 1AS8A 3HFFA 3DI3B 1CIDA 3SQBB 4F58H 5D1QD 2EEDA 1BZEA 4ALAH 3LZPA 1MI5A 3M45A 4MJ6A 2FEEI 1N2RB 4NNPH 4Z5RB 1IQDA 4X6EB 2LLNA 1F4AA 1CVSC 3UTQA 2ZAGA 2VLKA 3DVNB 4RRPA 1BVOA 1WA0X 3N2JA 4YBHA 3TCLB 3C09C 4XN1A 4PJHE 1H6FA 4JFXB 1BZ7B 4YR6B 5KEZA 3GSWB 5IHZB 3B3IB 4POZD 3ATDA 5FPIA 1EFXD 1PF3A 4EEEA 1I7ZA 4GW5A 3LS4L 2F5BL 2NY1D 4HV8B 4APXA 4NCC2 2D03L 4PTUA 4UM9A 1NZRA 3CH8A 3HS0B 4WGWB 2X4QB 3O2VH 1B4JH 1E30A 1GOGA 1WZ1H 3RWGB 4J3SA 2EYSA 1MNUH 3FFCB 3X3GH 5TD4A 4WU5A 1ZHNB 4S1QH 5EDXA 5LGHH 3F7YB 1NGPL 5E8DH 1GAFL 4BELD 2V0AA 1U92A 2OZNA 3G5ZB 4XWOC 5E23A 1KLGA 1XEUA 2IDQA 1F13A 2RB8A 3UDWA 3SDXA 1FBIL 1LO4H 1SPDA 2MJWA 3T0AA 2XOTA 5HGDA 2ITEA 1I8MA 2QADC 4JDVB 5D1ZA 2Q5BA 3TFBA 4HOMA 2PWFA 3L4VA 1XHHA 1XB6A 3IDGA 1M05B 3GIVA 5ABDE 1KUMA 3ARDB 4NNYA 4Y7OC 3BVDB 4G42B 3FB6B 1U93B 3P0YL 4I7ZC 5DLML 3MRQB 1JN6A 4ZMZA 3QI9D 1F6AA 1TJGH 2HTKD 1GTFA 4NQEB 1L7IH 4OLXH 2E27L 3WKMH 3CQFA 2BVOA 4WJG3 2D4DA 4PRAB 5F1IB 1XGRA 1FFPB 3STLB 5LXVA 1GJWA 5T3ZD 2G9HB 2ZPKL 3HG1D 5EIIG 3NRQA 5DD0L 5HDBF 2EDTA 1KTBA 5K9KA 3DPDA 5D2LE 1N67A 5EH1A 2CBMA 3VE0B 4NC2B 4DN3H 1T3FA 1XL6A 3QUYC 4YZWA 3CFJA 1SXBA 3VRJA 4OF8A 3VRIA 2FJFB 3DX0A 3TEZA 3BE1L 4PRDA 1S9WA 1YSOA 2BS9A 2EH8L 2A6JA 2VLMD 1AQKH 3AB0C 3JT0A 3LZOA 4FQIH 4OI9A 2VRAA 3OB0H 5J0BA 3RUGF 4LPUA 4ZTOL 4YL9A 4ZD3L 4HJIA 4HUWA 4YSAA 2EO9A 3VYOA 2YFOA 2L04A 3WFHA 4JM2B 1GYAA 1CLYL 4M7ZC 3EGDB 5H37G 3B3BA 5GJSH 2VR6A 2X70B 1OANA 3L5HA 5E2UH 5F9OH 2N3JA 3RDTB 2Z4QA 3C6LC 2JJWA 4ZAKD 5DD5L 4PJDA 1E7VA 5CEZH 1KIUA 5AB1A 1N8OE 3UABA 5C07D 2NDGA 4LSVH 3U7YL 3LNEA 4OM1L 1FDLL 3RWIA 3NFSH 4HIPA 3D85B 3K8MA 1YG9A 3AQZA 5HYJB 1DQQA 4UQBA 1FSKC 3OWRA 3LDBB 4L4TA 1X6LA 2X6CA 4GKNA 2X87A 5E4AA 3FYEB 3VFVA 4DAGL 2ZXWB 3W82A 1J87A 3D3VA 4K2UL 4HIIA 3JWOH 2V5YA 4DERA 4Z3IA 1R3HB 2DWEA 4PG2A 1JVKA 5I1CL 4OI7A 4XAKD 4N26A 4XCCL 5EF2A 4LXFA 1L9NA 4O4YH 4ZSOB 4NUJB 3TPUB 2Y1ZA 3GO1H 4FJYA 3CFCL 1QLRA 5IFAH 3UG5A 3LKNB 3VMPA 4OZFH 4FMKA 1TMCB 4U1LB 3TVMD 3PHAA 2V3FA 2CAKA 4S11A 4ANWA 3ORJA 4QHMA 3W0WA 1AZVA 3O3AB 4UANA 4EXPX 1WE5A 1WD9A 3DX4A 5JXED 3VD1A 3QHFH 4Y1AB 3VXUB 2ZICA 2DY2A 3CUPA 4FXGA 4GPVA 4F2EA 4QRSA 2P24A 3QCVL 3TL5A 2ICWJ 4IGBD 2EIMB 3PL6B 2EEAA 4Z7QF 4FI6A 1FFRA 5SWQB 1NAMB 4J3TA 1AVAA 2F19L 3ZHNA 2PXYD 3DBXB 4J6IA 1T4KB 2YD8A 4OU3A 4XVOA 2VXSL 5EUOE 4QXUH 5KW9H 1BZ7A 4KVCL 4IOFC 2PNDA 3O8XD 2FLMA 4R4BB 1BBJA 1SM3H 3APNA 4OD2B 1RJZA 2J71A 1OWWA 5EBLA 5CJQH 2CCVA 3RP1A 1RQ5A 3GMOB 4O5LH 2EUZA 3HS0A 5LQBH 5ID0B 4XBPB 1NFDF 4YSSA 5FS5A 1JPTL 1X5ZA 5C0BD 1HIML 4XNYH 3MA9H 3FH8A 4OLVH 3ZYJA 1HZLA 5KSBA 4GXUN 3FFCA 5G55A 5SX5H 2OTUA 3QGVA 3VU1A 2JXMB 4G7YL 1A7QH 3L16A 4GKSB 2VL4A 3F7YA 3VXSB 3S36L 3O6FD 4R26H 5FYJE 3Q5YA 4RFNB 3MAWA 4NPKA 1SRDA 3EYSL 4LSRL 4E41A 4JZNA 2BW4A 5EF1A 3WHXB 4FXLA 3V6ZA 3ZKXC 2BJMH 1T5XA 3QR0A 1N6VA 4YQXH 2WXGA 3VXTB 4ABWA 4UINL 3IJ7A 3G6AB 1M05A 5I1HH 4I3SH 3LH2H 1RUPL 2UV3A 4YXLH 4RGMC 2QBWA 4KHXH 4Z7NB 3R1GH 5BMFL 3H9SB 4MX7B 2H6PA 3U4BL 5I2IB 1H15B 3S8WA 4NQEA 4TQEH 3NSXA 1JZ3A 2P26A 2ZWSA 1K2DA 4PRAA 3STLA 1ZD6A 1SN0A 3HZKB 4AY0A 1S7QA 4G7VL 4UTBH 5D2NE 4DKAA 4Y2LA 1ZLVK 3KLHD 1DO5A 2B9AA 3TFKD 2X2HA 1UQSB 1P1ZB 3VE0A 5FWRA 2KQNA 1YYCA 1HCFX 3PDDA 3K2MC 3UAAA 4BFOA 1A1MB 5JW4M 1DQKA 1U8KB 2G5BB 1UG9A 2VLRB 4TVPD 1B0GB 4R7LA 5MERB 4OGZA 5KSAB 1KELL 4LSSL 1UT2A 2E75C 3BZFB 3HN5A 4U1MA 2OMXA 4Z0BL 4QGYA 1KACB 5I66B 3QEUA 1FL5A 2FH8A 4L29B 5DWUL 5I75C 1HK6A 3GZQA 1WHPA 3EGDA 2BIPA 3REVB 2GSMB 4A2MA 2B8OT 1JF5A 3N6YA 2X70A 4YLBA 3RJDA 5IEHA 3RU8H 1FE8L 4QXTA 3RDTA 1I1AB 5L2KB 5L6YL 5J5EA 2X6BA 5CEXA 2PWGA 1TETL 1G7IA 4U7MA 1OTTC 2WWKT 4AMKH 1SOXA 2Q8BH 3CLFL 3VG9B 2YLKA 2NZ9D 5TE4H 1NM4A 2YXWA 4FNPA 3RIAK 4NBXB 1NAKL 5CD5D 2GUYA 4MDIB 2ZX5A 4XTRC 2DDQH 3EJQA 4C4UA 4FEMA 2WLYA 4AGMA 3VI4E 3QSKB 1DHKA 4XCEB 3OKOB 5KVEH 2KZKA 3NN8B 2JB5L 3RIAF 4NN6C 1NBZA 3BP6B 4ATTA 2FO4B 3FT2B 1LD9B 4ISVB 5D2NC 1R34A 5DEGB 2CQVA 4UT6A 4KQ4H 4PJEB 3C8DA 3GLDA 4C47A 5E8PB 3V0VB 2BY2A 3UC0L 1XXFC 3IB4A 5IZ7A 4DH2A 4WNSA 1WZLA 5HD8C 3VGAC 4I1RA 3L1OH 4G8GD 5T5FL 4CNIB 2XDHA 1R3LB 4PY8J 2V8MA 4U1LA 1CG9B 1R5VA 3O41B 2A9NH 3VQ1C 4LQFL 1JWUA 2C9PA 4KXBA 2DICA 2D7QA 1GSKA 5ESAB 3U0PA 5IQLA 4BHUI 1U58A 4UQ2A 4XPAL 2FL5A 4ORZC 5GS1A 3NYKA 4IDJL 2EVHA 1QR4A 3QAZC 1OP9A 3BUBA 2J2ZA 3FZUD 4JO4L 3WUWG 3KZ8A 1PJWA 4N2DA 2YS4A 3IFPA 5IB2B 1FH5L 2VZTA 5SWQA 1NAMA 1NCOA 5H4YA 3BFWA 1OGTA 4J8QA 5DZVA 1IC4H 3DBXA 1SDDA 5AL0A 1MRCH 4MFHA 2VUKA 2H4EA 3QG6B 4KXDA 4A37A 4FQ1L 5HI5D 3KS0H 2W0FB 1LQBC 1AG6A 1RUQH 1QX1A 2YEVB 3NDYE 4LCWD 4GAYA 4R4BA 5CN3A 1NCDL 4FQHA 1XZWA 2YC1B 1FWXA 1CE6A 4KK9C 1XGUB 1I53A 4QYOB 1A14H 1ZT7A 3WFCL 1HQRB 3GMOA 1ZLSH 3BAKA 5ID0A 4R90L 2AK1L 2FHBA 4ONHA 1HNYA 1NIBA 4LAQL 1L6XA 2ZCZA 1BQHA 4YE4L 3VMNA 3S37X 4IBYA 3T0XA 1N0XL 2NTSP 2WCGA 1CD8A 4KQ3L 1NOFA 4BQCA 2ENQA 15C8L 1WPCA 4HU2A 1D5BA 4XXWC 3BLKA 5LGJB 1PEWA 2BDNL 1S7UB 4XWGL 2NX5A 5CFHA 1ILUA 2VSCA 4OZHB 3RPBA 5FHBL 4TPRH 3G6DH 4RVBA 1BM3H 4KI5F 3SGEH 1HL4A 2LTQB 2V7HA 3UTPD 4X9BA 1LO2L 4OCYH 3SJVE 1F8TL 4MDJB 3AWGA 2ZWZA 2I60L 2V6HA 3G6AA 4HIEB 5EC2B 5F1OB 4E5XB 3RLSA 4L1LA 1J1XL 4YFLI 1YDPA 2CO4A 4G6AC 4K3EH 4D9QD 2WLHA 4MX7A 4F58L 4ALAL 2CUHA 4J2XA 3HE6B 4NNPL 3ZE0B 4F8LA 3Q8BA 3BKCH 3NPSC 4UUJA 1OQOA 3S3DB 5MEQB 1VKXB 1DLFH 3MLPA 8PAZA 4LK4A 3HZKA 5DHVB 5HHOB 3M7FB 5FCUH 4W4OC 5MI0B 2AV7B 1FL3A 4FDWA 1T1YB 5DQ9B 2DKUA 3F7VA 3BO8B 4ZOBA 1AGFB 4HZ1A 1CD0A 3BUIA 3P3SA 4Q2ZA 4HPYH 3OMZA 3ESMA 4C58B 1UQSA 1P1ZA 1G9MH 1XCWA 3O2VL 4NUPA 3EGXA 1B4JL 1WZ1L 1U8KA 4EIUA 3FS9A 3X3GL 1B0GA 1E27B 1RJLB 4Z6AT 1FJ1B 5LGHL 4RDQF 1G9NC 4UBDD 4H8WC 4OQTH 4J3XA 4Y9BA 2G3XA 2PR9A 4KFZC 3TO4A 4AYFA 4ZX4A 4JVPA 3HHRB 3F8UB 3O9WD 3GRBA 2LV4A 1AACA 1LO4L 4HLJA 3RVUC 1WRFA 1UUSA 4A6YB 2NT0A 1MFVA 4Z0XA 2N01B 3ESOA 1A65A 4QKXB 1FUNA 1NMBH 3TBVA 5DJ8B 3D25A 5L2KA 1KB3A 5HGAB 1ITCA 4ZO6A 3BD4A 4RFOL 3FO9B 4PRPE 3MRKB 4CU6A 5A3IC 2EDEA 1TJGL 3CVCA 1QFWM 3FSZA 4OF5A 2XTSA 1UKQA 1L7IL 1S7WA 4JPQA 4OLXL 3WKML 4M6AA 5EWIL 3SDAA 3QJXA 3V9EA 1RUKL 4MDIA 3H56A 4XMPH 3FSOA 1R3KB 3QJSB 5B39B 4PH8A 4Y0GA 4IRSD 4XCEA 1OAZH 2YO3A 4X4KA 3ZDYF 1N7MH 1LXMA 3NN8A 5I71B 2F18A 4IBTA 5TJWK 3CN4A 4GT7A 2PCFB 3LIZL 1NPJA 2IG2H 2ZP8A 3RZCC 4IYKA 2ZUTA 5BV7H 4X7FC 5FCSH 3QA3B 4PUBH 4DN3L 3PWPD 4ZS7H 2YD7A 1FYHB 2LLLA 4JE0A 4JHUA 4AQOA 2PCPA 5ID1B 1FPTL 3ZXAC 5K69A 2E6JA 4W9IC 4FQIL 4HWBA 4AEHH 2HJFA 1AQKL 3QUZD 2WBKA 5F6HJ 1FRGL 1GZPA 4YLQT 5DUPH 5I74C 4A63A 4CNIA 4KOCA 4PIRF 1OF2B 1R3LA 1AHWA 4QRPB 5GJTH 4H8HA 3FN0L 1E8ZA 4C56A 3O41A 3NCMA 2BWQA 1E5ZA 3MSPA 4H5SA 4M6ML 4NNXB 4UT6H 5E1QA 3TONA 4P9HL 1U30A 4N90D 4R2GD 2J8UE 4LOUD 3T0VA 5HYQB 3G08A 5GJSL 3ZL4H 3NRPA 1F86A 5E2UL 1D2PA 5FK9A 1HXMB 1CB4A 1S7SA 1GVIA 2YUWA 3GXIA 4U1KB 3S88H 3NJNA 3QRGH 2BSDA 4ECNA 5IB5A 2I9TA 3SD5A 2J20A 2ALWA 1IAIM 3NZSA 2G4EA 3TJHC 5IMMA 1Z0MA 3QG6A 5T1KB 3JTBA 3NFSL 4B7LA 2Y23A 1TMQA 2YQ2A 3N5AA 3WTTA 2W0FA 1JZFA 1NBVH 5JDSB 2ZE0A 2Q3XA 4HJTA 2GY7B 3KNBB 3ZDZE 2YC1A 3L5WB 3QXUA 1VESA 1IGTA 4N6RA 3V0FA 2YAFA 2E7DA 4NQDE 2H26B 4OAWA 2BS71 5SX5K 3QQ4B 4FLHA 5MHSD 3JWOL 2IOMA 3IEAA 3MLYH 2GJJA 2I07B 3U4EA 4OFYD 1AYOA 1KB5L 4YHKH 2JKNA 4UILL 4ZUUB 4IOSA 4F7PA 1TPXB 1GR7A 2OMVA 1QWUA 1JPEA 4O4YL 4BQ9A 3DJZA 1E4HA 3ZOAA 4XH2A 1RULH 4AGPA 1KJMB 1GZHA 1LWHA 2C9AA 3MRJA 3JYCA 1X44A 5AW1B 3HCVA 1HXKA 1T0MB 3BWSA 1E3ZA 4ANKA 1WTLA 2VRKA 4BFFA 1OGAD 2AK4B 1GRWA 1V3MA 5KANI 2VDQB 1QRNB 1F6LL 3P9WB 3K6IA 1S9VB 3QHFL 3PG2A 4LL4A 3S35H 3E38A 4N2EA 3VGFA 3A4FA 4D7PA 5IK3B 2DQHH 1XR8A 5TPWH 1U0QA 2PO6C 5L2JB 4MB5A 1TITA 4EIZC 1J7VR 4KXZH 1Y0LB 1J8HD 4BUGA 3HN3A 3ZKQD 1PIFA 4G83A 2COVD 1CXIA 1M3IA 3OSKA 4QXUL 5MEQA 3DSNA 5TQ0H 5KW9L 4N0FA 1QRKA 2FGWH 2XN9E 5DHVA 2NR6A 3HW7A 1SM3L 3Q9QA 1VHPA 1FNSH 1G87A 1F1DA 2AV7A 4PIBA 1BMZA 1YECH 3CDCA 3O4LE 1VJSA 5DQ9A 1NC4D 1X5AA 3IMRA 4I3GA 4O00A 1B6DA 5CJQL 5TFSH 2OBGA 3R7QA 2P45B 5CZKA 4YXHH 4O5LL 4YSEA 1YEEH 2XT1B 4N8VG 3IFNL 4N28A 2LU7A 1O7SA 1PX8A 1P5UB 5B8CB 2E6PA 4IQHA 1FVCB 1OL0A 1PS3A 3BPLC 3MCLH 9CGTA 3MA9L 3VFWB 2ZIDA 5ECGA 1CN4A 4DP4X 5D7IF 1RJLA 2Z91B 2X3CA 3CDFA 1FJ1A 3WKQA 1XF1A 2BMKB 3BJLA 2PYEE 4AIZB 1KIPB 3SOTA 5FO8B 1BEYH 4U6YA 3MN8A 4R26L 3HMWH 5DD3H 1BZ8A 3LNFA 5K1NA 3RA7H 2GJ6A 3QFJE 3JVGC 2A9BA 3IRCA 5EZOH 4A6YA 3NBNA 4WI8A 4HH9B 3FUNA 2BJML 1CQKA 2VH5L 4YQXL 5H94B 3ASOB 2HLAB 3G5WA 5C7XH 1U8CA 2OX5B 4I3SL 1TIUA 4LDOB 3LH2L 3WENA 5I1HL 5B38A 5TGBB 1U8PB 3MRKA 4KHXL 3R1GL 4WTWA 3UTZB 3WS3A 3D51A 4KNSA 3MLVH 4PJAA 2VLJE 4TQEL 1ZIAA 1CD9B 1DVFA 2XXCB 2PWHA 2QPUA 3BRGC 1WZKA 1VRSA 1JTOA 4F9LA 5GS0H 1PPIA 3VDBA 1JIBA 1OK8A 4DP5X 5IB3A 3VWJC 1WZAA 2I7SA 1RU9L 1E7UA 5K9OB 2B4CH 1X9RA 2GC7C 5HDBE 2F1AA 5DJAA 1Z5LB 3KYAA 3WD5L 1XGYH 2B1OA 2ZWYA 2CMRH 2JIXD 2BCMA 1VFUA 1LNUA 2BSTB 3BZ5A 1Z3RA 2QPEB 4IBQA 4MGXA 2K6ZA 1T7XA 4PCYA 3K7UA 1YCSA 1CDGA 3EO0B 1PX3A 4XC3L 4Q9CA 2YJLA 3MLUH 2NY1B 3OGCB 1UB6B 3FQ4A 4N2CA 5DK0B 3RUGE 4BZ1A 1YVLA 1OF2A 1SXSA 4EUPG 3R8QA 3VFOA 4JDZA 3FTSA 4R96B 5DSCB 3MRLA 2XZAL 3RYMA 2VXVH 4X4ME 2GUOB 5HYQA 1M6OB 1C5DB 5K1VA 2K8QA 4WNJA 4XZ4A 5CP3H 5E2JA 4JFPB 3ME0A 1HXMA 3BZEA 3B9KD 3WIFA 5EUKB 1EHAA 3PQYA 1SJEB 3G5XA 3B6SA 4AMKL 2Q8BL 4XNZB 3NP3A 3NDZE 5EFIA 5TE4L 5KBKA 1V27A 2B1HL 3OMNB 3D2UD 2X6UA 3QISA 5CINH 1G0DA 1MOEA 4IMKA 4WUKL 5HXMA 4L37A 3L5WA 3SPJA 3JZYA 4YHZL 3PGCA 1IM9A 5KVEL 3QXAA 4Z3FA 4AGLA 1UOVA 3MGTB 2Q86A 3QI9B 5LCVA 4X8XA 3DV4A 1VAHA 1XGPA 3GS7A 1YEKL 2E46A 3MKKA 4OVUA 4FL4B 4Y4KC 2MSPA 4KQ4L 2HJLA 2YIHA 1M4KA 4Z7WE 3KYMA 3LPPA 1SLXA 4JDEB 4FEIA 3LX9A 1KYAA 1IFHH 1GGCL 3HG1B 3ARGC 1U3NA 5AVWB 3EOBA 4PRBB 1KCUH 3ETBF 1Q9WA 5B21A 1RZ8A 2R27A 2YMXH 3H6JA 4Z77B 3V6OE 4I4WB 5AVRB 5KSBF 2A9NL 3VVWA 1BXXA 1F3JA 4AEIH 3RY6A 4RGOL 4TV3A 2VMJA 5IROC 2CM5A 1CR9L 1S9VA 2B2XH 2N1TE 2VISB 5CSZA 1DBAH 4BSJA 3S4SA 3P4NB 5IK3A 4ODXB 2ZOLA 4D0CB 4FQJH 1K6QH 5L2JA 3GI9H 1QVOA 3T65B 2RQ8A 1T5WA 5EULV 2NYKA 4Z7QE 4L9LB 1RZKH 4V2BA 1HYRC 1I3VA 1IC4L 3HBPA 3CMGA 3KD4A 3PNWB 1J0YA 4GKOA 2EE9A 2XNAB 3QWOA 1GS8A 2VE6A 2IBBA 5E8NB 1RUQL 4LU5L 1PSKL 4CN1A 4HGKC 3E0GA 4ZAKB 1J0JA 3B9EA 3OHMB 1HSBA 4XC1H 1N64H 4OH2A 5DHMC 4DKEH 4ES9A 1A14L 5C07B 5CEYA 3L2MA 1KYUA 1FV1A 2MPAH 4P5MA 4UIKH 5IKCA 2EECA 1NFDE 2A4CA 1G6RB 3VFWA 2CUAA 1MHCA 2WO2B 3GHPA 4X6DB 2M26A 2Z91A 2FCBA 5C0ND 4AIZA 2BMKA 1EV2E 1WFNA 3LN5B 4KI1A 1K8IA 3EBIA 5ICXB 1UCTA 1L7TH 2C3HA 3NIGB 2WLMA 1J5OL 2GKIA 2X1PA 5DDHA 4EZLA 4R97B 1MFBL 4X8CA 3V6OC 3D52A 3G6DL 4K23H 1BM3L 2NW2B 5E8OA 1AGDA 4W9HC 2OXGB 2EH7H 1DSWA 4OCYL 2CUMA 2HLAA 4OB5H 5D7JA 3MJ8A 5DQDH 1R46A 1RIUH 5CF3A 4QIRA 2WXLA 2EE3A 1U8PA 4LOFA 3SGEI 6TAAA 2AQ1A 2XY2A 3UTZA 3FT9A 3OAZH 1VGKB 2XBZA 1Z9SA 1T66C 2ATAA 1BBDH 3CCHB 3CXFA 2XU9A 3RWHA 4N8UA 4WFGD 4U1JA 2Z93B 3B9AA 5C6TH 5CJXA 2XZQH 3ZIYA 3WG7B 5FCUL 4F7MB 2VQ1A 4U6XB 4S1RH 4XPHH 2PXYB 3AU1B 1A9EA 1Z5LA 4LB8A 4HPYL 4PJIA 3WS6A 1KTDA 3Q1SH 4A2HA 2DH3A 3EFOB 1FFNB 5CCGE 3N06B 3ZBMA 3DNKA 2AJ3B 3O8XB 3GBNL 4GI6A 3UG4A 1P7QD 1B3JA 2BP3A 2QEJA 5ITFA 4GAJH 3IU4L 4KTDH 4OCRH 1UB6A 5F93C 2WBJC 4OQTL 3NSCA 4X4XB 2V8LA 3U9UB 5LAXB 3DUUB 5DSCA 3BPNC 3NSYA 5FB8A 1ZVSA 4XWOD 3V9CA 3MPCA 3FYIB 2AGJH 5C0BB 1RLWA 4ETYA 3AROA 2GUOA 5DS2A 1M6OA 5E6IB 3FAWA 4D2NA 1NMBL 1NPUA 3MODH 4JFPA 4XO4A 2L3BA 2RQEA 1IGFL 1SXCA 3L13A 5BRZB 3N04A 2CR0A 3HAEG 5L8LB 1UATA 4JL2A 4OJYA 5F9DC 3O6FB 5EUKA 5J7CC 2J8HA 1SJEA 2RCSH 2Z8WC 1AHKA 1UFGA 1JZIA 5DMKB 1EAOA 5HPMA 4RMSA 4TTDC 1G7MB 4CGTA 1QFHA 1BFVH 4XBGB 1F90H 5DZAA 1OCRB 2WQSA 2WXFA 3VNYA 4XMPL 4HSAC 4K7PX 3GKWL 4L0YA 1JF1B 5CCKH 2AJXH 2IQAB 1N7ML 1OGSA 1N59A 2SEBB 1XZ0A 3C08L 2EDOA 2Y06H 1IGIL 4KRMB 1IAMA 2IG2L 4AUYA 2AVGA 3V52H 5C0JB 2FSEA 3IGAB 1BFSA 4FFTA 4ZS7L 4TNFA 4DUXA 2JWYA 4ZXBC 2YXVA 2CR6A 1ZCRA 3C12A 3X1FA 1O0VA 2X9WA 3IXTA 1RY7B 2ZG3A 3HG1A 3UPRA 7CGTA 3HN8A 4KNTA 5LCVH 2GBUA 1F1GA 5IQNA 4O2CB 5DUPL 1DJZA 1D3CA 4AE1A 1DN0B 5ADPL 4Z77A 5GJTL 2HPTA 3ISRA 1H8OA 4OF6A 4UT6L 3LKQB 3HMXH 3H85A 3DECA 1QFWH 1GPOH 4JHVA 3VGEA 1P4IH 3BVNB 4A66A 1M1XB 5F0LB 4AV5A 4AQ8C 4DK5A 3P4NA 1OB1B 1QHOA 2J5LB 2FBJH 2C9VA 3NIDB 2OV0A 3S88L 3C6LD 3QRGL 4M7LL 1UVQB 4JB9L 4MJ2A 4L9LA 1LO5A 2GAZB 4NZUL 5JW5A 4Y2DA 1IGJB 1G4MA 2VKXA 3VSUA 3ZMNA 3FU5A 2J21A 2DMBA 4ZDHA 1FVDB 4ADJA 4AK1A 4Z3HA 5AD0A 4N24A 1UA6H 2XQYG 1JCKA 3GSUB 1ED3A 1Q9KA 1NBVL 4HFWB 2EUWA 4HD5A 3GZOA 1S7XA 2E9WA 1ZT4B 2DWYA 1F45A 1B2WL 5CGYC 2GTWB 1VZIA 3V4UL 1Y1UA 2XQ0A 5TK2A 3MLYL 1PX4A 4BXVA 1MCLA 3ESPA 4K3DH 4HEPA 1E4WL 4PCSA 4YHKL 2XVGA 3BWZA 2Z92B 2KUTA 5AW8B 4X6DA 4CMMB 3IDNB 4XXCA 1JHLL 2AXJA 3H4HA 3Q01A 3KPNA 1ZKAA 4LHUG 3VWKC 3RWFB 1NC2D 3LN5A 1AQHA 1UCBL 1R5IB 1RULL 4RWHA 5T8IA 3RNKA 2GT9A 1MKFA 4LCUB 32C2A 3ZTEA 3IN2A 5DC4B 1JWSA 4HKBA 4JZJC 4LHJB 4NB7A 3ULSB 4PWKA 1IAIH 4KI5E 2HX9A 3N42F 4ZPVB 4FABL 2C1PB 1YLBB 4EIGB 1U42A 3MLWH 3S35L 4AV4A 3IETB 4RAHA 4R84A 5J9PA 4HISA 4MA1B 4NOFA 1INEH 1WAAA 1SLVA 2B14A 1UWXH 5AAMA 1BVKA 1VGKA 4XVJH 1PD6A 3CFEB 1F11A 2H32H 2PPAA 3FMGH 4WSKA 5HYFA 3DTDA 3UROR 2VN4A 3K72B 5TQ0L 3VM7A 4LEOB 8CGTA 1EO7A 2FGWL 3C2SA 4L23A 4EOWH 5GRYA 3ZKSD 4IOFD 4K73A 1E28B 1EMTH 4KQ0A 3QJRB 4TOYH 2XN2A 5J1TC 1EO8H 2Q1EA 3WO4B 1FF5A 2PXYA 1YMME 2EE2A 4YXHL 2XV2A 1YEEL 2YSSA 3AS2A 3EFOA 1N3NB 3QR2A 4LFHG 4LLYA 1FVEA 1HU8A 2C7UA 2WKLA 3MCLL 4LCWB 4U33A 1NDMA 1H8NA 1KBGH 2C9SA 5E9DB 2ADFH 5GGRY 1G84A 4PJ7B 2PW2B 3N50A 3ZE1B 3SYAA 3LIUA 4RDQG 5EU3A 1TVDA 2IAMD 2BINA 3G6JB 3DOSA 4X4XA 3U9UA 4MD5B 1BEYL 1P53A 5LAXA 1CLVA 3E1ZA 2TSAA 3HMWL 3CX2A 2LGNA 5BQDA 4KTEH 4BFGA 2I25N 1EK3A 2NY3B 5DFWH 2FWOB 4HC1A 1W72H 3PV6B 5E6IA 3WMQA 4CMHB 4ZPTA 5A2IH 2C26A 1IKFH 1D5IH 4LLDA 4KI5C 5BRZA 3MOQA 4FC3E 1JYXA 5AW5B 1CTMA 2ZZUT 3HKZA 43CAB 3K71A 3DSFH 2BVUA 3MLVL 2OYPA 1G7MA 4ACPA 5C97A 3G5YB 1I9EA 3GMLB 2DQUH 1I8UA 2R2CA 1KTCA 2RTTA 3FO2A 2XYCA 2CGZA 1CD1B 5I30L 5FLUA 1E5AA 4LLUB 5GS0L 1DANT 1SVBA 2IQAA 3ZDYE 5A6IA 4OZIB 3X12B 3N1MC 3DLQR 4IRJB 1S7RB 4GINA 4PHZA 3S37H 3CFUA 1U8OB 2BSSB 3BHBB 5ENWB 4AEEA 2B4CL 4IHOA 3CLEH 3ARBC 3R18A 1MAMH 4EPSA 2QVIA 2FX7H 2CMRL 3WIIH 4YK4C 2XXGA 3TBTA 5I1EH 3IU3B 3CZGA 4Z18A 5BS0E 1EXUB 4MCYB 2BPBA 3T71A 3GHEH 1M2VB 2HKHL 2CHDA 3O3BA 4AK2A 4H26A 1GH7A 3ILPA 1YYMH 3INOA 4O2CA 3IKCB 4PBXA 1W80A 2Z7YA 1DN0A 1U3JA 4JY4B 4FQQB 1P7KA 2G2RA 2FT7A 1F4WH 3BFQG 3HLAB 4GS7B 3MGOA 4FULA 1O5DT 3Q06A 2VXVL 3H7LA 1UD8A 1U21A 1YY8A 1DQIA 2CRIA 4P9HC 4RMBA 4HWBL 5ABAA 3RTQA 5FYJD 4LCYB 3V6FA 3T2LA 3Q7JA 2WAHA 1OB1A 5ICZB 3UZVB 1WC7A 3QUXC 4MKTA 4RAVA 3AMKA 1UVQA 4LVNB 5H4ZA 4X8GA 3OKNB 1OTTD 2DB8A 2D4FA 3O9WB 1OXYA 4HDIB 3ZVVA 3SE9L 4RX4D 5B8CC 4GBXC 1FC1A 3BFOA 4JKLA 1FL6B 5CINL 2WIIA 3MRGB 4HFWA 2R0WL 2XQBH 3MDJA 4XTRD 3BVTA 3GINA 1ZT4A 1TEFA 1Y6NR 2AZAA 2GTWA 3MV7A 2ENYA 4YEFA 5GXBB 4RRPG 2HFTA 2Y5TB 1I7UB 1AOZA 3MO1A 3MLZH 1E4KA 4F57L 2P48B 2EUXA 1HAWA 5I6OA 3JWOC 3SE6A 2B9BA 3UEZA 2RA1A 3VQMA 4V1DB 2YQGA 1WYJA 2P5WB 2Z92A 4CMMA 4IRSB 1RI8A 3IDNA 4TLTA 4CVXB 3T2QA 4XNDA 3RWFA 2VDRB 3QJOA 3QZLA 3BKYH 1R5IA 4I48A 1KCUL 2F7OA 2VLLB 5HD8D 1UYWH 4NZRH 1JDDA 2XIBA 2YMXL 4NWTL 5FOJA 1ORSB 3H2PA 4OCXH 3Q5OA 2OSXA 3PWPB 3WEXA 2BCKB 4GY4A 3OAZK 1FG2B 1AOHA 1J9CT 2IALA 4M02A 4N2BA 4YC2B 1NFIA 3QUZB 1PAMA 2B2XL 4ZFFB 4PVMA 3IETA 5I6NA 2BSCA 4FQJL 3C5ZD 3GI9L 4E9TA 5F7DB 3ZMEA 1H5BA 3JXAA 3TM6A 5KVGL 5GRUH 1PZBA 1RZKL 4DZ8B 3PXLA 4RNRB 2XWXA 1LDPL 4R2GB 3D39D 1WFMA 4L4VB 4MD0B 5TDOB 2NRDA 4XO9A 1THCA 1JXKA 4JQXC 3WTSA 3K72A 5JA8B 4AGNA 4ELKA 2A6KB 5IVZB 1UA3A 1OM3H 5K9JH 5PAZA 4POYA 5LO7A 3K80A 3EO1B 1E28A 2OP4H 5H8DA 3PYCA 4PJAF 1PG7W 1CMOA 4NO0D 1IJNA 4M43L 4ONOA 4XC1L 3WAKA 3SB3A 2R2HB 4H25B 4DKEL 3CSFA 3UL4A 1T2QH 4ZFZA 4BKSC 5JHLA 4EI5B 3K6OA 5DRXB 1N3NA 3V0EA 4NKDB 4E2OA 4LDLB 1V3KA 3JWNH 5E9DA 2DQFA 3ZTNH 4PJ7A 2UUDH 5D7IE 1MREH 2YN5A 3BJ91 1ZS2A 1L7TL 1TO5A 2X4TA 1FNGA 1ZANH 3GM0A 4FLQA 2XKSA 1G9HA 4LVOB 4NCC1 2VW7A 3JT2A 1XGQB 3HUJB 2W5PA 2FWOA 3L4CA 3N0AA 4F8OA 3ZKNC 4ENEC 1JZJA 4WK4B 2EH7L 2OSLB 3A0OA 1BOYA 2QSQA 5DQDL 2JKIS 4KXCA 2OPCA 2R51A 3UJIL 3D08A 1RIUL 1YEWA 2OTWA 4MJIA 1MY5A 4LCIH 5HGHB 2C9UA 4RISL 1BLIA 2WXNA 3I50H 5FUCE 3T0WA 1PYWA 4G6AD 3L45A 4QEGA 3V9FA 3EOYG 1L0XA 4JANA 2ADJB 3GMLA 4K7FB 1OGAB 1ZHLA 3L4UA 3UDWC 5C0RL 4OV5B 1N70A 4N2OA 1LM8V 1BBDL 3HPJB 4JM4H 1J18A 5D1ZC 5DUMH 4ZUWB 5AW9B 4P2OA 5IVXB 1YYLH 4LLUA 3VAEA 5C6TL 4N85A 3OZ9H 3CPUA 4RBPH 1CF8H 5KVEE 4IRJA 1S7RA 5KBMA 3QHTC 4NYLA 3LYRA 1U8OA 5J56B 5ENWA 2ICCA 1J8HB 4S1RL 3DVFA 2JCCB 1CQYA 3L1GA 3RRQA 1E6OH 1ZVYA 5E4OA 4YHLH 3L7FA 4CC0A 1ZK5A 2ZSWB 3Q1SL 4JKWA 5B1BB 1EXUA 3ZZQA 4L4TE 3QNYA 1U4EA 1KXTB 2WTRB 2CRYA 1OP3K 4B9KC 2BVQB 3D3VE 4MA3A 5KSUB 4OCRL 5AKVA 3IKCA 3ZTDC 1UZGA 1NC4B 1NFKA 1WT5A 1EJ8A 1GMIA 1S9YB 3OB8A 4Z3EA 2YRLA 5HJBA 1K8DA 1HSAA 2OW6A 5ETUB 3RG1C 2MHAB 3HA0A 3SPHA 2AGJL 4DP6X 2CRMA 3GMNB 1DANU 2OJZH 2XG4B 5KAQF 3C6EA 1KGWA 3BVVA 3RVUD 5CD3A 3DKHA 3PJSB 1HDMB 4RSYA 2ZTBA 3MODL 1NQBA 5ICZA 4BZ1L 3CMOL 4ELME 3SJVD 4NEHB 1A1NB 1PKQB 3OKNA 3NCJL 4HCRA 3SGKA 4QCIB 3WAJA 3W0WE 1O6VA 1KWGA 1EEQA 2WCPA 5KBDA 5FUCC 5A3ID 5CBAA 2Y6TE 2X3BA 1WWAX 2A74A 1BFVL 2WTOA 2OR8A 1F90L 4LSDA 2J1XA 3VGHA 4AQEB 5F7WC 3HI1A 4G2AA 4LP4A 4TN9A 1F3DH 2ZUUA 2AJXL 4O2FA 3BIKB 5EO0A 3B83A 2XWBA 1QUPA 2WSPA 4DFIA 2Y06L 5EBWB 2VR7A 2Y5TA 1OSEA 3JV6A 4OLZH 3O2DA 3P2DA 4HPHA 4P05A 3QZOA 3HC0A 2HFGL 2ZNXA 3SBQA 3U6XA 3V52L 5I1GL 3GB7B 3RZCD 4V1DA 3MBEA 2P5WA 4XRCB 3RPKA 1KJ3H 1MW2A 1SMDA 5IFHH 4CVXA 3TCTA 5DMGC 3DPBB 5AB0A 3K5SA 2TSBA 1GYVA 4ETQB 5LCVL 4URKA 3IMBA 2VLLA 4PLNC 5CKAA 4G43B 3BZDA 1ORSA 2DBLH 4MSWB 2JIXB 5A7BA 3CFTA 3MZTA 3O6KH 4ZO8A 2J1KA 4PG2C 5KSBE 3NJKA 3FFCE 5DS8B 5J1SC 3KL3A 1QFWL 3K1KC 1A3QA 1GPOL 4AG4L 1OSPH 1J0IA 1MHHA 1P4IL 3ZUCA 3TO2A 4UT9H 3D1MC 5IHLB 2WQWA 3LQZB 3BGAA 3QEQA 1TJHH 4Y88A 1MLBA 4E41E 3E9UA 5J12C 1T0OA 1WEJL 1BJ1H 4NM8H 4RNRA 4DVBB 4L4VA 4MD0A 4HGWB 3L4ZA 3SOBH 4PRPD 4J4PA 3TJHD 3UBXB 4BRJA 2A6KA 4AZUA 4QAMB 1WGOA 2B20A 1NIFA 3GSOA 4PWFA 4FXGC 3AWEA 3EO1A 4YAQA 3EXJA 3B9KB 5FUZL 1PCXA 3ZT6A 5BZDB 4HQQH 1BQKA 3P30L 5EZIH 2LAAA 4EI5A 4UU9A 3SDDA 2DMKA 4NKDA 3U30C 5HYIA 3GZPA 1E9PA 1I1FA 2C9RA 3BZ4A 4B95C 5FO9A 4HZLA 3LQAH 3LSOB 4YUEL 3F6JA 2DQMA 5GPRA 2WZ0A 3LNGA 3SZKC 3OXSA 3EUUA 1ERNA 2E6QA 3H2QA 4KKLC 4PJIF 2X4OB 1G43A 4YSCA 2HX7A 4B27A 3GBLA 2V3EA 4LEXL 1KFGA 2WZ6A 5CIPB 5DF0A 3VG0H 4JMXA 4X5RA 3MUGB 1OPGH 3RFZB 2KYIA 1IAIL 3MV01 4A68A 2OSLA 2VXTH 1BIIA 4AXWA 4DUWA 2XWJB 3MLWL 3QEGH 4ZUVB 2J3SA 5GRJH 2PTUA 2X7LB 1DBKH 2UZXB 1IAII 2D3VA 1INEL 4B6ZA 2DQJL 2PO6D 4QTHB 4P9ML 4UV7H 3Q2CA 1EIBA 4J23A 2ADJA 2YAMA 4XVJL 1LEIB 5AWNH 4KO9A 1PQZB 3OL2A 1WAPA 1AGBB 5FO7A 2E9IA 3RIKA 3KWXA 4ZUWA 4YDIH 1AS7A 2MCPH 3X3FH 4P49A 3JTTA 4QHNB 4UOQA 5J11C 1FZOA 2JNZA 2ZUXA 4KZ0A 1YN7A 4U4BA 3KWWA 2Y7SA 1NCHA 3FCUB 4TOYL 1EO8L 2GEEA 5DRZB 1TQTA 2BOBB 3C5SB 1F4XH 2IEPA 1J5DA 1T20B 3U48A 5IR1B 3LZQA 2DEXX 2P43B 4X5PA 4NQDD 4TVUA 4KROC 2VAJA 2XRAH 5CJ8A 1KXTA 1U8IB 1LK2B 4E36A 7FABL 1KBGL 1G1CA 1NBQA 3AZUA 1S7TB 3VXQB 3RY4A 2BVQA 4R0LB 2NY0C 4F15B 1ZPLA 2JVUA 3GMPB 2E7LC 4JM0A 2YAOA 2F58H 4HGMA 4MS8C 5TDPA 5KUMA 2IFGA 1NMCB 2O61A 1MRDH 3CN3A 4GOSA 1C7SA 2MHAA 5B7EA 1DVZA 4FF9A 4GEJA 4H7VA 3RVVC 2ZKMX 1W72L 4X7EC 3OAYK 2WJ7A 3PJSA 1ZSHA 2Y6SC 2ZF9A 4RFEB 1IKFL 2XWCA 3ZDXF 4G6MH 4ZX3A 3MLTA 4KO7A 1J0HA 1YNTB 2W9EL 1PKQA 3BMVA 3FULA 3H0TB 3DSFL 4WWNA 3QQDB 4NC0B 3ZKMC 1KPUB 2OYLA 3MTXA 2BZDA 5IVOA 4ERSH 3BC9A 3T9WA 3K2KA 2DQUL 3FUKA 4W9CC 3UBGA 4UAHA 3OKDB 4Y16D 2ENPA 5E6RB 4U1IB 1EA9C 2MQCA 3HBQA 2X5PA 3RDTC 2WXQA 4HWZA 4A55A 5FKAB 1ZPUA 4L4JA 3Q05A 1B4RA 3S37L 4JG9A 1JDCA 3VWJD 1QP1A 1NEZB 5A2FA 3ZT7A 2CGRH 5JIHA 4EMZA 1MAML 4I0CC 4E9YA 1KT2A 3KW8A 2JSFA 3O4LD 4Z78A 5I1EL 1NLBH 2IH3A 3CFBA 3CZKA 3VX1A 3C09B 3DPBA 3QXDB 2B15A 4EKJA 3GHEL 1FFQA 2A83B 2EVIA 2XKNA 3QG7H 3QWRA 2YZ8A 4YDNA 4ETQA 4EAEA 4B7IA 3T6QC 4G43A 4QT5A 5EIVA 1BQHG 1F4WL 4MSWA 4M6NH 2PYED 4WWID 3MUUA 4XMVA 3U1PA 3H8NA 5DS8A 3L3DA 1GKOA 2DEYX 1EAQA 4GUCA 2H9GA 3WXVL 1CBVH 2NNXA 5LDUA 1P7QB 2P8LB 3GMQB 3QFJD 4QRUB 3C60A 2NX5E 4HT1L 3L6FB 3WJLA 4ORGB 1Q90A 5EZJB 3ZE2B 2H0JA 2VERA 5FUOH 4GRLA 1X5MA 4L8DA 4HGWA 3I75B 4GSQA 5FA3B 3DTXB 3QDJA 1DQTA 1KIQA 2QADB 1TJXA 1AFVH 2VLJD 2XQBL 4I9WE 1WAAF 3GRWA 3QCTH 4NP9A 4ONFH 1PLGH 2WWOA 4OCNC 5JOFB 2ZXQA 1TZIA 3FSAA 1XSOA 2X09A 4P57B 5EZPA 5I8CB 5MP6H 3BUTA 2UUDK 4ZMPA 2X2IA 1TYJA 3WBDA 3MLZL 5D4HA 3RNQB 1TTAA 4D9RE 2JB6B 2B3RA 4LKXB 4P23A 5DC2A 5I15H 4Y4KD 1MZZA 3IDMA 1T7WA 4S0HA 3PXJA 4HHWA 2NNFA 3TS8A 3I9PA 5ESVB 4A04A 3K5RA 4PJHB 3FB5B 4HCFA 3BKYL 3FO0H 4YBQC 3VRLF 3ARGD 1C9SA 4NZRL 5KYWB 1PG7X 4NQTA 5CIPA 1SY6H 4MQSB 1YUHA 1PU0A 4OCXL 5D6CB 1TVHA 4ZMAT 3MUGA 3RFZA 4XX1G 2AEQH 3T8VA 2UZYB 4B96A 3QUYB 3UJJH 3AB0B 3K4DA 5IROD 1A6VL 4AMXA 2D9QB 1PAZA 2HLEB 4K7PH 4C59B 1M2OA 3CU1A 5IW6A 1JRHI 3F6IA 4RBPK 4GJTB 5GRUL 4LCVA 1PQZA 4PU2A 2AJYH 4FFYA 5L2KE 3OF6A 4M7ZB 2RH0A 3QIWA 4LPWA 2WQAA 1AKJD 4C55A 5TE7H 5KUKA 1OM3L 4KFMA 3BISA 1PDKB 2V33A 5ISZE 3MR9A 3WI9A 1A7NH 3W38A 4QR7A 4AMWA 1RUAH 2BOBA 4HJ0C 1J8SA 3LMJL 3D4YA 1IC7H 3QDHA 5E5MB 1T2QL 3HOGA 1HWGB 2VUOA 2E76C 1GL4B 1KGJA 1QSFB 4MYPA 3VXQA 1S2EA 4R0LA 4PGZA 5IJDC 4AGQA 1KBWA 1FSKB 1MREL 3VFRA 1BVLA 4N3UA 5DZJA 3BAJA 2ATPA 3PPEA 2VMFA 2FD6H 1ZANL 1D6EA 1ROWA 1MW1A 1KENH 3OHXA 3QDMA 4ZRGA 1COBA 2W38A 5MEPB 2CU9A 5EIIB 3FT3B 1IEAB 4X5WA 1MPAL 4I85A 4K9EH 4RFEA 1AZUA 1OAKH 3SBRA 3LY6A 5DK2B 2ED6A 2DQGL 4C56E 1I75A 2Z65C 4HULB 3WNNA 1IAKB 5FW6A 3KXFA 1BZ9B 2E9GA 2WXHA 4HP5A 3I50L 1EZUA 3TO4C 5FYKL 3ALWA 3H0TA 3RVWC 1JHKH 3EFFA 3TIDB 3EGSB 2L7JA 3KPLB 4G1MB 3S5LB 1T66D 2IPKA 5CHNA 4U1IA 2GSIB 4D0BA 5FGRA 3G5VB 3MJ6A 3C6SB 5FKAA 3OZ9L 1CF8L 2XJKA 4GSXA 5GS0C 4ZT1A 3W39B 2DZEA 4R4FH 3N44B 4KDWA 2FYYB 2LAGB 5DJ0A 4W68A 1DJHA 1ZTXL 2B4CC 2LE9A 1JNJA 2WUCL 4YHLL 3P2TA 4QPEA 5F7EH 3SDAC 2KLTA 2R1WB 2Y2TA 3WEMA 3S8GB 3CXHK 4R3SA 3SPIA 3TH4T 1ZLDA 5CZXC 1OCWH 1G7JB 3STZB 2KT6A 1KNOB 5C0FB 8FABB 1XCQA 1CFQA 3FK3A 4B3EA 4JZOB 1XF3B 4EF3A 2WBJD 1WQVT 4Y1TA 4Y9GA 1JVLA 3QJFA 2WQVA 1V05A 3SPCA 1C12B 1BMGA 3T04D 3RX7A 1JGUH 2OJZL 3K6NA 4L3ED 3US0A 2DMHA 5KYNA 1B0IA 1RKRA 4ORGA 2KPWA 1DQVA 5EZJA 2X6VA 5KVGE 1AHWC 5JIPA 3MJ7A 4KVNH 4JG5A 4UOW1 2P3YA 1BP3B 4QTIL 3H54A 2ADGB 4JPIB 4E5XG 5FA3A 3DTXA 4TTDD 2IDTA 1XIWD 1U8MB 4GAGH 3ZKXB 4AWJC 1RZIA 1GGBH 3NEOA 4P57A 1OAXL 3FQTB 4RGMB 5IBLC 1FLTX 4OLZL 1A8ZA 2EABA 1KBVA 4JO3L 1UGNA 2G30A 3MJGX 5DU7A 5ANMA 1YC8A 1OD7A 1MJJB 3KE0A 3PGDA 1KLUB 2R9HC 2WPGA 3GRWH 3KLKA 3MV11 1OZTG 4MASA 5IFHL 3IM1A 4PB9H 4OUUB 5FF6A 5EUOB 2FX8L 4ZXBD 1ZV5A 1ZGLM 2YOCA 3FB5A 4NQXB 4QMEA 2EDDA 1CXFA 2QLYA 1BYNA 3UYOD 4APQA 1J12A 2DBLL 1FNFA 2GG1A 3OJDB 1I3GL 1HWWA 3QDGA 4PJ7F 4XXDA 5J1AA 3RB5A 1U8JB 5B1AB 3QUYA 3HC2A 1REIA 3HI6H 4RGNE 2NYYC 2H0FA 4D8PA 1VZGA 4XNBA 3FW6A 4DKFH 2TRHA 1GZHC 1TJHL 3FQ1A 4BGLA 1R3JB 3K4ZA 2GJ6E 3NVQA 3GK8L 3OKKB 3GSQB 5GRXG 3TF4A 2CE6A 2DEWX 2N0KA 4D0DB 1J1PH 4NM8L 5C08B 1RZKC 5CBEB 4NQCB 5E94A 4BFJA 3HNTH 3SOBL 5FC9A 5B38G 1Q9LB 3OXRB 5KG9B 1E3XA 4KO6A 1FNEB 1PDKA 3IMTA 1ZA6B 3ARFB 5DR5H 4PJAE 4M1CC 3SO5A 2CCLA 3UO1L 4WCYH 4QRTB 1RSYA 5CGYD 2DW5A 2AXHA 1JMXA 1SBSH 2ORBH 3ENEA 2ZWNA 3BDYH 4GT0A 4KY2A 1X7SA 2XICA 4NCDA 3DJSA 1QSFA 3AG2B 3E80A 1CT8B 3LQAL 5EOTA 2AP2A 4AM0Q 2NR6C 2CM6A 5MI0C 1GW0A 1JK9B 3FC8A 3GJFH 3JV5A 4X9IA 4JY5L 4NN6B 2F9BT 2OKMA 2ICWB 3B2VH 3I2CH 3KAAA 5D6DA 4CL7A 5HDWA 5I1DA 3OKEB 5D2NB 3UXFA 5FYJU 3AS0A 1V5JA 3P1VA 1E5UI 1OPGL 2DYPD 2VXTL 4OGYH 1A3ZA 2CBTA 1Q94B 2FQFA 3CIAA 2IPUK 5DK2A 5CLZA 1HCVA 5GRJL 1QSZA 2YWZA 4RGNC 1DBKL 3VGAB 3RKDC 2JJTA 4UV7L 2DBJA 2VDNB 3PHOA 5SX4I 5AWNL 3S3SA 3EXLA 4OFIA 3S5LA 2VDLH 5IB1A 2E74C 2Z7UA 2GSIA 4EZMA 3LEYH 4EZKA 1SNRA 4YDIL 3RJQB 3X3FL 3UPCA 5AB9A 4KK6C 1E8XA 5B1JA 1KSRA 2WXRA 1UD3A 3PQYE 1IM3A 3W39A 3QAZB 4I8DA 3RL2B 4AYDC 2FYYA 4KHTL 2GIMA 2PW1B 1M7UA 1C08A 1OWRM 4HALA 4BH7B 1DVFC 1LEKB 3BQVA 3VD7A 1E6JL 1HQ4B 5CP7A 2VNCA 1GOFA 2JTYA 5K9QG 2XRAL 1OP5H 1NOAA 1TU2B 4PJ9A 1G7JA 1QI4A 2WMPB 4F9LC 3STZA 1QLEB 3SE3A 5TH2A 8FABA 1G7PB 4M5ZH 2F58L 4JZOA 1EPFA 1XF3A 2WSKA 3VI4B 4JFVA 5E8EB 3PLYA 5EIQA 5CM1A 1BECA 3OG6B 4UZUA 2EVGA 4N4YB 4XOAA 5DHXB 3TYFB 1D9KC 4LHUD 3R4DA 2FT6A 2VGLM 5FGBA 1CE1H 1TZHB 5KAQG 4OTXH 3V0AC 3MNMA 1MJ8H 1UM4H 2C3VB 2GCYB 3FF8A 3MYJB 3VYNA 3ZYIA 5SWSE 1J1OL 1W8EA 3G7TA 4QXVA 5KBNC 4MDRA 1W0WA 1WJ3A 2A0LC 4KI5D 1CGTA 1WG3A 3HHMA 4G6ML 3GRGA 2A73A 5T1JA 3B8SA 1HJBC 2GFBB 4JPIA 5GSVB 2IH8A 3VFMB 2BIOA 3S4SG 1WBYB 3DIFB 4RIRA 4TS6A 1AC0A 3K8LA 1U8MA 1EHXA 3ARTA 1YEFH 3GQFA 2R2BB 3BXNA 2FJGA 1N5AB 1RD6A 3P9LB 1J10A 4X7CC 3P2BA 2K4WA 4NO2A 4B3VA 4JY6B 4N5EC 1D2OA 2R2EA 3MNVA 3B2PA 5MENB 4Y8DC 5EO1B 1MCIA 3NCFB 2CGRL 3WUWB 4BYHA 4FCAA 1MJJA 3ARBD 1M71B 4IIZA 1KLUA 4OIFA 5C0IB 4KKBC 3IGUA 1BFOB 1AI1H 3II1A 1YMMD 4IMKC 5DQJA 2BHUA 4UNVA 4PLKC 2VL5B 4XCNB 3B34A 5IQ7L 1DBMH 3BWAA 3QG7L 4FNLH 2R39A 2OZ4A 2YXMA 4LFHD 3O2DL 2WOBA 1LE9B 3ILDA 4PY7B 4EKXA 2HFEA 3VACA 1BX2A 1X5GA 3TIEA 3B43A 1ZV2A 4M6NL 3VFNB 4MXWH 1ZTMA 2MRYA 1TYRA 1U8JA 3HLKA 3NK4A 1CBVL 4XODA 4KV5F 3VD2A 1CDUA 5EEWA 5EU4B 1LEGB 4U6HA 4BFRA 3QUXD 4K8RH 5FUOL 4FXKA 3CK0H 2QKIC 4RMUA 5C08A 4ZG1A 5CBEA 4NQCA 1JD9A 2ZYRA 5FFOA 4A1RA 4WIQA 3RY6C 5ACZB 1Q9LA 4LIQH 5C0AA 3IJYB 5IGXL 4GBXD 5BJTA 1AFVL 2NDFA 2R69A 1FNEA 1OAJA 2MOVA 3QCTL 1PLGL 3IJSB 5FEBA 1ZA6A 3ARFA 4H44C 3ZRCC 4L2YA 3TV3H 3SJVB 5E1HB 3ZYOA 4UYQA 1DSYA 1IKNA 3GXPA 3KPQA 4PRNB 1PY0A 1MFAL 1OLLA 4LMQI 3AITA 3FQYA 1E5CA 3I02B 1AJ7H 4PGEB 1CT8A 1NLDH 2D31A 5I15L 3V6BR 3L2NA 5FDYA 2DPKA 4OD3H 1KN4L 4CUCA 4JKKA 4X9GA 5KYUB 3QJZA 4JL1A 5B4MC 1JGEB 2PPFA 3FO0L 5BS0D 5DGRA 2XPGB 2CDEA 4PJIE 1BF5A 2ICWA 3A67H 3JTSB 1ZA3B 1SY6L 3OKEA 4N5UA 3OLDA 1IBGH 4IBUA 4G5ZL 2YAQA 4PD4K 3FUJA 2AEQL 5FYLH 4JFEA 3UP1A 5T33L 1Q94A 2YGOA 2CK0H 2EIKB 3HZVB 4P8QA 2BVPB 5ICYB 4K7PL 2FNWA 3W56A 2XACC 5I74B 1JD7A 5EC1B 4G3YH 4M93C 2R7EA 1ZGLA 1DUYB 5IVNA 1TSRA 3SGJA 1A4KB 1TNMA 1P69B 1MFDH 3RTLA 1BXAA 3Q48A 2AJYL 1OE1A 3L3KA 4R5VA 3GUTB 5D7JC 4PBWD 3TGXA 4ODVH 2EUVA 2GJZB 3CZFA 1R1CA 1QTPA 2B0SH 1A7NL 5DCCA 5C0CA 1RUAL 3GD1C 1IC7L 1D5RA 2YK1L 5A2LH 5H35B 1QTYT 4PRPB 2F2HA 1LEKA 3LXBA 4QHLA 5D7HA 4DNLA 5M94B 3KPMB 3OTTA 3J8F7 1K72A 2VLKD 2UVFA 1HHIA 2ESVA 1TU2A 3OLGA 1JF6A 1MAJA 5CJXC 2YFNA 2W65B 2C3GA 3W9DB 1S5IL 3ECQA 1G7PA 2IQ9H 3EJSA 3MU3A 2ZAHA 2XV6B 2FDBP 2XI9A 3VI4A 4GRMB 5BOPA 2V2XB 2FD6L 2WK2A 5BCAA 2A9ML 3TYFA 2QLVB 2KQMA 1KENL 4E9VA 3WS6C 4AOFA 4UM9D 1TZHA 3DJRA 4OCLC 1EEZB 4RQQB 2OMUB 2GCYA 4K9EL 4NERA 3NA4A 1MCNA 1HHJB 3ZKND 4ENED 5C2BH 1S7VB 3LHPL 1NGZA 1OAKL 1ZSDA 3I84A 3ZDXE 2E8ZA 1TTBA 4TQ8A 1ZXKA 4WRLA 2VC2B 2GFBA 5GS1C 4O02A 3H9ZA 1GMEA 3NESA 2JF1A 5GSVA 1HH6B 3AWFA 3JVFC 3BOVA 3WSQH 1ECYA 3TTSA 5C0DB 4NRYB 4YJZL 1LJMA 2R2BA 4J1UB 4IIQA 5D1ZD 3QUMA 3E6FB 2J8UB 2QR0A 3WCYA 1JERA 2GQHA 2C34A 3GDBA 5MENA 3W81A 3PPSA 2NY6C 3P11L 1G1YA 4OGXL 5CSBA 2V9UA 3HZYA 2QQNH 5F9JB 1T6BX 3PV7A 5CMAA 5C0IA 2ZCLL 5F7EL 1NCTA 1K4DA 5LKNA 4M5YH 3VU2A 4HKZA 3S34H 2VL5A 4PJ6A 3IE9A 3IVKB 1OCWL 4D9LH 3DXAA 3CH1B 3FH7A 2XX0A 1PLBA 5EOQH 1UOKA 4C54A 1Z1WA 4H2CA 1LE9A 1CYGA 3QP3A 3PWLA 4M4PA 4TUJB 1AGCB 1B88A 3ZDZB 4HEPG 1CFSA 2DL9A 1KTJA 1RCYA 4PS3A 5F7LB 1MZYA 4NQDB 1HKLL 5KBLA 1A22B 4JN1L 4QAWA 1ZOXA 1JGUL 3QNXB 4WGKA 5HJ3B 1JZGA 2VIRB 4I0PA 4L0PB 2QHRH 4H1LA 1T7VA 4YGVB 2V2TB 2OZ4H 3MFFA 3Q43A 1WFUA 3O11B 1DZBA 2OMZB 1KGCE 4FHKA 2HFFB 1FORH 3HTLX 5D4IA 2CA3A 5DJCA 2F54A 5HYSA 3PWNB 3FTYA 1EJFA 2R29A 4BA0A 2W95A 3M88A 4U2YA 1B0WA 1R3IH 1H3VA 5ACZA 3GBEA 4L8CA 4GAGL 2WQUA 4QNPF 3SKNA 1WAAE 3BW9A 4WZ9A 1AS6A 1ZRUA 2DD8L 2CO6B 2OQJB 1YN6A 1HVXA 2ZXGA 3KL5A 4N6QA 5I24A 3RDJA 4JPVH 4L9LC 3CNKA 2JJVA 5I1LA 3FT1A 1U41A 2ODHA 2R15A 2ZYHA 3GLAA 3GJFK 4Y2DC 3UIZA 5B1KA 1QR1A 4HOWA 4FI7A 2X40A 3JWNE 1SHSA 3GRWL 2HMIC 3ESVF 4GFXA 4Z7UA 4PB9L 3V0GA 4OLUH 4LNRB 5KYUA 5DMGD 1XF5B 3A22A 3MLSH 3VWJB 2XPGA 4L4TD 3VX0A 2XWTA 2XN9B 3O4OC 5G2NA 3OX8B 3VRLE 3VUAA 2G0KA 5J6GB 2R4RH 1WCBA 1ZA3A 3VD9A 1W0VB 3D3VD 4QLWA 3O4LB 3WNPA 4G9FA 4HIHB 3OR6A 2LABA 4U1SB 3U1SL 2J25A 2K9UA 3E6HB 4S1SH 4W1TA 4XXCC 1DJIA 5A43C 1DQLL 1F3DJ 2FR4A 1VACB 3IFLH 4WU7B 4WHTB 2ITFA 2G5UA 4DKFL 3BCDA 3BEWB 3NA9H 4KY1H 4M29A 4XGZB 5FYKE 1VADB 4ZW3A 1XF4B 1M3JA 2XA3A 1X5HA 2PYEB 1NCIA 4R97C 3GSVA 1XSIA 4ANUA 3Q5TA 1S46A 4YHIB 3EJZC 2JKTM 3TA4D 3SD2A 1Z5HA 5BRZE 3BYYA 2H8PB 5JPNA 3BIAX 3GFUA 3W0WD 2QHLA 3QFJB 4F7TB 1TXKA 1OP5K 3K2UL 2AMGA 3FRPB 2WGXA 5DR5L 1ZTXE 3EH5B 4WCYL 1DLHB 2CO3A 3IMUA 5AAMC 4AIOA 2YMTA 2CJTA 5F97E 1SBSL 2ORBL 3CXHJ 4AT6B 1GZQB 4PRPA 4BFBD 2A9AA 3ERXA 2KDYA 3H9HB 3KPMA 5JW4R 3ILEA 4N0CC 2VLJB 2OULB 3AABA 3W9DA 2G0LA 3GGWB 4PCTA 2C9QA 3JWNC 4WLCA 5T1MB 1BCIA 3SKJH 4GRMA 1WFIA 1OOAA 3B2VL 3I2CL 4KKLD 1LMIA 4XNMB 5F0MB 1BJ1J 1L4IA 5HDOA 1XCTA 2DWDB 4W93A 5HDBB 1EEZA 4RQQA 4YLCA 4P2RA 4Y4KB 1O7DE 3BGMB 1A6TA 4Q58C 3IGKA 4OGYL 5A16B 4FRWA 2K78A 3FFCD 5TQ2L 3ECBB 3ARGB 4G8AC 4K15A 3D0VB 4YO0B 4Z9KB 5T3ZH 3CSTA 4J6RH 2V5SA 5IFJB 5CUSH 4ZFGH 1KBKA 2V37A 5MEOA 3RUGB 3AUVA 3BVWA 3PWUA 2VDLL 2HG5A 5C0DA 4E41D 4JHWH 5E6IC 4S2SA 3LEYL 1AO7A 4I1NB 2H2SC 4J1UA 2LU4A 5B3NA 3E6FA 2J8UA 1ASPA 1TTFA 3CU7A 1CXHA 3VA2C 4HIJA 3AU0A 2BFVH 4WUUB 3AT0A 2UY7A 1B0RB 3LB6C 2VMDA 4O02H 1YMHA 4KZEH 5CKGA 1CTNA 4CSSA 2YGVA 5F9JA 3TBYB 5JORB 4FHJA 2VDML 2B3IA 3QHZL 1NBYA 2AQ2A 2EIZB 3IAGC 4ZMVA 1C16B 1J9QA 2NCMA 4NQED 4LO9A 1SGKA 1PG7H 4KRPC 3QUMH 3GSRB 4KROD 4YH6A 3NZHH 3MV7E 3CH1A 3KH3A 1JPGB 4AQ1A 4TNGA 2A4ZA 4JQIH 1F56A 5CGMA 6FABH 4M5ZL 1JV2B 2NY0D 3FTGA 4HF5H 3AXHA 2WM0A 4K7PY 5C1MB 3M17B 1ACYL 4MS8D 4HMDA 4U1NB 4JJ5B 5E2WH 3QNXA 1QEXA 5HJ3A 4HS6A 1QW8A 4JS7A 1F2XK 2HT4C 4GEIA 3VGGA 3ZPDA 3K91A 3RVVD 1MJ8L 1OARH 4XN5A 4A2FA 5HJGA 1NCGA 3BMWA 1O7DC 2OMZA 2PPDA 4QF1B 3ABZA 4F91B 2Y6SD 2Q6WB 2ZP0T 1I1CA 4Z7WB 2EDNA 1SXAA 4KRNA 5IB4B 1HNFA 3MCKB 2X4UA 3MRIA 4LVHC 1I4FB 2DYSB 3C5XA 5DJDB 3E7JA 3QCUH 1XH0A 3DYPA 3FOMB 4UT7L 4XP6H 1A47A 5JYMA 3ZKMD 3SKMB 4H1LH 2B1AH 3RTQC 3LZFH 2G2NA 4MAYA 5E6YA 1J9SA 1YEFL 4RH4A 3KCPA 4X8JB 4IKIA 3EZJB 3V4VH 4M8RA 5C9KA 3RDTD 2CO6A 3NCWA 4E9RA 4EQ3A 1WA1X 4DGIH 1OTSC 3FN9A 2ILLA 3WY3A 3D4CA 5GIRA 1MVUB 1HHGB 4XPBH 4AJYV 1VEOA 4O51B 1GW6A 4Z7QB 1PLCA 4M61A 1AI1L 3Q3GB 4LNRA 4OJAA 1DBML 1RZGB 5I28A 5KYYB 1XF5A 2VR5A 4FNLL 3U2SB 2QELA 4M62H 5TTRA 2COQA 2XN9A 4E9WA 3OX8A 3DX2A 5F7MC 4F8QA 2OMTB 4M8VA 5J6GA 2KS0A 1E40A 2C9XA 2PWDA 5DEFA 1E4KC 4KJYB 4JFOB 4XBEL 4TQIA 2DLEA 4HIHA 5LWYH 3ARUA 3BPOC 1KEGL 1GY1A 3E6HA 2ICES 3HPLA 4M8UA 1NFDB 3HC3H 4WU7A 5E0FA 3L3OA 2BVEA 4NO5B 1KC5H 4G6JH 4XGZA 2JLPA 1BGXL 5DJYB 4ZI8A 1DVXA 1UOLA 3CK0L 3SZ6A 2Y0SA 4GUPB 3WE6B 2XJLA 3BPNB 2P7TB 1PW3A 5I73C 1BVNP 3ESNA 4J7RA 2H1PH 1I8LA 4LIQL 3CHOA 2APTA 4MJIE 4NT6B 4ODUB 4W9JC 4WEBH 3WKPA 2Q9OA 3FRPA 2EEXA 4MA1C 3ZR6A 3TV3L 4KAQL 2PPEA 4R5TA 1H5BC 2ZCKH 3LXCA 4CILA 4YSUA 4Y5XA 4NAQA 2CPUA 3PJNA 1GZQA 4AT6A 2VZOA 1OSZA 5DJXB 3ROOB 1NUDA 1AJ7L 3KEHA 1NLDL 5F3BB 4GMTL 3T3MF 3QR1A 1QW9A 4X9HA 1RHHA 5T1MA 3GXUB 3OZLA 4B50A 2DV6A 5IQ9A 4FZ8H 5EEXA 3L3JA 3RVTC 1ETB1 4YBQD 1OK0A 2VAAB 4L8BB 2NUTB 4XNMA 3EYFB 5HHNB 1EERB 1A21A 5G4OA 2PTVA 2DWDA 2AQ3A 1A3LH 5FYLL 3BGMA 4FD0A 3S7GA 1A7RL 3P4MA 4ZXBB 1HJCA 4WGVB 4MA8L 3GKZA 2CK0L 4IJ3B 4R9HA 2FIRT 3MRPB 2XG5A 1QWNA 3ARGA 4OZGA 4N1HB 3V7AG 3ILQC 1D5MA 1JPFA 5AW0B 3D87B 5IFJA 4I5BB 3L9RA 4ZMXA 4G3YL 1VA9A 2NX5D 1PGRB 2NY3C 3N1GC 3REWA 5JUEH 1UJTA 1YAZA 2I7OA 4ODVL 4X4MA 1KPRA 5C92A 2GTZB 4Q6IB 4WUUA 1VFOA 4ZQKB 1B0RA 4P3CH 3MUHL 1LLAA 4YSPA 3T2PA 1IGMH 4I9WD 5AVXB 4RZCB 4GQQA 4HJ0D 3QJHB 1D7DA 3HAEB 5E6UB 2EIZA 1JZHA 1AXTH 2E7CA 2FE0A 3ZHKA 1OHZA 1TENA 3LKPB 2YD2A 3KPPB 4P2OC 1JFQL 1M9SA 3IDUA 4L18A 5L88H 5LBSA 1JPGA 4H0GA 4ZODA 4IRJC 3EBGA 2IQ9L 2G2PA 3VJ6B 4D9RD 4NO3B 1JV2A 2P5WE 3BEVA 3CBKB 2EC8A 3PF2A 1CFTA 4FKKA 4U1NA 2WV3A 2OYKA 5CGBA 4U3SB 3L2LA 2VZUA 1Y18B 3WN5A 3RGVA 4AITA 1UT1A 2MOQA 1AC6A 1INDL 2HJKB 3F12A 4BE5A 3VWKB 4Z7WA 1WT5C 5IB4A 4JFDA 4GO6B 2CLZB 4A2LA 3UZQA 5DJDA 4IOIB 3TO4D 1H8SA 3RVWD 1O9WA 3SSGA 1L9SA 4RETB 3SKMA 1WWBX 5AALA 3U83A 3NSJA 2DYPB 4JZJB 1YEJL 1MQKH 3SYCA 4JFYB 3KLAA