2AAVA

Solution nmr structure of filamin a domain 17
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
GAMVVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the GPIb-filamin A complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Filamin A
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aavA00
5EOQL 3VXSD 3GUTA 4NQSA 4YHZH 3TO4B 1UZ8A 4KJYA 3O0RH 4HUKB 4X4ME 1SY6A 4M93B 1S7QB 1CTOA 1TPXB 1XGUA 5CSZA 5I1DB 5KN5A 4GG6E 1RU9H 1MCKA 5EO9A 4G6AD 5CP7A 2E7CA 1MNUL 4MAUH 5M7QA 1FNEA 4YO0A 3QYCA 1HHGB 3G04A 4KJWC 5CBAB 3MGOB 3DO3A 2DQEH 4OJFH 2XIDA 4Y4HC 3WUWB 3X13A 3QO1B 3V4PL 3JV4A 1RK0A 4Y5YC 4N5ED 3G08B 5GS0H 3HG1B 3X12B 1WEJH 3OBAA 4JFZL 4G42A 4X98A 1ZANH 3OAZK 1G7HA 2X89A 5DR5H 4F37K 1WCBA 3HNSL 2VE6A 2HH0H 1K5NB 5CSZB 2UVEA 1UB5B 2VLJE 5D6DC 1TVDA 4FOMA 3RIFF 1PY4A 1SMOA 2BP3A 4WI8A 3L3DB 1CBVH 1EV2E 4P3CL 5GS2D 4M93C 2ED8A 4UUJB 4G8IB 3C2SA 3F6LA 2P7TB 3W11C 1C16B 3O45A 1HKLH 2W59A 3BH9B 4Z78A 5FO7A 1Z3GH 4N9OB 3L3KB 4UT9H 3BGFB 4XP6L 5DDHA 2MHAB 4WHYG 2J12B 5DJ0A 4LVOB 4QRQB 1AHWB 4TNVF 3MRRA 3TYFB 4JRYE 2J5LB 1BFOA 4PJEF 3S35X 3TIEB 3BHBA 3IDNB 5JORB 3D2UA 2GJ6A 5C0RL 4YHYC 4JO1H 5EU4B 2EYRA 4F3FA 4PJIA 3KPSA 2MKWA 4OKDA 5DJDB 2GJ6E 4WUUB 1YY8A 1KLGA 3AREC 3BAEL 3KPSE 5DUMH 3B43A 1D5IH 1OGTA 4ETYA 4LCUA 3BH9A 5H2BA 1J18A 1N5AB 1RZIA 1S9YA 2AAVA 3CVHA 1SEQH 3IXTA 2ZCKL 1WC7B 1WCQA 3OR7A 3E3QE 4UQ2B 3K74B 1XEDA 3GMPB 2OYPA 3Q2CA 4ZNEE 2ICEB 5EUKA 1AD9B 3W9DB 3B5HA 2HJFA 4MNGB 5EZOH 3ZDYF 3ZSSA 3RPKA 4I0PA 4RGND 4LP5A 3Q5TA 1T7VA 2G60H 5EU4A 2W0PA 1X6NA 4OGAD 1IGFL 2EC9T 4TTDD 1MAJA 4MLIA 5KBNC 1OLZA 4JFQA 3PHOA 5I1IL 4XNXH 2JKXA 3F7YB 3TT3L 3MUJA 1DN2A 1NCDH 4R4ND 4ELMA 1JPSL 2GTWA 4LSTL 3JWOL 3H3BC 1KBGH 1NGPH 4HKXB 1NL0L 3OAZH 4KTYA 4U3CA 4I3RH 2YRLA 1BZ9A 3T77A 3OR7B 4M1GL 1LE5A 3HC3H 3Q6FA 1NANI 2X70A 4K3GA 1AGCA 5IT2H 3GKWH 4QTIL 5HGDA 2HKFH 1G9EA 3RNQB 1AI1L 5HGBA 1TZHA 3CLEL 3O11B 2WUCL 4Y16C 5CD3B 1CGSL 2XTJD 2VDOH 3OB0K 2CKBL 2A6KB 4N1EA 1S7UA 2UZYB 3JWDC 4LKCB 2DICA 3S6CA 4FQLH 4OI7A 1IZJA 1A0QH 1U8PB 2E27H 4ZOEA 3VFNB 1NCAH 2C1PA 2FZ3A 4HJ0D 2CH8A 2E9IA 2EXWD 3MA7B 3FQTB 3VI4F 3K4DA 3MACL 5E2VL 1A9BA 2VMFA 3QJHB 3VWKC 5FOBA 1GGCH 3KXFB 3HNSH 1IEBB 3RUGE 3KYOA 3MNVB 1YEIH 5TQ2H 3H7BA 1TITA 3VXOB 2IH1B 4OD1L 5I1HH 3MV7E 1ACZA 4OFYA 4YZFF 4LHUB 5JPMA 1U8LA 3CSGA 4MA1B 5DS8A 2JE8A 3UYPA 4X4XA 3S36L 4ZFGH 2AJSL 4QGTA 3QI9B 2NY3D 2DM3A 4X7CC 1ZT4B 5HVWA 5D7JA 5JDSA 1S9KC 2VXSL 3MO1B 1PYWA 3DXAE 5EUOE 1J1XL 3G6DL 3LQMA 4JPIB 1OGAA 3VXMA 2IGFL 3WO4C 2I25N 1VGKB 1E4XL 4BFBD 1AKJB 1A7QH 3HMWL 4OM1L 1YMHB 4U1HA 5J3HC 1C12B 5E08L 1MFCL 5C2UB 4YDJB 1JF6A 1OTTD 2XTJB 3K0WA 3UO1H 4X8JB 3DVFA 3MRGB 1M7DB 1FFPB 5T3XD 4G9FB 5HYJA 4V2BA 1QYGL 4O02H 1TIUA 2OI9B 4NP4H 4XNYL 2NX5D 3FN0L 4QXUL 1SJVA 4HPYH 1J88A 4OLEA 4OUUA 4LDEB 1NEZG 2IFFL 2XZQH 1FZJB 2IANB 4M02A 1CXKA 4Z7WF 4QHUA 2LV4A 3L7FB 3VMOA 4UU9A 5C92A 1Q72H 4ODXA 5I15L 4E5XB 1RFDH 1I8MA 4H20H 5H94B 4MSWB 1H8OA 5JW5A 4WW2B 1FZKB 1IGTB 3T2PA 2Y36L 4DEPC 1F4XH 1QFHA 4G5ZH 4P2OC 3QUZC 4U7MA 4LU5L 2Z0BA 4OZHE 4GQ9H 3BQUD 4Y4KA 3EYSL 4WIQA 2DL2A 1T89C 4RFOL 4NZRL 1MHEA 3QWQB 1NDGA 3RI5F 3IDJA 4JFHE 4F8QA 1ZOXA 5DEGB 4KJYB 2QQLH 3T0ED 3GSQB 2WSKA 3PHSA 5IW1B 5E6IC 1KBGL 1NGPL 4HG4K 1GGBH 3E2HB 4QHNA 3VGAB 4HJ0C 3VXRE 3PL6D 2VITA 3FZUC 1FGVH 4PJXB 1H9VA 4YDKH 2GHWB 2X4QA 3OJ2C 3TPUB 4NQXB 2R2EA 5C0BA 3RWJA 4CKVX 4PD4J 1RSFA 4IIQA 4ZUSB 2CKBH 5EZLA 2AK1H 5FA4A 2YKLL 1W8NA 2P5EE 5TPWH 4CW1A 5F8QC 5ID0A 3ISWA 3W39A 4K2UL 3CFDB 4GMSH 2R2BA 4ODUA 4EI5A 4NM4L 2FIKB 5DVMA 4LQ1A 5F1IB 5CEXB 3DV6A 5MENE 1DBBH 4ZFFB 1DN0B 3WNLA 2DKMA 5T33L 2DLFL 2A73B 4OCSL 1G9NL 1GZQB 1IGJB 3RWGA 1H3PL 4ONGH 1P2CB 3FHQA 4XX1G 4Y4HA 1FV1A 4FQIH 4NC0B 3WS3A 5I6XB 2BOBB 5I1HL 5A16B 5DK2A 3MRDB 4G8GE 1GL4B 2YD5A 2Z8VC 1YC7A 5IW3A 3WNMA 5CSBA 5DJ0B 1P7QA 1TLKA 4KRPC 4Y16B 5HD8D 4QXGL 3CFDA 3CVHH 5JO5A 3AM8A 3IDMB 4LF3A 4NQUA 3RUGF 2HG5A 4HKBB 4XH2B 2CSPA 2VXQH 4H8WH 5HJ3B 1J1XH 3G6DH 3JWNC 3EDJA 4XCCL 1JHTA 3QPQC 3UTQB 1T6VN 3WCYA 5JHDD 3KPRB 3LSOB 5D93B 1E4XH 4P2RE 4XNMA 1OP3K 4HUNB 3QDGA 2C3GA 4H88H 5E2TL 1MQKL 4OF0A 4MAYA 5A43C 4X5XB 5J3HD 3SPVB 5E6YA 5E08H 5DURB 2HRLA 4GAJL 1FZMB 1T5XA 4U1SB 3EW3B 5A2KH 4O51B 4DGYH 2XQBL 1OTUD 2P46B 5I1GL 3CPLA 4LCIL 1FL5B 1GAFH 5I30L 1PVHA 1VDGA 4FTVD 5D1XB 4FTVB 5I9QB 3RBGA 3W0WB 3W0WD 1AIFA 1GGYA 5I1KL 2Q6WB 3QFDB 2HT2D 5E8NA 3EIFA 1KB9J 5HVHB 1AO7D 2ZKHH 2DYPB 4PY8I 5JPNA 2OS7A 1Q72L 4ONOA 3MV8D 2OJZH 2F53B 2VC2L 3B2VL 3KJ4B 1MVUB 2BNUB 1YN7B 5DHYB 4PUBL 2J3SA 2UWEB 4J3XA 2X4NB 4RQQB 5GGSB 4WO4D 2AJXH 4U1IB 3S34H 1XIWC 5IBTH 1TQBC 2EDYA 2W38A 1IM3B 2AJYL 4PJ9C 4DOHE 3SE3A 1DUZB 4XPTL 1U8QB 1MVFA 1WITA 4OZFH 3S7GA 5KSVB 3KPSD 5L2KB 3LD8B 3MFGB 4QHLB 3OPZH 2NY5L 5J06A 1XCQB 3W82A 1OSZB 2BVPB 4CMHC 3LKOB 5E7BA 3NCYP 3WFHA 4QRTA 4XNXL 1XH3A 2AK4E 4LOUD 4HZLA 1BVKA 5HTSA 1I9IL 2ZUQB 5ACMA 4LCWB 3KPQA 4U2ZA 5SWZD 4EXKA 3VXMB 4MCYB 4YDKL 3GMOB 3F5WB 4Y4FC 2D03H 5DHVA 1PW3A 3RVXC 1RIVL 4MJ2A 2Z8WC 3SDXB 4GUPA 3ZMRA 4H25B 4X7SL 2EDRA 3I75A 5JHLH 1JVKA 3ZLQC 1HI6B 4G9FE 4K8RH 4R7NB 4GG6A 3VE0B 1WTGT 3VFWA 3HE7B 1ROWA 3U36A 4G9FA 1QUNA 2X9XA 4OJFL 4CVXB 5IGXH 4APQC 5CSGA 1YEDB 4WU7B 4XCNB 5CEZE 4OFKA 2EIZB 4Z76A 3SBWC 3ROLA 3WE6A 3VA2C 4GRLB 4F7EA 4HUXA 1A0QL 2E8ZA 3DX7B 3IETA 3IDIA 1XGQA 3PXJA 1F42A 4LSVL 2OCFD 4OIBA 1K3IA 4OZHF 3EO0A 3LQZB 4E5XA 1CD9B 1AC6A 1JGUL 1QSEE 2D0HA 2VDRH 4F2MA 3CDYA 3VD9A 1F6FB 1R5WB 3CFKA 5I76B 3TVMC 1I1FA 4LPVA 5CJBA 1WCBB 2X4PA 3ARFB 1YJDC 1A6ZA 3T4AA 3MV9E 3UP1A 2CUHA 1ZA3B 1LP9B 2YWYA 2XWJA 4LPTA 4IDJH 1DVFC 3FRUB 1I3GH 3ZKMD 1NLBL 2H6PB 2DIBA 4ZTOH 3ETBF 4PRPB 4YPGB 4XC3H 1ZHKA 3RL2B 1X3DA 5EOTB 3SDDB 2R2EB 1O5DT 5C0BB 2HT4C 3RWJB 3ARUA 3AS0A 4GAJH 5KSBE 3L5XL 5F7MC 3TN0B 4P5TA 1L4IA 5K9QG 2QBWA 4PJIE 5C70A 3W5NA 2V17H 1URLA 3LV3A 4QHKJ 3AREB 2V5RA 2D9QB 4X7TA 1VSCA 4XAWL 3LQAL 3RIAK 3TIEA 1G7MA 1MFCH 3IB4A 4QRQA 4F9LC 3Q6GH 3VWJB 1D5IL 3ZHLA 1T1WB 3ARGA 2EICA 4JO3L 4WI5A 2O5ZH 2ZOKA 4JN1H 5ACZA 1IJ9A 3MJ7B 3QT2A 1DN0A 4UIKL 4XMPL 5GGRY 2ZKHL 2B0SH 5SWQA 4JQXC 5D5ME 2XYCA 2ZG2A 5C09E 5J4MA 1HINH 3OAUL 2VXTL 4DJMA 2BVQA 4WWKA 2XZQL 3LOWA 4O9HL 3KS0H 3MNWA 4BFGA 3QDMA 3LKPA 4U1MA 2AI0L 3ILQD 1ZS8A 1GC1C 2F5AL 3O3EA 3V4UH 1HQ4A 4LU5H 2DQTH 1JHKH 4Q9QL 1R3IH 3QFJB 1QBML 5IVXB 4OQTH 4U6VH 1NL0H 3CMGA 1OOAA 3DYMA 3DGGB 4NZDA 5EOCL 4LDLB 1A6WH 2FSEA 2XRAL 2FJGB 1GRWA 1XT5A 3TNNA 3GJFH 1OAKL 1ORSA 1JMZA 1R3KA 3TBVB 1CDGA 5JW4M 3FFDA 1A02N 5DS8B 4C54A 4WI4A 2XA3A 4UQ3A 5T5FH 2AV7A 1PY9A 2G5BB 1ADQA 3EBAA 4NZUH 5B8CC 1FGVL 2NYYC 3QIBA 5ADOH 5D2LE 3QNYB 1R0AH 3DHJA 4K8RL 1HSAA 4TSAH 1R5VB 4FQLL 2MPAL 4GBXB 1AJ7L 1FJ1A 3HS0A 3DSFL 1EO7A 3A6BL 1AKJA 1QKZL 1YMMB 5D2NC 3GSNB 4L4VD 4Z7QF 2A9MH 3VRLF 1A3QA 2ADIA 3RWIB 3T0EA 1MFAH 3D5OF 5BXFB 4TYUA 3QXTA 1UB5A 3IRZA 4YJZL 1YPZF 3VDAA 3GMRA 1FSKC 4YC2B 5ADPH 1U8NB 5T33H 5JO5B 3RGVB 1W0VA 3MBEC 4PY8J 1HHIB 4OD1H 3V7AE 1C08A 1H0DB 5T1MA 1QNZL 2VZOA 3IAPA 1U58A 5C0GA 2VLME 4PGDA 4U3XA 3M45A 3KPOB 3B9KD 1AKJD 2WK2A 3PQYE 3LKQA 2CKBA 4OLXH 1CG9A 1NLBH 1S5HB 2E5EA 1A6TA 3FAWA 5J11B 2GJ6B 2NY0B 4ZOAA 2P48B 4L3ED 43C9B 3ZE0E 3RGHA 4YXHL 2YPKA 1A7QL 5KSBA 3STBA 1KACB 2Q8BL 5CINL 3UXFA 2XTJC 4PJIF 3U7WL 1GOGA 1FO0A 4H88L 4K3EL 4L8BB 5I8OL 4AZ8A 5IB4A 3MV11 1Q1JL 1JI1A 4AG4L 2C4XA 4LLMB 2DJ4A 4UQ2A 3C87A 3C9NB 3N1GC 2DLTA 4RZCB 4XAKE 5BVJA 1UXWA 1OAXL 4HPYL 1M7DA 1UENA 1D5BA 2VH5H 3HZVA 1Y18B 4PREA 1I9JL 4YFLI 4MXQC 4N8CH 5HYSA 5IBLD 3ZYOA 1HINL 4I8DA 5KSVA 3SGKA 1JNNH 3QH3B 3H3PL 3RWCA 5ITFA 3K8KA 4MNQD 5D96C 1HK6A 3T2OA 4BZ1L 3MLPA 4ZDHA 3A6CH 5C0EA 4MWFA 5C8JB 4RRPG 3BDBA 2Q76B 2EC9U 1N59A 4KQ3L 4Z5RA 3K81A 2AJYH 2YZ1A 3QXDA 2J88L 1Z5LA 2CLZA 4GRWF 1B0RB 1MUJB 1E4KC 3TJHD 1T3FA 4IOFD 3HZVB 3MLUH 4JHWL 2P44B 3W0WA 1Q9OA 1RZJL 3MV01 3FRUA 1MJ8L 4X4MA 1KPVB 4NGHH 3O6KL 3GO1L 4ZS6D 5D2NE 3BPLB 4K9EH 4M03A 2YS4A 4U0QB 2EIZA 1BOGA 2F53A 4R96A 5IK3B 3QCTH 4ZS7H 2AK1L 2X4UB 3HFMH 5EBWB 4DGIL 4PRHE 3MOQA 4OLZL 2MPAH 4L3CB 2Q76A 2VAJA 5C08D 2JJTC 3MRNB 5I16A 2NXYD 3DVIA 4F7PB 3EYUH 3SDXE 2PYFB 3TC9A 3MUY1 4HT1L 1OB1A 4Y4FB 4Z7NE 5CCKH 4JE4B 3DOSA 4Z6AT 5IIEA 5DD5H 4FQCL 4U1SA 1RZ7L 1RHHA 5DQJA 4Y1AE 5CUSL 1TZGH 4D0DB 1UZ6E 4KVCL 4G7VH 3RPIB 1SM3L 2DQGL 2R4SH 1T0NA 1BZQK 4NCDA 3QCUL 3O4OC 3P4OB 1XR9B 3MV7A 4DOHB 5HHNA 1EXUA 2X4TA 1IGJA 3RWGB 1I8IB 1TZIB 3HB3D 1DANT 2BCKB 4YEEA 2C4FU 1EHNA 5DZOA 2R56H 4PJ7A 3TA3C 3VFWB 3RHWF 1U9KA 1S78D 5TQ0L 2HYMA 5L7XL 5DA4A 4PGJA 3OKLA 5IQ9B 2AEPH 4PJAB 1EHLL 4LQFH 1K8IA 2V9RA 4AEHH 2P24B 1IM3A 4K71B 4CVZA 2WBWB 1I3GL 3VFTA 2Z8SA 5ANME 1MY7A 1NGXB 1AP2A 5TF1L 3IS0X 1TJGL 2WIMA 2KBGA 2ZSVB 4WTZG 4ELMB 3MV7D 1WGOA 4NQEE 1DL7H 2Y07L 5DEZA 2IPKB 1FZMA 3T09A 1JPGB 3FO2B 1GXEA 7FABL 4L29A 1U8IA 2QSTA 3HG1A 1AGCB 3DNKA 1DEEB 3DBXB 4WDIB 1I9JH 5IR1A 5JIPA 3O3AA 4ZNCD 4G42B 4X98B 5E2WH 3O3DA 2WBKA 3C09B 3VFMB 1K4CB 4KAQH 5M95B 2ICES 4EXPX 3IAQA 6CGTA 4Z8FL 1UEYA 1EFQA 2DB8A 1R3JA 3BOVA 1ZGLB 1LDPL 1G7JA 4ODTL 1FNSH 4X7DC 5FA3A 1HIMH 1AP2B 2EIDA 3H9SD 4PYGA 5DTFB 1WIUA 4KK6D 1XIWD 2P7TA 3TGXA 5L8LB 5BS0D 3VWKD 2H2PC 2JB6B 3SKOB 4I3SL 1CT8A 2OQJA 3FB8B 3W0WE 5JW4Q 4HS8H 1YN7A 5DHYA 1UA6H 3B3IB 1I9IH 1ZT1B 3P4NA 1RZJH 2AK4A 2R0WH 5IWLC 1KIQB 5KS9F 2AGJH 5CBEA 1FYHB 3EYFB 4FZEH 4EUPB 4R7DA 3TYFA 3ELAT 2OZ4A 5K9QI 4M8QA 3VXRA 4NGHL 4DVRH 2HJKA 5IMMA 1O7VA 3HR5B 3RY5A 4DZ8A 2PYEE 2P45B 4A2MA 2FNBA 2XFXA 2PXYB 2IBZX 2VUOA 4U05A 3HZMA 4KFZC 2DYPD 2DKUA 4X7SH 1MI5E 4EOWH 4PRHA 3SE3C 3LZFL 4ZUTA 4KKLC 5F7DB 5L9DH 3NPSC 1S9VA 3FQRA 2IC2A 4NDMA 3TO4C 4PJ8A 1E6OL 3N1QC 4ZO9A 5GRZA 2BY3A 4YPGA 1OGAB 5J1TC 2DWDA 1I7UB 5INDA 2V5MA 3VFRA 5C07A 5GSVA 4EN3B 2COQA 3CFJA 3ZHKA 4LLDB 5KW9L 3BDYL 4EI6A 1XR8B 2J8HA 5TFSL 1MFEL 2A0LC 3VFOA 1HYRC 2EO9A 5GIRB 1XGQB 4KGJA 4PRHD 3ARGC 3FQNA 1T21B 4F9PA 3KYAA 3BEVA 4MXWL 2VL5B 3TBWA 5T3XH 3GHEH 2CPCA 1ED3A 3RVTC 1KULA 4P5TC 1U92B 5LVEA 3IDGA 1I1FB 3WXVL 4HPOH 1BBDL 5L7XH 4XT1C 3OGOE 1LO0L 3HPJA 3MODL 4ODXB 1MUJA 4LQFL 3U9PL 2XZZA 5I71B 4XTRC 3D87B 3TCXA 1F6LL 4M7JL 4LLDA 1Z3GL 4AEIH 3QUXA 2AABH 5FKPB 2F19H 5ANMA 2DOCA 3QO0B 4EEEA 1JGEA 2X89D 3OKOB 1I9RH 4RZCA 3WUWG 3O11A 3L5XH 4GKOA 1A1MB 4AIXA 5CJQL 4OCWL 5HYSB 4PJFB 3LQAH 5T1LB 5I18H 3GSQA 2BZDA 3OB0H 3S35H 1TENA 4F7TA 1J1OH 4R2GB 1XCTA 3BAEH 1ONQB 2GUOB 3PGCB 3FO1B 3K8LA 2Q20A 1Q8MA 1AGBA 3ZTJG 4I0CC 3T8XB 1Y6MR 1ZLVK 3MJ6A 3L5JA 2ZOKB 5SWSA 3NN8A 1U91B 4ODTH 1FNSL 1T1WA 3ARGB 2MCPL 4YH6A 4HJJH 5DJCA 1DFBH 5EZOL 3T4YB 4PTUA 4NUJA 4IIQC 4I3GA 2BRRL 5CEXA 2X7LA 1U2CA 2CRIA 1LEIA 5DZLA 2BVQB 5E4EC 1G7LA 3D3VE 3KLAA 1P4BH 4NO2A 4BUHA 4U7SA 1FH5L 4RAUB 2V2TA 4YHZL 3ECBA 5ALBL 4I3RL 1RVFH 3KPOA 4O58H 1CLYL 2PYFA 5E8DH 4PGEB 4ODBD 3HCVA 2YC1B 5D2LA 2HKFL 5D7KE 4B7IA 1BZ7A 1CLZH 5FYJE 5D5MB 4HIIA 1ZTXH 2GJZB 3CLEH 4JDVA 4JZJA 2NZ9D 2R9HC 2HVJB 1TQBB 3GJFB 3QNYA 3SGEH 4LBEA 3HFML 4UT7L 1HSAB 5E5MB 5EO1B 1M7XA 4UQ3B 1OWRM 5F6HJ 5ENWB 4UIMA 1T0NB 5DC9B 1MFAL 1BQSA 1F2QA 4FXKB 5EFIA 3HE6B 4FZ8H 4WNQB 4Y2DB 1K4CA 2DRUA 5IVOA 1MFEH 4GBXA 1FZKA 1IGTA 1UH4A 5BV7H 4KDTA 2FO1A 3ZZ1A 1ZHLB 2NXZC 3FQUB 5IEKA 4YDIH 4NM8H 2J8UF 5GJSH 1RZKC 4P3CH 3U4EB 2XN9E 1TZGL 3CZFB 4R8WL 4G7VL 3SJVA 4HIIB 1CFQB 3UAJC 4KC3B 4E41A 4HGMA 2W9DL 3RVTD 4Z77B 1MPAL 3DJ9A 3VDBA 5FO9B 1VKXB 4FABL 5E8EB 4AT6A 4PJCF 1OW0A 3UMTA 2SEBA 4GAGL 3QDGE 5T1MB 1NGZA 5GGTA 1BX2A 1P53A 1XFPA 2FYYA 4DZ8B 4LEXL 1CQYA 4JFOB 4MA8L 2Q86B 5EBLB 3TJEH 1ZHLA 4BQCA 2NQCA 3VXNB 4OGYH 3JVGC 5EZLB 5FA4B 3VWJA 3MRIB 3KAAA 4QHLA 3HMWH 3WIHA 3TF7C 4QOKD 3PGFL 3CXHJ 5I18L 4XXCA 4KV5E 4E41D 4JG1H 1K9TA 1U93B 5F7DA 3NBNA 4YGVB 2YD9A 2Y7QA 4L9DA 4IOSD 3VFPA 1HN1A 3NPZB 4LLVB 5HI5D 5KSBB 1EXUB 1VACB 3MGOA 1DL7L 1ZVSA 2FX9L 4C4KT 4TQEH 3ULVH 5JXEA 4JY5L 4MHHG 1F4WH 2IQAB 2P42B 3FN0H 4UOW0 5BVJB 3C6LD 1BX2B 1S5IL 1J7VR 3E0GA 1LK3L 4M5ZL 2X6MA 1HI6A 1U8HA 4LLMA 5DD3L 5F6IB 2DQUH 1SEBA 1CT8B 3FHAA 4PJHA 4QF1B 4YXKL 5A2IH 5JW3H 5ICYA 3WFBH 2ZP0T 3TA3D 5J89A 5FCSH 3RNKA 3MQIA 3IJHB 5IF0B 3WIFB 3VFPB 2V5YA 3QHFL 3OAYK 1HYSC 4W70A 2NX5A 3STLB 4OLYH 4JPWH 1KJVB 3DX6B 2IPUG 4WUUE 5E9DD 1M7IA 3RGVD 4U0RC 3L3KA 5DVNA 3AMLA 3GBLA 1RVFL 3FTGB 3IGAA 4FXLA 1UA6L 4P2YA 4W4OA 1FJ1B 1MJJB 2XKNB 4PJEE 2CRYA 4M8VA 3WN5C 4PRNA 5MEPA 3CFJB 2J4WL 3HE7C 2OTWB 2AQ3A 3BQUA 4B41A 4PJGA 1KIRB 5F70A 2E27L 4YGAB 5BZWB 3LEVH 3IRPX 3LZFH 1QD0A 4XXCC 4PJGE 2G75A 5IQ7H 5DMYA 4L9LB 4OCYL 5E5UB 3G6JB 4OCLC 2NZ9C 3RGVA 1RUAL 1B0GA 1D6EB 1BEYL 3IVKA 4LCWE 2GSGA 4FZ8L 3ULUF 1JRHL 3MV8E 3TFKC 25C8H 2ID5A 2ZUQC 4XXDB 1KSRA 2NW3B 1RHFA 3FOMB 4ONGL 1N0XL 2FBJL 1MHHB 5FYJD 4GW4A 5KW9H 1WZ1L 5AZEH 1KUMA 4NN5B 1UZ8B 4FQIL 3BDXA 5INCA 3R06A 3S37X 1RJZB 4LAJH 4TTDC 1WZKA 4NOFA 3KPRE 1XGUB 4Z95H 2G9HB 3M8OH 4MXVF 4FABH 4U31A 2PW1B 4X9IA 3BP7B 4H0HB 1EHLH 5E94B 5ESAA 3UTOA 4DN4L 5KS9A 4TVPD 1JWMB 4OIIL 3HNTH 3PDDA 3HI1A 4OM1H 1GZPA 3G9AB 5HVHC 4WHDA 4NFBA 3ALXA 1I8IA 2BVUA 2D9CA 4GUPB 4Y4HD 2CIKA 3I6GB 3TJEL 5L2JA 4PR5B 2CLRB 4M7JH 2EDFA 3MRBA 4AEIL 4EQ3A 2FBOJ 4X4YA 3FO1A 1F3JB 3WFDH 3JTSB 2R0ZL 2VZTA 4JG1L 4NP4L 3FB6A 1IC7H 5FYLL 4E42A 5GS3A 5KANG 2AJZB 4DGYL 5EZJB 2HVJA 1WQVT 5IVZA 2HJKB 3BO8B 1Q9KA 4P99A 5JLZA 4R2GD 3S35L 5C09A 4QHMB 4M5YH 1J1OL 3L95A 5T3ZL 3L3IB 5JHDA 3MMEA 5T1LD 3Q3GB 3UBXI 2ZSVA 3TNMB 1JF1A 1U2HA 1UM6L 3PNWB 1R3LA 2D7TH 4ZO7A 4M5ZH 5DD3H 3MYZA 5D1ZD 5T3ZE 5E7FA 4NNYA 1CDBA 4MAYD 4GQ9L 1A7NH 3NH7H 4PJXE 4BYHA 2IG2L 2IH3B 3VXQA 5I75B 3RY4A 1BIIA 3FQWB 5BMFH 3L6FA 4IRJC 1M6OB 5GZND 4BQ6A 4MNQB 4HHAB 5DI8A 3BPOC 4ENED 3RTQB 1SMAA 5EOCJ 2AJ3A 2RFXB 5IB1A 5I6XC 2R0WL 1EO8H 1QZ1A 5J57B 3CCHB 3OAYH 3QCVH 5F72S 3FQXB 4Z7UB 4P2CG 2FCBA 1B4RA 2N7BA 1ZLUH 3K1KC 2Q87A 1DEDA 5D1ZA 2FX7H 3T8XA 4WCYH 3P4MA 2BVTA 3V95A 5ALBH 1FDLL 2F54B 4JHAH 4QCIB 4XPFH 4HWUA 4MQXD 1RUQH 1NCWH 3MRQA 4NQDE 5L0QB 4F58L 5DVOA 1IQWH 2I60H 3BE1H 3QAZC 4KY1L 2BDNL 4D0DA 3VWKB 2HKHL 4HAFA 5GZOC 1JNHA 3V2AR 2YPKB 4PRHB 5D70H 4YO0B 5J0BA 3BDYH 1JRHH 3BKYL 4H26A 3VXUD 3D39E 4DQOL 1EBPA 2IQAA 2F53D 2FWOA 4IEFB 2O93L 4M43H 4UT6L 4IRZL 4NRZA 5DJZB 4XBEL 5I1JH 4LSVH 2EDHA 2FEEI 1CDHA 4PJBF 3BKML 3AMKA 2K1MA 5A1AA 4OKVA 5FXCH 3PQYA 1J9CT 4AQ1B 1MIEL 1X5KA 2W9LA 2R0LL 4QNPF 1S7RA 1V7ML 4Q74A 4D0BB 2VL5A 5TE6L 5JORA 1ND0B 2HN7A 3TYGH 4ELKA 1EX0A 1IEAA 4JRYA 1E4WH 1KELH 3NAAL 5I1EL 1KJVA 3DX6A 2BSED 2P8PA 4MJIE 1CE1H 4KQ4H 2R0KL 4TRPL 3RL1B 4LKXA 3LRGA 1TCRA 2EZ0D 1OVZA 2IAMB 1Q0XL 2EC8A 3UPRA 2X5PA 5DJ6A 5E2JA 3VFSA 2P8LA 4GBXD 4OFPA 3AROA 3NIDE 5IHZA 1D6VL 3T1WA 5L6YH 4LCIH 3JV0A 4R4BB 1MAMH 1P4LB 4YHPA 5F8RC 4X6BA 1K6QH 2YUZA 4PRBB 2CGRH 2FO4B 1D7FA 5CLWA 3IXAB 5CMAA 4JO3H 2JK5A 1QVOB 5CGTA 2A0LD 1S7VA 1NC4A 4UIKH 1GPOL 4WJ5A 2B0SL 4PYHA 4JY5H 1G9MH 4RMWA 1VERA 4EUPG 3ESUF 2XN9D 3ZE1F 1LILA 4HJJL 1FO0L 4X9GA 2YUWA 3QEGH 3WUZA 2YZ8A 4P59L 3V7AG 5MP6L 5EBLA 4UIMB 4NJAL 4S0TD 1FNFA 1JWUA 4Q9CA 1BHGA 4G80B 2H9GA 3D6GA 4OFDA 5HYQB 4KRPD 2EH8L 5JW3L 2CKBB 1KTDB 1OAZL 1GSMA 1V8HA 1KJ2A 5HHXL 2APBA 1YEFH 4OQTL 1UVQB 4U6VL 5ETUB 1CLYH 5E8DL 3B6SB 4RAUA 1II4E 2R23A 1MHCA 4KI5C 4KJQD 4HWBL 5FGRA 2H2SC 3BN9C 4GQPH 2JCCE 4GO6B 4NUGH 2I9TB 1LE9B 3C8KB 5ADOL 3QSKB 3PWPA 4PJCE 2E6JA 1CE6A 1YDPA 4KV5F 4DFHA 2J4WH 1T7WA 2RQ8A 1KENL 5EC1B 3OKYA 5J13C 2BVYA 4PJ9A 4LKCA 2VQUA 5EUOF 3PHQB 2BHUA 1SYSA 2EKJA 4RA3A 5DC0A 3WV0A 5TDNA 1JV5A 3QEHB 1G7IA 3QHTC 2V7HA 4NM8L 4J4PD 1HH6A 7CGTA 1ED3B 1P1ZA 4BH8B 1MAKA 4J4PC 4NRYB 2XZCL 2W9EL 2FBJH 4NKIL 3PWPB 1PFCA 4L29B 1MIEH 1WBYA 3H6JA 3QXDB 3CMOH 3LDBC 4Y88A 4A6YL 2A77L 3SE4A 4JJHA 4KHTH 5HYSG 1DEEA 3DBXA 2F58L 5IR1B 3P9WB 3RDTD 5EU5B 4EIZC 1RUKH 4PJ9D 1HHKA 1ZA6B 1L7IL 2PTUA 3QO0A 2OM5A 5BW7C 1E4WL 1EEUA 5F9WB 2YD6A 1G1CA 1IGCL 1YPZE 4WI6A 1P9MA 4LSUH 2IBGA 1ORQA 4HIHB 4WI9A 1IE5A 1N0LA 1TMCB 2GT9B 3CX5J 4OZGA 2ESVB 1GH7A 4YK4C 2NNAB 5C09B 4P3DA 5GGVH 2MWCA 1EERB 1VB9A 3EJYD 1PX3A 3ARDC 1FN4B 2B1HH 2FJFB 5I2IB 1MCRA 2BOCB 1S7SB 5H2BB 1I1RA 1EAJA 5DFVC 5ELIA 3C6LB 3MRDA 5HHME 4I77H 3GIZH 3SDYL 1JP5A 4X80L 5KOMC 3MPCA 2UUDK 1FVEB 4P2QE 5E6IB 2ILLA 1SEQL 3SDAC 3MRJA 4L5FL 2DAVA 2NY6B 4R4FH 5D7IA 3TZVD 2Q8AH 1M05B 1IFHL 4P59H 4RGMC 1X6LA 4P3DB 1BQLL 3RZCD 5HHMD 2ZOLB 5IM7B 1RMFH 3NACL 4JFFA 2APXA 2DQTL 4KHXL 5B22A 1TQCC 2JJSC 2V5TA 2Y06H 3CU1A 3PJSA 2GSIB 2M1KA 4LHQB 4YQXL 4LPUA 5EOQH 5FV2A 3MNZA 3ARBC 4MJIB 5ESQB 5C0BE 4LVEA 1YA5A 4OGZA 3O0RL 4BSWA 3MRKA 5HI4C 2P5WE 1DBMH 4JPKH 1OL0A 1ZAGA 4JHWH 4M1GH 3Q3GA 1DJSA 1RZFL 5F7UA 1U8JA 3OJMB 2GAZA 2KL6A 1L9MA 4Q9RL 5C9JA 4TSAL 3GM0A 2H8PA 4RFNB 4Y5VB 1XGPA 3FL7A 3HLAA 2WUCH 1VA9A 3QIUB 4LLWB 4AENA 1VADB 2BSSB 2X09A 1QKZH 4U1IA 3BH8A 3O4OB 2HT4D 4P4RA 5T1KD 4D3CH 2UY7A 3BJLA 5CHNA 3U83A 3VD5A 1OTUC 1RUQL 4BJLA 1IL1B 3EYUL 3QUXB 5FKPA 3OKMB 5DR5L 3DMMA 3QUMH 4UNVA 2I60L 3IXAA 2DI8A 2ZWLT 1KIPA 2NYYD 2HKHH 3VWJC 2LAGB 4K7FB 1D5XA 5EO0A 5HJ3A 4DQOH 1X4ZA 3CH1B 5FGCE 1YEIL 1SM3H 1U95A 5KAQF 3HE6D 1RUPH 4LCYA 4G9DB 3L95B 4H25A 4WO4C 1T0MA 4J6RH 3BFOA 4LSQH 4D9QD 1G7PB 1NCNA 5DJ8A 5CS7A 1KXVC 3BQUC 1WFTA 4OGAC 2OTUB 4GW4B 1K3ZA 4EUPA 4GKNB 3MV9B 1V7MH 4HUMB 3WN5A 1T2JA 4Y89A 1DDHB 5BQ7B 4BQBA 4ZAKB 2HLAA 4JFED 4XI5C 2R23B 1CE1L 3SJVD 4PJBA 2Y7QB 4GBXC 2GIYA 5DUML 1L0YA 1VACA 2B1HL 1J0IA 4NQCB 1EEYB 1I3UA 1YN6A 3TO2B 2E6QA 2OK0H 2QSQA 1YQ2A 1G6RB 5EBMB 1UWXH 2EKSA 3QUYD 3ZT6A 4PLKC 1D6VH 3SDYH 3QEUA 3HMXA 4KJPD 3CX2A 4N8CL 4NNXA 3VXSA 1B88A 1NFIB 4M5YL 3TIDB 1T4KB 4NQEB 3QIBC 7FABH 2Y5TB 4LLQA 2IFFH 1FL5A 3CDCA 3Q5OA 4PJHB 4WW2A 3DUUB 1LP9A 2BNRE 5KSAB 4L4TB 5FB8A 4KAQL 2Q8AL 5ICXA 5DQ9B 1P9MC 3QNXA 4JPVH 2AW2A 3E8UH 4YHMH 2IG2H 4PRIE 3RWEB 4P2RB 4J2XA 3G5XA 3QDHA 5BMFL 3WJJC 4S1SH 3HB3C 2Z4QA 3VG0H 2J88H 3I3BA 3C5ZC 3IDGB 1FYTE 2BJMH 9CGTA 1K85A 1WBYB 4CADB 2VDNH 4YHKH 3GSRA 4LVNB 4FXKA 5DJYB 1P4LA 5KOVC 2EH8H 1MLBA 5L2KA 2XKNA 4HS8L 3LKSB 4GKZB 4OFIA 5CILH 3GNMH 3S96A 3L6FB 2EE2A 3H42H 4H1LB 1HNFA 4AH2B 2YD7A 5ISZA 3OR6B 4DVRL 3IS1X 3IU3B 2ITCA 2CRMA 2RFXA 5HI4D 4JHZA 3MRHA 4JAMB 2CXKA 3N1MC 4HWZA 2D7PA 1NCWL 3H9SA 1N26A 2NXYC 5KSAD 1VKXA 5F9OL 1IQWL 3FCTA 4HC1A 5H35A 4QRSB 4D0CA 4EQ2A 5D72L 2YD4A 4CADA 2P47B 4U1GC 3VFGL 1A7PL 3KVQA 4BFIB 3RQ3A 5K59E 5L2KD 4JO4L 4P9HC 2I07B 1DZBA 1B3JA 1CGWA 5TQ2L 1DVFB 2DLFH 3NPSB 4NO5A 1TJIL 2C7UA 4LEOA 2OI9C 4NKDA 5KG9B 1MWAA 2W65A 1ZEAL 3GGWA 3NFNB 3T0EC 4OZIB 4XBEH 5I1JL 5CAYB 2QQQA 2VLRB 5HDQL 2VLJA 1DQQB 1X5LA 4E41E 2GTZA 3SDCA 4DN3H 4L4TE 4IJ3C 5DC4B 2PXYC 2HFTA 3QDJD 2JCCF 1IM9D 3N85L 1MH5A 2WIIA 1UKTA 2PNDA 5EBGA 1HDMA 4MXWH 1OPGH 1ORQB 4WTWA 1JRHI 5T3XL 5TE6H 2W9EH 1E27B 4R97C 1K8DA 3G5ZA 4PJGF 2Y1VA 3QUKB 3TVMA 2M2DA 1NCTA 4A6YH 1Z5LB 2A77H 2CIKB 3L1OL 3ZDZE 4KQ4L 2EE9A 4LASL 1IZKA 1AY1H 4XHQA 2O61A 5E1AB 2V6HA 2GQHA 2D0FA 5DJXA 1N6VA 3PV6A 1Q0XH 3AAZA 4HDIB 4LLUA 3SQOL 2XG4A 2BFVL 3Q1SL 2QHLA 3GB7A 4KDWA 2AXHA 4JZOA 1BFTA 1G6RH 3MV8B 3QDJA 4XWGL 3DV4A 1P1ZB 1WBXB 2G2RB 2OR8A 1AIFB 1ZHKB 1UVQA 5ETUA 3V0VB 5JHDB 1S7XA 2IALB 3RA7H 5TGBA 1JF1B 4X83A 1S7WA 1XF2A 3MLTA 1NANH 4Y16D 5E4EB 3UJIL 4WO4B 3EOAA 3QPXH 4NQTA 3OKMA 5IHZB 5FYKU 2W0FA 1F4XL 2AEQL 3WD5H 3HRZB 4PV8A 3ZYZA 4PJHE 4LF3B 3FQUA 5IEKB 5DHVH 1HIML 5BCAA 5IHLB 4ZXBC 2YA1A 4OIAA 4W6WB 2EDEA 2I5YH 2WNGA 5EO0B 1A22B 5MP6H 2R1WB 3WIIH 4MXQD 4FXGA 4R4FL 5D1XD 1JZ5A 2H41A 2R9HD 1ES0A 1BOYA 1F45A 4Y8AA 4DKEL 3JV5A 5DRXB 1AHWC 4K94C 4ZSOA 4R97B 2A6IA 1KB5B 5C9JB 1CICC 3C9NA 4LGSB 1XGPB 3C5SB 4GKSB 1P2CA 4ZSOE 3MOBL 5CEYB 2AXGB 4GKNA 3TPKA 3HRZA 4P4KC 2YWZA 1CD1B 5I8EB 4QXWA 5CP3H 3L3HA 4EOWL 2D03L 4UV4L 2XNAA 4OM0L 4LL9A 1DBML 4JPKL 2EYRB 4AEEA 2HFFA 1IC5H 2LU3A 2AV1A 1FQ9C 4FXGB 5C0AD 3I84A 3V4VL 1CFBA 1I1AD 1EVUA 2DQHH 5JQHC 3HR6A 4TULH 4K7FA 2RJMA 3O9WD 1H3PH 1C08B 3O3UN 4KROC 1IKNA 3S3JA 2VDMH 1XF4B 3ARZA 4OUOA 4ZQKB 2XA8H 4J3VA 5IMOA 2OMNA 5GRVL 1IGIH 2CLRA 2V9QA 3O6FC 1ZEAH 4TUJA 5I8EA 3QUML 3LKQB 2B8OT 2E7BA 3P11H 2XTJE 2HT2C 4DN3L 5IFAL 1B6UA 1A6TB 5KJRL 2F9BT 4ZAKC 5LKNA 4MJ4A 3WN5B 1QPXA 1JBJA 3IFOA 4PLNC 3MODH 3U9PH 1TTFA 1RUKL 2Z8RA 4KUCF 1QLRA 3MBED 4X99B 4CMMA 2R1XA 5HGHA 2EXWC 4PLJD 3IFPA 1WISA 2PN5A 1G1YA 4JFYA 5FK9B 3BWAB 3MFFB 1Q38A 1QSFD 2A6DB 2ICCA 4AH2A 1FAIL 4OZGE 3ZHDA 4FHBD 3BIAX 3RHWK 2GSIA 5GGVL 3F7QA 2OTWA 1GAFL 2VZUA 3THML 3MLVH 1KG0B 4QHKI 5CJOL 15C8L 3MZTA 4N0UB 3B9DA 1AC0A 4WFGE 5LXGL 3GIZL 2NTFA 1LO4H 1P7HL 3HAEG 4PJ5B 3KDMB 4NKMA 1PGRB 3LAFA 4G6KH 4NC2B 5C0FA 4PUBH 4DAGH 1OTSC 5DRZB 2MCPH 1U3HC 3SY0A 2AXFA 2VXTH 4XP1H 2Z93A 3T3PE 5M94B 5JOPD 3W9EA 3OL2A 4HX1A 1BVLA 4JFEA 4FQQB 4WHCA 4BZ2L 1BWMA 1RQ5A 2DQUL 3A6OA 4U1KB 1NC2D 1F4HA 2KQNA 3KPSB 3MJ8B 1YEDA 1JFQL 1YEHH 5EOTA 3SDDA 1A9EA 2O5YH 4JKWA 4YQXH 5HYJE 3D18A 3NCJH 1R3IL 4J23A 4LCWD 5DWUH 3VCLB 3O9WB 2BJML 1N5AA 1RZIB 3OKDA 2FWOB 2VDNL 1BJ8A 2DKSA 4NNXB 5DD1H 1OAKH 4GG8A 1KJMA 2VQ1A 3DX9B 4BK4A 1VENA 1XGTA 1H3GA 4U1HB 5I76A 4KKBC 4HDIA 2Q7YB 1B90A 3RGVC 3CSBA 4HUUB 3H42L 5EZIH 2WW8A 3JWDH 2EDLA 5HGAA 4CVUA 3DVGA 4WWKB 4ZMAT 3TA3A 4G7YL 3G5XB 3ZKXB 4EJ1C 3RWIA 1AJ7H 1CXHA 2XWJB 1A6VH 1A14H 2EECA 1U8KA 4YBLB 3CSPA 5A3IC 3MMEB 2VDML 5F9OH 1QTYT 3BYYA 4FQXD 5CP7B 3MCKA 1DLFL 2PO6B 1FNEB 1JGUH 4UNTA 2OJEA 1PEZA 2IADB 1T04A 2BSRB 1UJ3C 3SCMB 1W72B 4B7LA 1FBIL 4M7LT 3FB5A 4POYA 1NCUA 4R8WH 2IH3A 3VXQB 3OKLB 4L4JA 1HXYB 1QSED 5JA8B 3WIHH 1F13A 5JUEL 1M1SA 1QHPA 1WZ1H 2YRZA 2MQ0A 2D3VA 3FN3A 3UTSD 1D5XB 3WDIA 4ETQB 4JKKA 3WEXB 3B4NA 2O61B 3SQBA 3S37H 1J8HD 3ARBA 1H3TA 1AO7A 1MCJA 4XCYB 3UYOD 1HKLL 2PTVA 3I9GL 3AXLA 5D9SB 4FQXA 4IOIB 3CH1A 1TFHA 4NWUL 2OSLA 5CKAA 3INUL 4UUJA 1MRCL 1H15B 5D1ZB 3SGEI 1I3RB 1HHHB 3EDEA 1AQKL 1I7ZA 2C1OA 4JGUA 1B0WA 4Q6IC 5FHAH 4KJQC 4ZUVA 5IW6A 5AZ2H 2UY6A 4JM4H 3E6HA 4MMXC 4G6FB 2VLRA 1S7TA 5F7KC 4S2SB 3CVIL 4WV1B 1F11B 2GI7A 4B5EA 1BIHA 3SQOH 1T89A 5I75C 5F7HA 3HAEH 3Q1SH 4G8GA 3WFDL 1LD9B 1G6RL 4JN1L 3EYVB 5EUOA 1QR1A 4TQEL 2OLDA 1OGAE 4DK3A 3QEQD 5J13B 5JDSB 3WUWA 4TPRL 1WZLA 2ORBL 1S5IH 3O4LD 3I3EA 4UILL 1H8NA 1JL8A 4Y4HB 2AEIT 3HRPA 3ARXA 3T3PF 2HFEB 1JNNL 3DRQA 2FL5A 5EB9A 2E6PA 1FNHA 4GRMA 5F89B 3TBSA 4ZUVB 3KYNA 5KVGL 4HKJA 2AEQH 3WD5L 4ZAKD 2VLRD 3ZDXF 3EFDH 1H3VA 4NBZB 1OW0C 4U6XA 4L8CB 3OXRB 4MHHI 3NH7L 3HR5A 5JMOC 2X1OA 3BP4B 1A6WL 4J3WA 1WBXA 4OLYL 2NPLX 4UDUA 5F6IC 1Z9LA 4CJ1A 5DEFA 3DVNA 3UTQA 4XX1E 4W68A 4NHCH 4F7TB 4RFEB 5MI0C 4QRUA 4XRCA 3F6IA 3QXWA 1PJ9A 3KYMB 5DQDH 1JHLL 3FO0H 1U8NA 3S4SB 2XTLA 2BNQB 4NZUL 5FYLE 3IKKA 4JEGB 4BH8A 4F15B 1MLBB 3O6KH 4XCEB 4Z0BL 4PJDE 1AI1H 1ZT1A 4Y5VC 4H5SB 4Y4FD 3T0XA 5D7JC 4X9HA 4JFOA 1E27A 4JFFD 1DQJB 4U6XB 1V3MA 3VGHA 4UV4H 1IL1A 1XR8A 3HZKA 4DGIH 1SBSH 5C0JB 5D1XA 5IJKA 2WUBL 2WINB 2WWMC 1BPVA 4HT1H 1RAMA 2BNRB 4F58H 1MLCA 2UWEE 3BPOB 1AR2A 4LNRA 1EUTA 3BE1L 1NBYA 1DLFH 3QIUD 1ZVSB 4G6AC 2ATKA 3OX8B 5SWZE 2GT9A 2XWTB 3MACH 4M61A 3V5KA 5DD5L 1QRNB 1P69B 3FFCE 3UZEA 3JTTB 5DSCA 5GGRA 2DLGA 1QNZH 3GSVA 3BKYH 1BAFH 3GUTB 4HUWB 2FEEL 5DMKA 4IIQB 3I50L 1INQA 1SEBB 1AXSA 3U48A 1W2KT 2HJLA 4I5BB 1K2DB 3FFCB 4OLXL 4YC2C 3EOAB 4HIEB 2OBGA 1L6ZA 1FFNB 3S36H 4ZFZA 4ZFGL 1AO7E 1S3KL 5AAWA 5IFAH 3EGSB 4G43A 1T7YA 4R96B 5FGCB 3KJ6L 1LNUB 3W2DL 1FNGB 4JN2A 3QUZD 5MEND 4RGNC 1FZOB 5D6DA 1OWWA 4YXHH 1Q9LB 1SYVA 4PJ7F 1JYWA 4AEHL 2N1KA 1AQKH 3K2UH 1LE5B 2ZG1A 4P9ML 4NQCA 1HDMB 2VQ1B 5T3ZD 3FT2A 3MO1A 1GYAA 4K3EH 4MD0B 4ZFOB 3I75B 4WNQA 4JPIA 4XWGH 3K4ZA 3PGCA 1JYNA 3ZE2F 1MJUH 2R2HB 5E6ID 4WTZA 4GAYB 5DRZA 1XAUA 1TETH 2CQVA 4P4KD 1JTTA 2FATL 3VFMA 1OTTC 5T3ZH 3V5HA 4TPRH 4I0PC 1MAML 4I0PB 5CJOH 2ORBH 3PWJB 1FZOA 1BVLB 5FGBC 2JIXD 2D31B 5LXGH 5AEAA 3WYRA 3L7EA 1T7XA 5EIQA 5BVPL 2JJVA 5FCUH 3W81A 1TVBB 4U7KA 2A1WH 1J8KA 1F6AA 2Y36H 3BMVA 4OUUB 1CWVA 1LDPH 3QP3A 2IAMC 2YOCA 1WT5C 2V2TB 4P4RB 3WFCH 4XP1L 2OR9L 3EYSH 3MRNA 5I16B 2OQJB 1I8KA 3FB8A 4NZRH 3RAJL 3V5DA 4U2YA 1HH9A 3CC5B 2YK1L 3MLWH 1A47A 5SX5H 3LKSA 3VI3F 1MJ8H 1J05B 2NY0C 3HUJB 5K93A 4NHCL 4RGNB 5GRJL 4GXUM 5E9DE 1OAZH 4GRLC 5GGSY 4HULB 3MOBH 2AGJL 4IRJB 4ZPTB 2J7LA 4BQ9A 3O2WL 2ZZUT 5DWUL 3RKDC 4Q2ZB 3D69B 3TH2T 4PJEB 1C1EH 3PDGA 1RIUH 3ZKNC 1YMHA 4N8VG 3BN3B 1RK1A 4Q97A 1DBKH 3IT8D 3NCYS 3MRGA 4POUB 2DS4A 3QJHA 4YHNA 4KY1H 3OHXA 4A2LA 4NQSB 3TO4A 3UBXB 3JWDL 5FHBH 5ABDE 2NY2B 1RZ7H 1CGTA 3T0EE 3ZO0A 3EZJB 3BP5A 3F7VB 5I71C 2DMCA 5C9KA 1G84A 4R0LC 4LCWA 1HHJA 1MCSA 5GS0C 4FRWA 2R4SL 2YEZA 3F5WA 3RVXD 3BEVB 1MQ8A 2YUXA 4Y5YA 1QG3A 4X5XA 4LSSH 4MAYC 1EEYA 5B3NA 3I50H 5LWYH 3FO9A 5IWLA 1CYGA 2OL3H 4X6CA 5HHOE 1FLTX 4F15C 3KJ4C 1YJDH 2LQRA 1NMCB 5IVXF 3UPAA 4RRPA 2DQCH 2AEPL 3EHBC 4XPBL 3W2DH 5JUEH 3WXVH 4XP5L 4KHTL 1BM3H 1NMAL 2P4AB 3EJJX 1I1AB 2VDLL 3LN9A 5E8NB 2AJ3B 4N0CD 4KRPB 1INDL 2VUYA 1MCCA 5DUBB 3D3VD 4P9MH 1QLRB 4MD4B 4HEME 3PWUB 3QUYC 2F19L 4NWUH 4PJFA 1H5BC 3LMJH 3F7YA 3BN9D 2EE6A 2Z4QB 2BHZA 2VLMD 4N8PA 4XXDA 3DPBA 2XQBH 3QIWD 3E3QC 2A6JA 5I1GH 2CLVA 4KMQA 4JRXB 4KK9D 4Z7OE 2DQDL 3TN0D 1LO4L 1U8OB 3GKZA 4HMDA 3JBG7 2W0FB 5T1DH 3T4AB 4ZD3L 3UEZA 3LKRB 5HYEA 2Y9RT 3DMMB 2DJUA 2BNRA 1ZHNB 2FHCA 4I77L 1IGYB 3WLWD 3U0TB 3KXFE 3QZWG 1R3HB 1NCBL 1A6PA 2J8UA 5GGUA 5FYKE 3RNKB 3EHBD 2X1QA 4OFVA 4S1DC 2BVEA 2ZUXA 2WM0A 2VISA 1NBZA 2FLBT 1FVCB 2IAMD 3S34L 5C08A 5DRXA 2OR9H 3QZWB 3CUPA 4TVSa 1U8HB 1NEZB 1OF2A 3L3JA 3RBSA 4UAOB 5JNYA 1HKFA 3H7LA 1A1OA 2X4SB 4NBXB 5TE4H 3VI3E 1W72A 1ZXQA 2EE3A 2VDPL 4GRLA 1S5HA 4F7EB 4M6OL 2MFNA 4EI6B 1P4BL 5ACZB 2EDBA 3CX5K 3VXOA 3V79C 1UCBL 2VLJB 3O4LA 1RIHH 3QULA 4LNVA 4P5MB 4MYWB 3OKNB 1FL6A 4KTDH 1G7QB 2ATPA 3QDGB 1KCKA 4NUGL 3D18B 1MH5B 2IAMA 1RZGB 5IVXE 1CU4L 3MUGA 3WFEL 5C6TL 5D7JD 5J6HB 3HHRB 4KU1A 3FZUD 1A3RL 3IVKB 3QJFB 4Z0BH 1CS6A 2GW5A 2X4PB 2FEDC 4PRPE 2VZVA 4FFYL 2M26A 1OGAD 1RV6X 1MWAL 5IGXL 2BY2A 5ITBL 2KKQA 1A6VL 1L6XA 1I75A 1A14L 4MB3A 3ILPA 4JQVA 3T4YA 1KIRA 2L7JA 3DX8B 1NFDF 5GZNC 1S7UB 1R24B 5F88A 1HSBB 5DJAB 2ICWB 2C3VB 4J3OC 1CFQA 2FJHB 4W4OC 1LEKB 1MF2L 4RGNE 3VD7A 2XZCH 5LWYL 2UUDH 3KXFD 3GHEL 2OL3L 5ESAB 5C0AA 4IDLA 2WANA 1BAFL 4ORGB 3AY4C 1G7MB 4GRWB 1TTGA 1XF5A 5DMIH 4NNPL 3EOTH 3SCMA 4UU9B 2GUOA 4L4VE 5ID0B 1BM3L 1CR9L 1NMAH 5H94A 4DGVH 4LSUL 5CGYD 2C3HA 1MRCH 4HMCA 4LHUA 5JPMB 2QR0A 3D39B 4YXLL 3KPQB 4PJFE 4PD4K 1T66D 3BPNC 2A73A 5FHAL 3BP7A 4X9BA 3U6RB 5GQBA 4LEXH 4X5WB 3JTTA 4N5EC 4DFIA 1DE4A 5MERB 1H15A 5C7XL 1I3RA 4NUJB 3DUSB 1N3NB 3MJ9L 4NRZB 5DJZA 1DQTA 4MJ5A 1F00I 2OSLB 3ULVC 3Q6GL 4X80H 3REWA 1X5YA 3S3PA 4ODVH 1Q9WA 2AK4D 35C8L 5T1DL 5KVEH 5IFJA 1DQLH 1MSPA 1U8MA 3SO5A 4NQDD 1MJUL 2O5ZL 3V6BR 3Q5YA 4XMPH 5H37G 1A4JB 3RRQA 3QFJD 1TETL 3QUZA 3T65B 5E8PA 3DX7A 5D1XC 5I9QC 3D85A 4QXTA 5CZXD 4QO1A 2BVOA 5B38G 3BRFA 4YHYB 4O9HH 3F65A 4NQCD 5JQ6L 1G7IB 1F58L 4XNUL 2BRRH 1LO2H 2F8OA 4YXKH 1VFAA 4R90L 5F1IA 4NJ9L 4XNZB 2AI0H 3MCLL 1UH3A 2XQYG 2OMBA 3SGDH 1ADQH 5GRUH 4RAVA 4KKAD 3P4LA 2MTPA 2DD8L 4WFHD 4S1SL 1KGCE 4TUKL 3BT2H 5FFLA 1QBMH 4WHTB 1UXWB 4M6OH 5HPOA 2IJ0C 3LKPB 4U1MB 2XRAH 4ZUUA 3UROR 3I6LE 3C60D 1AXSB 5AYUH 5FDWA 4LLUB 3OJVC 4Z7VB 3NCMA 1ZLSH 4EKXA 4YFLF 1XZ0A 4PJDA 3CZFA 4KDTC 2VITB 1YY9C 1NC2A 2Z91B 5EU7C 1U8PA 2ESVA 1NDMA 1W0YT 4MWFB 3BZEA 5FKAA 3BD3A 5C0DA 4D3CL 1S7XB 2IALA 2E7MA 1SBSL 1C1EL 4L8DA 4JG0H 5FO9A 4BM7A 4QCIA 2BC4B 4E0RA 3DI2B 5LG1A 3WS6C 5CZVL 2EYTA 3QUXD 12E8H 1JGVH 5MEQB 5HHPA 1KEMH 3U0TA 3KNBA 1DQJA 5GJSL 4GT7A 5ADPL 1W72L 1ZGLA 2OXHA 3FONA 2QADB 2K9UA 2PW2B 4KH2A 2W9DH 1NBZB 1M7IB 4FTVA 3UC0H 3WDHA 3RZCC 4YGVA 1MFBL 5C08B 3SDXA 4F37F 3GMRB 2PW1A 4J6RL 1YECH 4CNIA 5AD0B 3GMQA 3K8MA 1UM5H 3EOTL 2DMKA 3N85H 1WJ3A 4HKZB 4PBXA 3MLZH 3OKKA 5KS9B 4HK3N 5T5NF 1OPGL 4RISL 1D5BB 3GJFK 4CVXA 4XVTH 4U1JA 5C0GB 2Y25A 1CE6B 1WWCA 3VXRB 4MA8H 1J10A 4HFWA 2BMKB 4YXLH 4FQHA 3LRSB 3WHE1 4ZO6A 5EIVA 4XBPA 3F7VA 4OIIH 2VIRB 3O4LB 2IBBA 1C5BL 5K9KA 3GRWH 1T1ZB 1NMCC 5GS1B 4B0MM 2JJSA 2P8MA 4R3SB 2AV1B 5EZJA 3ARWA 3RL1A 4AMKL 3P4OA 1AE6L 2OL3A 4KGLA 4OV5A 2J5LC 4CN1A 5I8OH 1RUMH 1BVKB 5B8CB 1JI2A 1IC7L 35C8H 5KVEL 3UBXG 2YUVA 2CDGB 5LQBH 1F4WL 2BCKA 2EZ0C 3HS0B 3V7MA 1NAMB 2H32A 1JPTL 3GBMH 4EZMA 2VXUL 4ZFOA 2NY2D 2K7QA 3SDAA 3CPLB 3WL9A 4FQ2L 4MVBC 4QRPB 3UJIH 4XBPB 1LK2B 3LIZL 4OZHB 2QSCH 1CTNA 1X5FA 1WICA 4LLYB 4YDLC 2ICWA 2UZIL 4YDLB 5D7IE 1F58H 2ENSA 3N0PB 5GRVK 1I7RB 3R0NA 4NT6A 1HHIA 4G8GD 3KPNB 3B8YA 4AIZA 1OT1A 1DTUA 1UC6A 3MRMB 1OTSD 3QEQA 4PRAB 2VWEE 3KPMA 3G6JE 3CFCL 3MA7A 2ZCHL 3P9LB 4RSVA 4X4ZA 4ZXBD 3ZSTA 3QEQE 4HUVA 1MRFH 1Z0NA 3UTPE 3UTPD 5CILL 3U46B 4BK5A 2AXJA 5IHBA 1CXFA 4JGMA 3FB5B 4UBDD 3NZ8A 3LY6A 1TVHA 2VDPH 4XPAH 4L3AA 5GS1C 1DSFH 4APQB 1RIUL 2FIRT 5C0JA 4XHJD 3GSNA 2V7NA 4XZUB 1DBKL 3IYLW 4JHAL 4R9HA 5A2JH 4OM0H 3QI9A 2IPUK 1A2YB 4KTDL 2FX8H 3MV7B 4N90E 1KPVA 1IC5L 4BQ8A 4OCYH 4HBCL 2H6PA 1R24A 4ZPTA 1KTKE 3B2UD 5TDNB 1E4XI 3VFGH 3ZKND 4N9GB 3C5JA 5FHBL 4QNPE 3SE9L 1A3RH 5DLMH 4JO4H 4FFYH 1RD6A 3QEUB 4MVBD 1H0DA 4PJ8C 1I7ZB 1KEML 2C1OB 2WBJB 3L5WA 3OSKA 1N0XH 5D70L 3F8UB 2P5WB 2YSSB 5CZXC 3IJYB 5HDBE 2JJUA 1BFVL 3DTXA 1OB1B 4Y4FA 3O8XB 2DQGH 3L3OA 5C0IA 4L4VB 1HHKB 1ZA6A 5C2BL 3RFZC 2NXZD 4X9FA 5HYJB 3WKML 3H2WA 2X40A 4X6DB 4IMLA 4ONHB 3KLDA 4OAWB 1ZHNA 4MMZC 5D7IF 4CU6A 3MUGB 1Q9LA 1IEAB 4YR6B 4UDTA 3O6FD 3QJFA 2R56L 2DI7A 4GW1A 3QIUA 4QRRA 5I1CL 5GSVB 1UYWL 2HFEA 1R5WA 3CFKB 3NAAH 5FM5O 1J0JA 3SGJA 1RJLA 1CR9H 3TBYA 1NEZA 3UTZB 1G7JB 5HY9B 4HUUA 3HNVL 4ZFOL 4Y4KB 5DUBA 1T80A 1NUDA 5FYLH 4J3UA 3IDXL 5TH2A 3BGAA 1I7TB 3MC0A 1AE6H 1MREL 2A2QT 3KLSA 1JGDB 1HHGA 2XN9B 2Z31C 3G04B 3QFDA 3O6FA 1U95B 3SOBH 4AQOA 2NNAA 2ZUVA 1NBQA 3MJ9H 15C8H 1JPTH 2AQ1A 3GBML 1KPUA 4XI5D 1K6QL 5D93C 3QA3A 2K7PA 1PZ5B 1U8OA 3PGDA 2IPKA 4Z8FH 3UZVB 1MFDH 4K94H 1JWUB 3QQ4A 4ZYKB 3NFNA 4OZIA 4HV8B 4ODHH 3U7YL 4PRIA 1T1XB 5HPMA 2P8PB 4JM2C 1YMMA 3O3DB 3U2SB 5J1AA 4O2FB 1IARB 4P4KA 3VFUA 5JQ6H 4IM8A 1EO8L 4P3WA 4PY7A 1FG2B 1F8TH 4R90H 2VAAB 1CGUA 3CUPB 3BUTA 4M61B 2AKRB 5C0NC 1OQXA 3NCJL 3CXHK 2FX7L 1AHWA 4KK5C 4G3YH 1UCBH 4P57B 2FYYB 3VXSB 5FYKD 5AUMA 5HHOB 3BH8B 4NCC2 3T0BA 3RP1A 3I6LD 3VFOB 5DD1L 4XPFL 1N64H 4HIJB 1QR4A 4Y4KD 3CFEA 1T1ZA 3H9HB 3AAZB 4CL7A 1N8ZB 2P5ED 2DDQH 5DJCB 5IVXA 3MR9B 4JRXE 1JJUA 1H3WM 2ED7A 4K7PX 2FSEB 5HDLA 1ZLSL 5KVDL 3DGCR 5FB8B 1LNUA 2OL3B 3MREA 4DK6A 3BD5A 5IV2A 1LWRA 5DQJB 4K3DL 4BSVA 4MXVE 2NY3C 4G7YH 1S9YB 1FFQA 3QFJE 3TEUA 4BUGA 1P84K 2JJTA 2V9TA 1CFTB 4JANA 4TVPH 5AWNH 1OT2A 2NY4C 3S98A 5FUCE 1VGEL 1EZVX 1HEZA 2W92A 4PP1D 1TZIA 2DBLH 3C60A 2P5EA 2PXYD 4JM2B 1T2XA 1FBIH 5IQ9A 2CR6A 2AEWA 3TCLA 1QA9B 32C2B 3F12A 3DSNA 3IU3A 3MRCB 3TYGL 5BQ7A 4NKIH 2X05A 5IG7A 1E4KA 4RIRA 3WO3B 4OBSA 1MFBH 1JPFA 5CIPA 3UPCA 3C6LC 1MY5A 1P4IH 5HGGS 4R3SA 1UYWH 4D0CB 1U6AH 5CEZL 3BGMA 4WJ5B 1JUFB 3KPPB 5D71L 3MLYL 4WWID 4NRXA 4RISH 4XNZC 3NZ8B 4HS3B 3INUH 1I9RL 1FN4A 2PXYA 2CK2A 2CXGA 4NO5B 4K3JL 5C7XH 3H3KA 3THMH 3T2QA 3V5DB 5CJQH 1T2QL 4XGZB 3GRWL 4ZPVA 1LO3L 1XCQA 2BSTB 3UTSA 1VCAA 4C56A 4FG6C 3CVIH 5CJXA 4LP4A 3D25B 3H0TA 3N9GH 5T1KB 1RZKH 4X5WA 5DMGC 3DARA 4P2RA 2DIJA 1FCCA 3MGTB 5ESVA 1I7UA 2QQKH 4OZ4A 5TDPB 2MSPA 4XVJL 3IFLL 4WW2F 3QEGL 4L5FH 3PP3H 4UILH 1UB6A 4HS3A 5EU5A 3IJYA 5K33A 4KROD 4M3KB 4PRDB 2DQJL 4CVZB 2A9NH 3AGVA 1MCOH 1LO2L 4M6NH 1UFUA 2YXFA 5E1AA 5LGHL 4Y19A 3K7UA 1UQSA 2BVOB 3HMXH 5KVGH 3QUZB 3T65A 5J11C 2I9LA 1UJTA 2VXVH 1RMFL 3NACH 5TE7L 2YRPA 1F8TL 1IAMA 4HH8A 2NMSA 4TUKH 4BSWB 2Y06L 3AS1A 5EO1A 3RU8H 3QG6B 1FH5H 3E6FB 1OP9A 4FNLH 3OKEB 4I4WA 5HHQA 1CDCA 3QUMA 5AYUL 4FQPA 1NGYB 1YYLL 1T1YB 1T3FB 1WAAE 4LIQH 1JWSB 1E28B 2DWDB 4KWUA 1XF3B 1OHQA 5FDWB 2CDFA 2Z31D 3SJVB 5B21A 2PYEB 2ZCLH 2ADIB 1MWAB 1BQHA 4ELME 3S3SA 2RR3A 1IAIM 1ZMYA 4UT7H 5IB5A 4WUUA 3L3OB 1HWHB 2ZNWA 1KLUA 4QY8B 5I8CB 1BOGB 1N6UA 3CAFA 1ONQA 4JFFB 5JOFB 3O2DA 2DN7A 5DRNB 2L4OA 1OAYL 3KDMA 4NKMB 5DLML 1ZK9A 3GI9H 3P4NB 4UZGA 3CNKA 2WV3A 3C5SA 2VABB 4GKSA 3N50A 5HHPB 3JV6B 1U92A 3TN0C 1K8DB 3WIHL 3QXAA 4U4BA 2VTFA 4IBLT 5CZKA 1PEWA 2YMXL 3DHMA 3CMOL 3LKNB 5F9JB 3FO2A 2OTPA 5FYJL 1CIDA 3BKCL 1AR1D 3BW9A 3PXHA 1ULVA 2W65B 4R6UA 2V7NB 4W6XB 3CC5A 2EH7L 4I2XE 2VO5A 1J05A 1EJOH 3PV6B 5ANMB 5BZWA 5ALCL 2QQNL 1BD2B 1P4IL 1BD2D 1LMKA 4XMLH 4QLRA 2LAAA 4MD5B 3L3DA 3RWHA 3WXWL 2XY1A 5E8OA 3KJ6H 1I85C 3VXUE 4LLWA 4PJAE 3MLYH 2QJDA 4NQXA 3JV4B 4U33A 3DUSA 3VGAC 2Y23A 2EDJA 3MNWB 3VH8B 4AL8H 2E9JA 2JTDA 4NQED 5HDBF 4P23B 4PJAA 3PIQB 1S7WB 3CH8A 3QDMB 1K4DA 4H1LG 2M8XA 3K2UL 4HFWB 3MUZ1 5BS0A 5DT1L 4WWKC 1BFSA 3O2DH 5B38B 3PGFH 5E99H 3X14B 5GIRA 1Y0LA 1T22A 1I1CA 4JQXA 1LEGB 3ZKMC 5LQBL 3V52H 4J3TA 2N4IA 3DMMC 2R4RH 2XI9A 4KI5D 2FX9H 2ARJQ 2CIIA 5C0CE 4F9LA 5GS2H 3VXMD 3HN3A 5LBSH 5IEHA 4FQ2H 1NMBH 1FFOB 3IFLH 4XBGB 1F2XK 3FTGA 1F3DJ 4OB5H 1QFWM 1LK3H 2GAZB 3WS3B 5E00B 2BRQA 2UZIH 3UDWC 2IADA 3EFFA 2A9NL 3EFDL 2BSRA 3C60B 2A6IB 4N9GA 5T3XE 1J0YA 3UTZA 3MRRB 3ZE1E 5FOJA 3MA9L 3QUYB 3MNVA 4FFZL 3LEXB 3WFBL 4ZG1A 1RURL 5EUKB 5CEYA 1QA9A 4KI5E 5B39G 4N0RA 4JO2L 4GXVL 3SKUD 4Z77A 3RAJH 5HYIA 3C2AL 1H8SA 3BKJH 1JHLH 3FO0L 4APQD 5DJ2B 1V7NL 4N0YL 4XNMB 2NR6D 5BRZA 1HNGA 1W0VB 3QWOA 4X6DA 5TJWK 1R3LB 2BX5A 2LVEA 4LK4A 5D7LE 3FCTB 1YUHB 2H2SD 2X10A 3U9UB 3P73B 4HK0A 1AXTL 2ITDA 4TSCL 4HBCH 5CBEB 4GOSA 1DR9A 3MOAH 5HGBB 5DUPL 1JMXA 5DD6A 1ZLVH 2B4CL 3QRGH 4APQA 3RY6C 3G5YB 4LVOC 1NPUA 2FDBP 3VGDA 1DDHA 3IF1B 3VU2A 3KLHD 2W1NA 1GZPB 1IQDA 3IU4L 3TH4T 4QHUB 3ARDA 4C58B 3P30L 3UJJH 5C2BH 4NWTH 3BZFA 5IOPB 2F5BH 4LSSL 4F8TA 5DDHB 1P5VA 1ZVHA 4Z9KB 5D96B 4HK0B 3ARSA 2EH7H 4FS0A 5IMLA 1IBGL 3CDGB 4L4VA 4ODSL 3EYOB 4OI8A 5ALCH 3LKOA 1H3XA 1KTRL 2P24A 3DTXB 1AR1C 2WMPA 4MB4A 2HT3D 2VIRA 2C5DC 1UACL 4NSKA 1DQDH 3VMPA 4XP5H 2VDLH 3SE4C 5HHQB 4F7MB 1KLGB 2E9BA 1INDH 5D7JB 3V8CA 1WWAX 4NQVA 5FDYA 1U3HB 4MA3B 1LHZA 4LCUB 2D7NA 4U6YB 3TBYB 3LMJL 2VLRE 1MFNA 2R0ZH 1TTUA 2Z92B 1NEUA 3U4EA 2EEBA 3GK8H 4M7ZC 2ZPKH 5TH2B 5L2JB 1P84J 4X5LA 3RA7L 2H1PL 3VRIB 3DURA 3CCHA 5L0QC 3QPXL 3EDDA 1PBYA 1RZKL 3E8UL 4YHML 3QDGD 3HZYB 3O8XC 1KIUA 3MRMA 4LBEB 4ODHL 1U3YA 2I5YL 4WEBH 3MBEB 1OARH 2GFBA 4JFDE 1ITCA 3X3GH 4HBQA 1OD7A 3GSWA 5HGDB 3DMMD 5I66A 1NFKA 4P48A 3C2AH 3AM8C 4O2FA 4KKCC 3A0OA 1T1XA 3O2WH 4NHUA 2B20A 3RU8L 4KZEH 2NW2B 1PG7H 5EA0L 4KK8D 4PTTA 2R2CA 2RHEA 1WLHA 1S9XB 1N64L 4PJ5E 5GRXG 4FA8A 3O6ML 1EVTC 1J5OH 5E95B 2QKIA 3MRFA 2YD8A 3MSPA 4MD0A 3FQXA 4X4YB 2AERT 2BOCA 4TSCH 3GDBA 5DRNA 1EFXD 4Y19D 3V9FA 3VFRB 1T22B 5DGRA 4P0DA 5HYQA 2CR3A 5IB2B 3VRLE 4Z7QE 4ZXBA 5IMOB 3K4AA 4TUOB 1Z0MA 4GAYA 1FFRA 3MJ7A 3HC0B 4FQHB 3DVGB 3MXVL 3SBWA 4IHOA 5AWNL 2AP2A 1MCEA 3BESR 4WW1A 2RAMA 2VE6B 5DVKA 4NO3A 4BH7B 4QOKA 5J9PA 4X4XB 1IC1A 1IGIL 1NGXA 4IMLB 4ZOCA 4M1CD 5GSRA 1NBVH 4TTGA 2JCCA 3QB7C 3D3VB 4EIGB 4RNRB 3QI9D 2B2XL 3BKMH 3P11L 3MRLB 4LCCA 5BV7C 1CL7H 1GZQA 3KLHC 3RWDB 1KCLA 5BJTA 1IBGH 1JE6A 4XPBH 5D6CB 5JXED 1CD1A 4JKLA 3MLTB 3GHBL 1P5UA 1DUZA 3G5VB 1TPXC 5MI0B 3MV9D 4TUOA 2HFFB 5E5RB 1UACH 1LVEA 5L8KB 2WLZA 5DK0A 3PWNB 3VGBA 1EEZA 2WINA 4EUPH 5D71H 2FIKA 2CRZA 4ISVA 2DTSA 3BIBX 2OP4L 2VLLA 2VLKB 3DLQR 3EYQC 5BZDB 4PJIB 3CZJA 5DYOA 1JUFA 2VERN 1YEEH 3I3DA 4XVSL 4KVNL 5C0DB 3QRFM 4AL8L 4NO0D 4PB9H 5L6YL 1XCTB 5D6CA 3X3FL 3DXAA 4I9WD 4ZD3H 2PUQT 3VRJB 4MDIA 1EHXA 1VHPA 5C3TA 3RVWC 4N1CA 1J11A 2HJLB 4I5BA 4TNWK 5I73B 1T5XB 3SCMD 4X6EB 1KJ2B 1NCBH 3ULUL 3D39D 4JREB 3G6JF 3V52L 2FR4A 4RMUA 1BD2A 3ULSB 3QQ4B 4ZYKA 1QO3B 3RTQD 1AFVH 4PIRF 1GPOH 1OQOA 4FQ1L 3S88L 3UTSB 4Y5XA 3WIIL 2X4OB 1EJ6A 1A2YA 2I27N 1NMBL 3MROA 1J0ZA 2JB5L 4UTAL 3JXAA 3ALPA 1S9VB 3QQ9D 4RFNC 1W0WA 4YUEL 4WY7L 2H3NA 4CNIB 4DKEH 5AD0A 3MRBB 3JZ7A 3G6JA 5BRZB 2VXVL 4U1NA 3WSQL 5TE4L 1F3JA 1DCLA 3MCLH 2LTQC 4F80A 3OWEA 5K9OB 1ADQL 4OTXH 5GRUL 2YPVH 4LHUG 4JM2D 2ADJB 3ES6A 4MZ3A 1KCVH 3ARVA 3H9ZA 2CIIB 1PG7L 3HZKB 4A6YB 2VLJD 3MRJB 3VFVB 2DTML 4QYOB 4WWKD 4G8FA 3P3YA 4JZJB 3B9VA 1CU4H 3WFEH 2FRGP 2P8MB 3OG6B 1J5OL 1V05A 1KCUH 3DV6B 2G9HA 2FLRT 3GSNL 3VWKA 3QIWC 4TULL 5ITBH 4U1NB 4JY4A 1CFTA 2XA8L 3A67H 1FPTH 2XZAH 4WI3A 4JG0L 4U6HB 1G0DA 1HEZB 2X1WL 3VXRD 5CJXC 5LAXB 5DMKB 3VD4A 3MXVH 5H37H 4HAGA 1CD0A 5IMKA 2FO4A 2IFGA 1BLNA 5AAMA 4JFDB 2YR3A 1QFUH 1NBVL 1MF2H 1XH3B 5BRZD 2R69H 1B9ZA 2B2XH 3NIFE 1MOEA 5SX4I 3JWOC 2AJVH 1X44A 3SE8L 2NY4D 2ESVD 1ZT4A 4OF7A 1D6EA 3PL6B 2V2XB 1EJOL 3H9SE 5IFHL 2H9GB 4PPTA 3ET9F 3QA3B 4GG6B 3L3JB 4DGVL 3S37L 4NRXB 4MA3A 1WBZB 1A1OB 1L7IH 2X4SA 2UYLA 1VESA 1CFSA 1BJ1H 4JVPA 5INCB 1TVHB 2G5RA 3BYTA 3LEYH 3MRIA 5C6WH 2DBJA 1JNHB 4PRIB 2NCMA 5HPMB 4Y4KC 3SEPA 2IPTH 4YHPB 1QBLL 4MQXC 3ARFC 4P2OA 1C5BH 5CGYC 1TXKA 2AV7B 2HRPL 2D2OA 3ZTJH 1JK8A 1RZGA 4M1DL 1OM3L 2IAND 2R1YA 1HQRA 3RWFA 2R8SH 4G6KL 4XNQB 5FM8A 1FNLA 1RUML 4TOYL 4MDJA 4DAGL 1WBZA 2EXYC 3ECBB 3S36X 5FUZH 4E42B 3DRQB 4D9LL 3MYJB 3S5LA 2F8XC 4QKXB 2X41A 3ZDXE 2VXUH 4NQCE 3UTTE 43CAB 3NCEB 1GC1L 5ID1B 3S88H 2Q7YA 4IJ3B 4XNUH 1HCFX 4R26L 3MRQB 4M7LH 2I9LB 5FAAA 5B39B 1T6WA 2JCCB 1JFQH 1YEHL 8FABA 2UWEF 4YHLH 1IFHH 4RWYL 4PJBB 4PB0L 1BQLH 5I19L 1FYTB 5D1QB 4LARH 1A1NA 2X4TB 3RWDA 5CJ8A 3LVEA 2NX5B 3WSQH 1BVZA 4MA7L 4OD2B 5ENWA 4DUXA 4RFEA 2I26N 3RVWD 4QRRB 4P2RD 4Q2ZA 1IQDB 4YHOH 5AG8A 1BBJA 3MCKB 4U1GB 2XKSA 1I1YA 1V7NH 2K3TA 4WV1A 3FT4A 4H8WC 1PKQB 3VE0A 4CN6A 1KJ2H 3LKRA 4ZOBA 5DQDL 2P5EB 1T66C 5EZIL 1K5NA 5DJ2A 2FB4H 1RZFH 2DLIA 4MNQA 3NOIA 4HIHA 4RMRA 1YNTB 3V0WL 4CW1B 4Q9RH 3F58H 1EEQA 5E9DB 3BP5B 4KI1A 1UWGH 2G2RA 3MJGX 1KJ3H 4G9DA 4WW1B 1CN4A 5TF0A 1FC1A 1D9KC 4NO3B 1J0HA 4XCYA 2CD0A 3O45B 3PWVA 3MBEA 1QFWH 2FX8L 3VMNA 5E4IA 3TJHC 4M6MH 4P5KB 3KPPA 3QRGL 4HWNA 4P9HH 3SE9H 4HSQA 2HMID 4RA0C 3ZKXC 1YQVL 3U1SH 5D2NA 3VW3H 5CD5D 4I18B 5C6PB 4LDOB 4NZTL 4G9FD 2ITCB 2F74B 1P7QB 3SE8H 4HJGA 1YY8B 1RUPL 1YN6B 5HVFB 1U42A 3VG9B 3I9GH 4PY7B 4PLKD 3RVUC 3V6FB 5KSUA 2JK5B 2QV2A 3FRPG 5BZDA 3KPLB 1S3KH 3CJJA 3EO9L 4H5SA 4XVTL 1CLCA 4TN9A 1ITBB 4KKNA 1P7KB 2P5WD 4P23A 4P5TB 1WWBX 3MNZB 3QR2A 3ULVF 4JFXA 5EU7E 1MCWM 1CFNB 1FHGA 4NYLB 4ALAL 5AZ2L 3DXAB 3NA9L 4KPHH 4QF1A 3QG7H 1Y6KR 4L4TA 4NSKB 4PJFF 1SJXA 4RMTA 4LSPL 4L8CA 2HRPH 1DQQA 2OP4H 1CGXA 3FJTA 5SWQB 1P6AB 2FJHA 4RNRA 1J12A 4M6AA 3V5HB 1CGVA 1YEEL 4Z7WE 3OG4B 2YN3A 4K8RC 4XVSH 1VADA 4LRNH 4OBRA 1NLDL 1RJYA 1FC2D 4D9RD 3OGCB 2FATH 5FUZL 4XPGL 4QRRD 3NIDF 3CFBA 1NGWB 2XT1B 1QLFB 3O6LH 3PWLA 1JIBA 5EORH 1OF2B 4FP8H 4P5TD 3QI9C 4X6CF 3VWJD 2I9TA 5FYKH 3BPNB 4WHYH 3DRTA 3G6AA 5SV3A 2A1WL 1G0XA 2PW2A 1S7VB 5KSAC 4MNHB 4MA7H 4PJAF 3MJ9A 4XAKD 3RVVC 2Z35A 2IEPA 1QRKA 1NC4B 2NY5C 5L88L 4YHKL 2YK1H 3MLWL 4MJ5B 1HXMB 3HPLA 1WT5A 3TV3L 2J8UE 2Q7NA 4CN4A 3MRLA 4LCCB 1KJ2L 1N59B 2X9WA 1DVFA 4M3JA 3GNML 4MNQE 3QDMD 4XHJC 1B0RA 4IS6A 2VOTA 2VR9A 2DTMH 3ORJA 2NR6C 1HOCA 5F7YC 3SN6N 4M9OA 5D7LA 3IDYC 2R1WA 4PRID 1A4KB 1D5MA 2WUBH 3X17A 3BPCA 3DECA 3WE6B 3ULVD 2NX5E 5D72H 5ISZB 3GSNH 5JZ7C 4JCMA 1A7PH 4XTRD 3GIVB 1QSFE 3KHOA 1VEPA 4CU8A 1I8KB 1FPTL 1YDPB 2XZAL 1TJIH 4RBPK 1YPZB 3SY0B 4TVPL 5EC1A 5B4MC 3GBNH 3NFPB 3DO7B 1DLHB 1ZLWK 3S8WA 3MRKB 1T83C 3GSOA 3P0YL 3NABH 3TP4A 1F4YL 5JXAH 5LGJB 4HH9B 3ARYA 4PJDB 1TDQA 3QQ3B 1S8DB 2AJVL 3TLRA 3VJ6A 2B5IB 2DQCL 1D3CA 3TNMA 4HCRL 2X4OA 2E7LA 3ZT5A 3FT4B 1JZ8A 2P49B 1AY1L 3F62A 4GLRH 1KIQA 4KPHL 4NOBA 3QG7L 2ZOLA 2RIKA 3IDXH 2EKSB 5D2LB 2BFVH 5FGSA 4CAGA 1MREH 1FG9C 3D0VA 4HD9A 1CLOH 5K9JH 4WENB 4I0KA 5ICZB 1GGIL 4K3JH 4XZUA 1Z9OA 2IPTL 4S10A 2J6EA 1ES0B 1X5JA 5DJXB 5IB5B 5C0CA 1VEMA 5GJTL 3HAEB 4L3EA 4NIKB 4QHNB 5I0DA 4PJ8B 4YNYA 5BVPH 5B39A 4PRPD 1C16A 4XPGH 3GMLA 5FO8A 3M1BB 2CJUL 2PO6A 4L3EE 3NCFB 2VISB 3QPQD 3LN5B 2OTUA 2H2PD 1OAUL 2FJFA 5FYKL 1T03L 4WFED 2Q3AA 2C7UB 3SHSA 5FO7B 3WFCL 4XVJH 2XNAB 4JJ5B 3O3AB 5EU6E 4HS6B 4YUEH 1GC1H 5F6HI 1S9WA 1PQZB 2H32H 4LSDA 4R26H 4BA8A 2R2BB 5GRJH 2J8OA 3U82B 4RWYH 1MCDA 1KGCD 2EYSA 2FJGA 4JFDA 2H3NB 4S11A 5D1ZC 4OCMC 1YNKL 3CK0L 5HSFA 5EBMA 3MROB 3FFDB 2PO6D 2F8VA 2VKXA 2X1XR 3M1BA 3P77A 3BX7C 3LN5A 1EAPB 3VDCA 3AC0A 5SWSD 3VG9C 2CK0L 1OGTB 1I4FA 1RIHL 5DURD 5A16A 1J8HB 1PAMA 2DDQL 1UADC 2VR4A 3I6KB 3WNNA 4LIQL 3UZQA 4OZHA 1M71B 4PBWD 1F11A 3EO1B 2EDXA 3QNXB 4U1KA 4Z7VA 3U4BH 4GRWE 4M62H 2J6EL 4DW2H 2O5XH 4JFDD 2DQHL 1NC2B 1MWAH 2WBJC 2ZCLL 3LPFA 3DX8A 3BZEB 3LSOA 4ZUTB 3NFSL 3OV6A 2LVCA 3RI5K 3OGCA 4OGXH 5SWZA 4WVRA 4BFEA 1QFWL 2VR5A 2GITB 2VKWA 4M6ML 4LAQH 2B5IC 4OZGF 1CFVL 4JFYB 5MHSD 1I8MB 1ODAA 4P9HL 5JIHA 3DX9A 1A7RH 4M7KH 4EI5C 1D9KA 4G6MH 4GRMB 3FFCD 2HTKC 4HF5H 5FYJU 3V6OC 5FUOL 1MI5A 3U1SL 1BWWA 1ZV5A 5KJRH 1YNTA 1SJEA 5DGQA 3ZYJA 1ACYL 2GY5A 3LRSA 3STZB 4NN5C 3BKCH 1GCFA 1B4JH 3CSYB 3B9AA 3L5HA 4O2CA 1JYXA 4OLWH 5FUCC 5DMIL 1SHMA 2ED9A 1FRGH 3WJLA 4JVWA 1BJ1J 4PFEA 2VLKA 4HZAA 4OZFB 2FEDD 1OD9A 4OLUL 4OLVL 5EN2A 2VDKH 1EGJH 1UXSB 1QBBA 1MVUA 3GFUA 4JDZB 1A1NB 4IMKC 4UBDC 3TPUA 2UYLB 1D9KD 3RDTB 1JNLL 2X9YA 1FVCA 3RDTC 4JLRB 5EU3B 4FTVE 3QZWA 4RX4D 5CJ5A 1HZHH 4K9EC 2DQDH 2APVA 1HOCB 4M1DH 4URTB 5I66B 3AS3A 4X8XA 4BELD 3BPCB 3MV9A 4K55A 3VXME 5E99L 1MCPH 1A1MA 1JZ7A 4PGBA 2WIIB 2QQKL 1U8LB 1GHFL 1PG7W 4PGZA 4Y5XB 5HD8C 2R29H 4ERSH 5KANI 4AIZB 5F7WC 3KYKH