2AAVA

Solution nmr structure of filamin a domain 17
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
GAMVVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the GPIb-filamin A complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Filamin A
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aavA00
4KU1A 1JGUH 3BGFC 1Z0MA 4FMKA 3RY6C 4Y4KA 4XXCC 1XR8B 2CGRL 3CZJA 4QRTA 4NM8H 1DFBL 2DQJH 3L6FA 4P46A 1BZ7A 4XPTL 1MI5D 3MACH 2J3SA 1EEZA 1A7OH 4TUOA 3IJYA 3R06B 3O9WD 1KXVC 1NQBA 3QULB 4PGBA 1ED3A 3VA6A 2M26A 1IL1A 1K8IA 2X4SA 4P2OB 4Z7NF 3F5WB 5KG9A 1OAUL 5EBLB 3QCTH 3LHPH 4P48A 4L3CA 2OSLA 1ZVSB 4LHUD 5ESVA 5C0JA 5J9PA 5DJZB 3WFDL 2AV7A 3EJZC 4P23C 1I7UB 1MQKL 3QWRA 2FSEB 5EH1A 1XZ0A 4HLZH 4X5XA 2DQIH 3NVQA 1VDGA 4XPBL 5IMLA 4FZEH 5F6IB 2C3VA 3QDAA 3HZKB 4WI2A 2L0DA 3G5VA 5GRUL 3GHEL 3ARGD 5FF6B 4G8IA 1QEWA 1UT9A 1WK0A 2ZSWB 3FT3A 4MD4B 3D18B 5ICYA 5IIEB 2APXA 5DLMH 2CIIA 4PP2B 5HVHC 4HK3J 3L3GA 4FRWA 3CU1A 5LCVH 1TFHA 4GXVL 3MNVA 3PGCB 4WW2A 4OSUL 3BRGC 1CFBA 2Q3AA 1CZ8L 4X6FB 3DXAA 3T2PA 3LB6C 4PJ8B 5DLML 4RZCA 5E2WL 4XP9L 5C3LD 4OBRA 5JOFB 3O6FD 3OF6A 4F80A 1OAUH 4JFYA 3T4YB 2F15A 1NGPH 3BOVA 4HUUB 4PRBA 1RZJL 2PYFA 3EYOA 1ADQL 1UEMA 3GSUB 1I8LC 3MV8E 1P7QA 3THML 1KELL 3DVIA 3HI6L 5E7BA 1WT5C 2C4FU 5GHWH 2UZXB 4I77H 4X6CB 4TUKL 4D9LL 3I75A 1WF5A 4P23B 2AEPL 2EC9T 3MJ9A 5TPWL 3TBWB 3RVVD 2LTQB 4B5EA 5I30L 1DEDA 4YWGL 1WISA 5HGHA 3BKCL 1KCVH 4M9PA 1T6WA 5T1DL 2E27L 3HUJA 4WI4A 3OB0H 4L1HA 5GGRB 1UJ3A 2IBGA 4U1MA 3LRGA 1U8JA 2QJDA 1JGVH 1JFQH 1MVUB 1GZPA 3QQ9C 3BD4A 2RCSL 3QIBA 3ZYZA 4YGAB 4OFYA 4OZGE 1PZUB 1KENL 2NY2D 3U36B 3IU3A 2PYEA 4AH2B 2GTWB 4FQQA 4H8WC 3CDFA 1FNFA 2CK0H 5IESH 1T4KA 4JFHE 3RZCC 3U0TB 5GRWA 4UBDD 4D0DB 3BHBA 5DMJB 5GGVY 5D2NE 3QT2A 2VQUA 3GSNA 4L8SA 1LO5B 3QG7L 2AKRA 1QBAA 2NX5A 5F1IB 1ONQA 3BAEL 4JFHD 4YIQA 3PWPA 5L2JA 2V5RA 5J12B 3GIZH 4NZTH 1UXSA 1HKFA 5F9JA 1NLDH 4L5FH 4LPUA 1G6RA 5KSBF 1TMCB 3IGAB 3ZTNH 4UT6L 5C07A 1AC6A 3VFRB 3X11A 4X6DA 1NLBL 4J6RL 1KCRL 3TBTB 5HGHB 2JB6B 3UTTA 4QGTA 3G6AB 3VRLF 4HUNB 4FXKB 2H2SC 3FQXA 4NKMA 4CMMB 3SJVD 4JM2B 1H5BC 2MQCA 5A16A 1K3ZA 3GSXA 3WO4C 5IHZA 4Z78A 4PJEE 1EGJL 3VXTA 1EJ6A 4WHTB 3FCTB 2SEBB 3M17A 1HXMB 2P5WB 4X99B 3OAUH 1NFDA 5HGAA 3IVKA 5F7FA 2UWEF 3BN3B 5L8KB 4D0BB 3O3EA 2HH0H 5DZLA 2AQ1A 2YWYA 1JPSH 2XICA 3BYYA 3DX8A 5JIIA 3TV3H 1A3LL 4MJ4A 5IQ7H 2IMMA 1SJEA 4QEGA 1CXFA 3KYOB 4XP9H 5DJDB 4DOHB 2PCPA 4LSTH 3DVGB 4ZXBB 2XN9A 4U1KB 6CGTA 2AJXH 3CFJB 4BFIA 1XF3A 4IEFB 4O58H 3L3IB 1D9KA 4OLVL 3MRKA 5LGHL 2E6PA 2F74A 1IGCH 5SWZA 1JNHB 3ULUL 4M8QB 2OCFD 2G75B 3S35X 5GGRA 1QLEH 2GIYA 1PG7H 3VRJB 3VXMA 4LSSH 2OJEB 5IHLB 5JW4R 1CFSA 4DVRH 4F7CA 1P4IH 3GKWL 1CLYL 5IB4B 4O02H 1R3KA 3FRUA 4ZO8A 5CUSH 4Y89A 5E1AA 2C4FT 2J5LC 1A02N 3L3KA 5E8PB 4LLVB 4ONGH 3MODH 3B6SB 2EKSB 4OD2B 3PF2A 4LVNC 3HE6A 3QSKB 3WXWL 5IF0B 2K1MA 1NC4A 3BT2H 1AD9B 1FNEB 3ARGB 1ZLVK 1KEMH 4LNRB 1Y18A 3PWVA 4KC3B 2FO1A 4BQCA 5D2NA 4CADA 3TFKD 4P5TB 5FYKD 2Y06L 4JKMA 4LL9A 3JWDL 3UJJH 2B1AL 3LH2L 1YEJH 1F00I 1UM4H 1NCBH 4K94H 2CKBH 1UWXK 4YXHL 4DGVL 3RVUD 5B39G 43CAA 3TF7C 3QQ3A 1JGLH 3FOMB 1NLDL 1IAKB 1YNTA 1IC1A 4YBHA 1N5YL 1KCSL 3L3DB 1MFAH 4Y19E 5IB1A 1KCUH 2WZPD 4R26L 3DNKA 4GLRI 5C07E 1UGNA 1FNHA 3T0ED 2JLLA 2IG2L 4BELD 4L1DA 1IJ9A 4ELMA 3RWFB 2DRUA 2A6DA 5I0DA 4M43H 1KYOJ 3SDDC 2OZ4L 4EXPX 3MV7E 3DGGB 5D7IE 2LAAA 1Z9LA 3TNNA 3V6OA 3ZE1E 4R4BA 4CMHC 1RK1A 1FVCB 5MENA 1X7QB 2H26B 1LHZA 1RZJC 4O9HH 3V0VA 3M8OL 3LIZL 1OGAE 1BFVH 4JPWH 1QBMH 5KOMC 2EH8L 4PJXF 2O61B 1JV5A 4G3YH 1HHHB 5CJQH 2QQNL 1I1AC 4V1DD 4G6AD 1UZ8B 3BP7A 2BY1A 3L3HA 2VKWA 2X1QA 1V7ML 2UY6A 5DUMH 4P4RB 1G6RB 3IJYB 1WTGT 4XXDB 2FX9L 2GUOA 1AXSB 1J8HA 4RQQA 3WCYA 3MZGB 5CHNA 4M02A 5H37G 4PB9H 2V5TA 4U33A 4HUWA 1A64A 1VFBB 2HWZH 2VDLH 5KJRL 3DI2B 4ODXB 1N2RA 4RMWA 1JZ8A 3H3PL 5EPMA 4Z95H 5GRZA 4EZMA 3FQUB 3L1OL 3T3PF 1F4HA 2NZ9C 4C83B 1FSKB 3O8XA 5GRVK 5HDBE 1P4LB 3QNZB 1WZ1L 1NGZB 2QL1A 1AD0B 1AO7A 4KK5C 4FFVD 1FRGL 3RAJL 2UWEA 4J3XA 4AIOA 2YPLD 3ZKNC 4ZNCD 5KVFL 3ZE0F 3KLDA 2FWOA 3LZFH 4B50A 1ZHLA 4HULB 1UFUA 2V9RA 4DCQB 3JVGA 4U1MB 1I8KA 4Z0BH 4KZEL 4OM0L 2ZOLA 4N0UA 1UA6H 2FZ3A 1PJ9A 4YE4H 2XIDA 5B39B 4KQ3L 1F11B 4ORGA 5FHAH 3MLTB 5F1SA 2AK1L 4WFFE 4D3CH 2EICA 4OIIH 3AC0A 3IYLW 4LSPL 5L9DH 1I8MB 1DBBH 1CQKA 2XPGB 3HC0B 1UA6L 4XP6L 3S88H 4XP5L 4K7FA 4K8RL 4QNPE 5CSZA 3LIZH 2AK4D 3PIQA 1MCSA 1IAIH 3X12A 3UTQA 2JJSC 5C9JA 2E6QA 5BV7B 5EA0H 4Y8DC 3DBXA 4X6CE 1FORL 5D5MF 1ZLUH 5HVGB 4V1DB 4Z9KB 1VHPA 4GJTB 1WZ1H 5L2KB 1A2YB 1S5HA 1ZHNA 2HVJB 1SM3L 2BCKA 4IIQA 5I2IA 1NEUA 2OLDA 5SWQA 1XF1A 3TYGL 4Y1AD 4MD4A 3IDMA 3HR5A 3RL1B 3KDMA 2HWZL 4JPIA 2V5YA 3VFGL 2XRAL 3QHZH 5HDQL 4H20H 4O5LH 5LAXB 1CFQB 4RFEB 4JFOA 3QCUH 4LDLB 4LEOA 3JTTA 4BZ1L 4KJPD 4OFKA 5F7EL 1R5IA 1KJVA 3MRRA 2F53B 3HAEA 3K8MA 3FT2A 4MWFA 3LKPB 4WUUE 4YHYC 2YD6A 4GG8A 4NC2B 5D7JC 3GMLA 1T83C 2HT2C 1IM3A 4HDIB 1OTTD 3QCUL 4RNRA 3QUMH 3ULVF 5T5FH 2NY0C 4JPVL 4MVBD 3BP4A 35C8H 3TFKC 3OG6B 5HI4C 2ADFL 3QWOA 3EDFA 1NC4D 1MH5B 4LPWA 3S34L 1YMME 1VKXA 1T66C 3MV7B 1PLGL 4I0PC 4KZDL 3BMWA 1U93A 3Q2CA 4LQFL 1DBBL 2QSVA 4ONFH 3FAXA 2ZUQC 1C7SA 1J5OH 1CGUA 3TEUA 5J56B 1G7JB 3WUWG 1R3KB 4GSDH 2W65B 4XBEH 2DQCH 4U4BA 4NQVB 3TIDB 1A6AA 3O6FC 4X4XB 1F3DH 3T0EB 2CKNA 4F2MB 5J13C 2PO6B 3GMOB 1CE1L 3ULVC 4ZSOE 4P9HH 3ISWA 3STBA 3QEQB 4R0LB 3OR6A 5EB9A 3MA9H 5CZKA 1PKOA 4NN7C 5EIVA 4KQ3H 1FJ1B 3OKDB 4CW1B 2HRPL 4WI5A 1ERNA 1U3HB 1CGSH 1JNNH 1WITA 4PLJD 5AZ2H 1S7QB 4RIRB 5TE6H 5D2LA 1Z6JT 2EDLA 1NBYB 1PD6A 2EYTB 3MLYH 5HHNB 5T33L 4J1UA 3F58H 1KG0A 3KPOA 4WY7L 3NZHL 1NFDB 4TVPD 3OR7A 4YGVA 3HE6C 5DD5L 5I8KL 2QADC 3MUGA 1AGEA 1PQZB 4DFIA 3GM0A 1UACH 5AAWA 2AJ3A 4DUWA 2CLZA 3WFEH 2DQIL 1T89C 1P4BL 3W39A 3HPLB 4RMTA 5SWZE 1KJMA 3ARBA 2H2SD 2Q7NA 4ERSL 2IFFH 5DJ0B 2XZZA 1WSST 2QLVB 3Q1SH 5C0GB 4F8TA 4PRDB 1GCFA 4MAYB 2Y7QB 3UTTE 2C3HA 3MXVH 1VCAA 3SDXE 3UC0L 1IM9B 4Z76A 3KHQA 4WHDA 2NZIA 4DKDC 3HMXH 5HY9A 5I1IL 2MNUA 3EYSL 5C0DB 4Y5YA 1S7VA 4EJ1C 2I07A 3O6ML 1SEBB 1VFOA 4AMKL 3WO3B 2ENYA 5IR1A 1DL7L 4HWBA 1BOYA 2OK0H 3UJIH 1R3JA 3RVUC 2F8OA 2QHLA 4LVOC 3RWJB 3G5YA 4PRNA 5JIHA 4C54A 4HHAA 1D7FA 3TZVA 5IG7A 1CU4L 2O93L 3QXAB 3HCVB 4OI9A 4B7LA 3B43A 2P44B 2Y36H 5T3XD 3U36A 2R56L 3H7BA 4ZAKD 1K4CB 3GI8H 1ZGLA 5EU4B 3U9UB 1PG7X 3BPOC 1YNKH 1MVUA 1KCVL 5SWSE 3I6LE 4B7IA 3WLWC 2D0FA 1EEUA 1DVFA 3IRPX 3K1KC 4AENA 4U1NA 2DLHA 2HN7B 3GIZL 1EMTH 4K9EC 5L8LB 4ODVH 4GFTB 5JO5B 5EO9A 5DYOA 1SQ2N 5E8DL 5E2TH 4XNMB 5SWZD 2BVEA 3VWJD 3DECA 2CK0L 2VJXA 1VFUA 2DLGA 3QI9A 4KK8C 4U6XA 3C8KA 5E70A 5HI4D 3MJ6A 3VMOA 3FN3A 1L0YA 1Y6KR 3EFFA 3ZDXE 1LWRA 5DRZA 3T4YA 3QDGE 3SDAC 4YXKH 3V6ZB 1S9KC 2XXMB 4PJGB 2P5ED 5H2BA 2VIRB 2YEZB 4AEIH 9CGTA 2GHWB 1KOAA 1MCPL 3ZMRA 2AABL 4NZTL 1T1ZA 3GBMH 3TO4B 3BMVA 4PTUB 1AGFB 1BM3L 4YHMH 4YDLB 3ARWA 3B5GA 3PV6A 1XGYH 3DSFH 1ZLUK 5GZND 4PLOB 2YRPA 2ADJB 3BPLB 4L9LB 3BRDA 2HLFD 4M93C 3K80A 3UAJD 4UINH 4PJFA 2CK2A 3BKMH 4J7RA 1HH6A 1NJ9B 3ARVA 4OD1H 3OXRA 1AO7E 3SDAA 4HIEB 2P8MA 3LN4A 3D2UB 4RGOL 1K5NA 4M7ZB 3K4AA 1R0AL 5CWSA 3T0XA 4U1IA 5GGQH 1HCVA 2ZOLB 4N0UB 1TJGH 4F57L 3S3SA 2LVCA 4OZHA 5FKAA 1MCPH 4TNWK 1F90L 5F9OH 1FIGH 4LHUA 4OCXH 2AV7B 3JWOC 5DJZA 1KB5B 2R0ZH 2VLJD 4WWID 1MELA 4YBQD 1MFEL 1W72A 3BEWA 4ZAKA 5AUMA 1ZANH 4LSQH 3RWGB 1IAOA 4Y5VA 4KKAD 3VFVA 3HNSL 1EGJA 1H15B 5J3HD 1CXLA 1MCFA 1XIWA 3L6FB 4M8VA 5FYLL 1M4KA 5D8JH 2H8PA 1I9JH 3RZCD 5FV1L 5C3TA 1BIIB 3VXPB 3IDNA 2PTTA 3ECBB 5IW3A 5I1JL 1NBQA 5IT2H 1PX3A 2IAND 2Y07H 4G42B 3BZ4A 4BQ8A 2P7TA 3CFKB 3HC3L 3TO4D 2XWBA 4ZMAT 4R2GD 1UWGL 4GKSA 3QA3B 2F8VA 3H9YA 5CINH 1MCJA 3U2SA 1B88A 4XNZC 1ZVYA 3GMNB 5FUOH 2BOCA 2C3WA 1O5DT 5DVKA 4OZHB 1ZGLM 4ZTPL 4X9FA 4QCIA 3W0WD 1I1FA 5F7MC 2Z8WC 3I85A 5D9SA 3QDHA 3U7YH 1G9NH 1Q9OB 1KEGL 3WE6A 1AY1L 4GKOA 1UVQB 4R3SB 4YHZH 3BQUA 2BFVH 5BRZA 2BJMH 2R2CA 1NBZB 2QR0B 3MFGB 1QHPA 5ALCL 2P24B 4NUGL 1XGQB 3DMMA 1R0AH 2CKBB 1H3PL 3IDYB 2MHAB 3BZ4B 3QUYA 1GAFH 3UTOA 2JK5B 2X4OA 4FQCH 1BQLH 4OIIL 5KBNC 3EYQC 4KHXH 3DO7B 1CDIA 4P0DA 2A38A 4XXCA 4RA3A 4HPYL 2HJFA 4FP8L 4BA8A 2Y25A 5EZLA 5KSBE 3WN5C 3VA2C 1UM5L 3C09B 4PJ9D 5CD5C 3JWOL 3V79C 3RPIB 1YC7A 4XP5H 3QEQE 2Q8BH 4I3SL 1IARB 3GIVB 1AD9A 1FNEA 3ARGA 2IPKA 4JREB 5DRZB 2FJHB 3PNWB 1FORH 1S7TA 2FD6H 4OCWL 4OLUL 3ULVD 2GJ6A 1MHPL 4NUJB 4WFHE 1FH5L 2HG5A 3DMMC 2D03L 2EYRA 4NJAL 5AYUL 3RTQD 1KIRA 1JHLH 1K6QL 1N8ZB 4NQSB 3FT4A 2HT4D 4FA8A 4Q6IC 2DYPB 2WQ8A 1S7SB 1XF4B 1TCRA 2R0KL 2D03H 5AYUH 1C12B 3D25B 4NQED 3IDIB 4MSWA 2X2YA 3ROOA 2G60L 3MREB 3FTGB 1NJ9A 1Q72H 5E2VL 5LG1A 3HLAA 1FPTL 3SDXB 5EU4A 3U9UA 5M7QA 2BVYA 1TTGA 4JKPH 4X7CC 43C9B 3KPSD 1D5IL 4JQIL 5F72S 4L9LA 3O9WB 5I17B 1NBVL 4TOYH 2BDNH 5C0AD 4F7EA 4H25A 3W2DH 2JELL 1K85A 3EOAA 5DJDA 2HTKD 1CGTA 4HKZA 5I1LB 4NQUA 1HYSC 3EYVA 1DQDH 1Q0YH 2W59A 5SV4A 4YBLB 5IVXB 2NYYD 4MXVF 1GYAA 2BK8A 1X4XA 2RHEA 4JFQB 3UTZA 4NFCA 3TT3H 4D0BA 3SE8H 1OWRM 1A6WL 1IAII 2FIKB 4XPAH 2AV1A 4OI7A 4NQSA 3O8XD 2DI9A 2EO9A 2OP4H 3IFPA 3H6JA 4XAWL 4JFPB 1BWWA 4MDJA 4MXQD 1ZLSH 3HZMA 4Z7QF 2BNQE 4OCSL 4PJDA 5LWYH 1JGLL 2C9AA 1P1ZB 1MJ8H 3BXNB 5HGBB 2VXTL 1FL5B 4JJ5A 4DEPC 4AEHH 3WHE0 1K4DB 2W0FB 4JN2B 3TBTA 1YN6A 3PQYA 4ORZC 5JDJA 1F13A 5T3XH 1FAKT 4U1JB 2MKWA 1E4KC 3HE7B 4FXLA 4OGAC 4IMKA 5EUOE 3Q5OA 3CK0L 3IGAA 5I73B 2HJFB 2DLEA 4IRSA 1AGDB 3S5LG 2DIBA 4RMQA 4JG1H 5DSCA 3FHAA 2AJ3B 5D93B 5EA0L 2VITA 4DZBB 4JJHA 5C0ND 3LPGA 2O26U 5D1XA 3OZ9H 4JM2F 4KKCD 4EDWH 5BQ7B 1JGUL 1D6VH 3DYPA 4MA8H 3MFFB 2X4NA 3A6CH 3QHFH 3LKSA 4JAMA 4EUPG 1HINL 4D0DA 1IC4L 1QKZL 1N7ML 1Q9OA 5ACMA 4LSVL 1U3HA 2ZUXA 3GO1L 4F7MB 3UP1A 2XQYK 2X4PB 3TCXA 3NFSL 3IU4H 2NTSP 4MYWB 4ZPVA 4LLYA 4R2GB 3QUKA 4FZ8L 4OQTL 4H1LG 2XY1A 12E8L 3I3DA 2EDWA 5I18L 3EO0B 2O5XH 2FNBA 5F97E 4UNVA 4PD4J 5JPMB 1BBDH 1FRGH 1TDQA 5ERWB 4CMHB 3FQWA 4NYLA 3QEGL 4L29B 5E99L 3UX9B 4JAMB 4QOKE 5GISH 4OFPA 1RMFL 1MF2L 5I0ZA 5DMGC 2W07A 1G7HB 4FQXA 2PNDA 3SDYL 4ODHH 3MV11 4K3GA 4XVJH 3GNMH 1NEZA 1MJUL 1OP9A 3MBEB 3MFFA 2BVQA 4P4KD 5EBWA 2VSCA 3H9SD 3HI5H 4TRPH 5EZJA 4HXBH 2ESVB 3C8HA 3FFCA 2DQDL 5DVNA 3F7YA 4Z7WB 4KKBC 1GZQA 5H35A 2DBLH 5I75B 4RIRA 4JHAH 1KB5A 5C8JB 5LKNA 1CCZA 4RGNB 4XCYB 2FEEL 1N3NB 3MRIA 1GGCH 3TJEL 1KXTB 4JM2C 4F7TB 4BYHA 3RJDA 1ZT4B 2VXVL 1BVZA 1YN6B 2OTUA 4G8IB 4JQXC 4RDQG 4F3FB 1NFIA 2ERJB 1OAQL 2ORBH 4GBXB 4MDJB 5F6IC 1HHJA 4I13B 4GKNA 4N8CL 5EC2B 3NGBB 1I8IA 4Y2DB 1CK0H 3BVNA 4LP5A 3CPLA 3IDMB 4LRIA 2IWGA 1QHOA 4PB0L 3WFZA 5HVHB 3UBXB 5EUOA 3DURB 1I9IL 3VFTA 5BOZG 2DTMH 4HUVA 2FIKA 4AMKH 3VMNA 2EE6A 3T1FB 2EIBA 3QJHA 3RI5F 3DUSA 4H25B 4P2OA 3HMXL 4J3WA 3EYVB 1A47A 5DJ6B 3D85A 4OLEA 4XBGA 2XZAH 5F7YC 2D7QA 2ARJA 1JPFA 1YNLL 1N6QH 2X10A 4TUOB 2ILLA 5F7DA 2P8LB 4HS8L 3C09C 3MO1A 5GQBA 4U6XB 4ONHB 2DMKA 4XNXL 4R7NA 4U7SA 1OAYH 3X3FH 5EO9B 3LQMA 3VFWA 4M7JH 2A6JB 4NN5B 2DYPA 4P23D 1MRFL 5E6ZA 4UUJB 4UTBL 5HDLA 2AEWA 3QPQD 3TT1L 4XC3L 5JHLH 4HIJA 1GOFA 4RWYH 3DVFA 3EJYD 5CLTA 3TN0D 1GH7A 1CFTB 1IEBB 1P9MA 1DQJB 4MX7B 2BP3A 3CLFL 5E8OB 5FYJH 1TJIH 4EIZC 1ZGLB 1C8PA 4NNYB 5EU5A 4DGVH 4JN1L 1M7IB 4Z7UF 5I1AA 5FYLE 1JPFB 3OGOE 2IFFL 5JOEA 1FNGB 3CIQA 4WCYH 5IEKA 1EHLH 4I2XA 1G9MH 5TQ0H 1MCEA 4RMVA 4N8CH 2NY1B 3PWJB 2NY4D 2F19L 4MZ3A 3VI3F 5GZOC 1WVZA 4NO3A 4TSAL 2QSQA 2DF3A 4XMPH 3KPMA 5B22A 4FFZH 4K7FB 3ET9F 3S36L 4DFHA 1ZE3C 4GAJH 3CXHJ 5TPWH 2YD1A 1FL6A 1XGQA 5TE7H 4HWZB 5C7XH 4HKXB 1FFPB 3VFSA 2BXZA 4JREC 3UDWA 4QRRE 3NPSC 5C0AA 1VB9A 1EJOL 1UVQA 4BJLA 1FFOB 4WDIB 4Y4KC 3T8XB 5CGYC 3NIFE 1A7BA 3QIWA 2M2DA 3VWKD 5E2WH 1YMMD 5GRUH 3ULUH 3HB3C 5ILTH 3W39B 2DBJA 3L3OA 1IILE 1NL0H 3BX7C 4M03A 4G7VL 2CRMA 4OZ4B 4XPGL 5AYQA 2MPAL 2XZQH 5JHDD 2AJSH 4JLRA 1KB5H 5FHBL 3OAUL 3GGWB 3JWNC 1F4YL 3MUGB 4U49A 1XF5A 4TUKH 1QPPA 4QHMB 4MJ5B 3KJ6L 1R3HA 2IMNA 2YKLL 1L0QA 1PBYA 2WUBH 1A3LH 4GW5A 1KPVB 2EE3A 2DQGH 3CFIC 2XNAA 2E27H 1VEOA 1EMTL 5FO9A 2K7PA 3HI1B 1DQMH 4MJIE 1HZHH 4AT6A 5CJBA 1INDH 3QCVL 4RQQB 4CW1A 3WL9B 3HNVL 3CLEL 3JXAA 5EOCL 3M8OH 3V52H 1AIFA 2NY2C 1NCBL 4JG0H 32C2B 2A9ML 4NO5B 1JHTB 5K93A 1W72B 3KPRA 4N68A 1A6VL 3C60D 4F9PA 1LK2A 1CU4H 5F1NA 4WI3A 2J6EL 1IGMH 4X8JA 2EDBA 5CFHA 3IXAB 2R4RH 1WZMA 1OTUD 1FVCA 5HHMD 3FRUB 3HB3D 5FO8A 4U1IB 2UUDH 4IRJD 4O4YH 3F62A 1I85C 1NCCL 1LDSA 3CFEA 3IKCA 4LFHD 4U1LB 1KJ3H 1U93B 3NA9L 4YHIB 1PDKA 1YDPA 3D2UA 4MLIA 2V6HA 5C2UB 2P8MB 4QY8A 4F7PB 5KN5A 3ZDYF 1MRDH 2WP3T 4JZNB 1J0KA 3CH1A 3OWEA 3RZCB 1FBIH 4CRPA 1Y6MR 1G6RH 2BNQD 1K9TA 3WLBA 5I1KH 4WUUB 2XN9B 3QPXH 2NY7L 4OAWA 4M6MH 1ZTXL 2PCPB 2C1PB 4XBPB 4ODSH 1KB5L 4UNTA 5FDYA 4NCDA 1AHWC 1JHKH 1UQSA 4M3JA 3ZL4L 5C0FB 3HS0B 2XN9E 3OJDB 2VLRA 1AR2A 4JY6B 5FK9A 1NBVH 1RURL 5BVJA 4ZUTB 4ZUSA 4JB9H 2Y1VA 2NY7H 4PRAB 1BFTA 2VERN 3SGDI 4JDTL 4Z77A 2I9TA 1KYOK 4JFZH 2PETA 1RIHL 4JJ5B 2IBBA 5BS0A 1BQLL 3SHSA 4JFOB 3VGFA 1S7XA 4EI5B 3W11D 4R90L 5C0AE 5FYKL 2HLAB 2X7LA 2CLVB 3KYAA 3GMMA 4JZJA 4YDKL 3DX7B 5BW7C 3SGDH 4NKMB 4CMMA 2BFVL 3MYJB 1OM3H 1OD7A 4IS6A 1QRND 3VDCA 3B9EA 4HIIB 3H0TA 5C09A 5FFLA 1G7PB 2W9DH 2NY3D 3O6FA 3OF6D 2A83B 5C0BD 4ZUWB 1W72L 2BSRB 2I9LA 5J1AB 1CG9A 3V8OA 1OGAB 5KVGH 2GKIA 5C0BA 4P5KA 1J1XL 1IE5A 3ULSA 4YAQB 4I8DA 4NKOB 3TV3L 5IQ7L 3ARQA 4S2SA 5F7NC 5HYSB 4BFIB 3V5KA 4HC1A 3KYMA 5F9JB 1UXSB 4PRHD 5IMMB 3HC4H 1IGTA 1UXWA 5GSRA 3RA7L 1HILA 1QNZL 1AXTL 3AROA 4JFDB 4ISVA 2D0GA 4P57B 4X9HA 5MEOB 3LDBC 1C5CL 3O45B 3QQ4B 4PJDF 5T1MA 3ROOB 4CDHA 2V9QA 3K2UL 3QCVH 2YPVL 1I75A 1S3KL 2MSPA 3RVXD 3CMOL 4LAJH 1IBGL 1T6VN 4NHUA 2FCBA 4N90D 4KI5F 3IVKB 3QFJE 2YN5A 3BO8A 1IFHL 1K2DB 4NM4L 5TH2B 2OL3H 4ZFFB 1MCWW 5CGMA 5JORB 3QIBC 2FWOB 3GSXB 5IHZB 3AM8C 3L5XL 5MEPB 1M05A 5CIPA 1EFXB 5T5NF 4Z76B 3AUVA 4KWUA 5FA3A 2AJSL 4Z5RB 3O3DA 8CGTA 5LQBH 1XGTB 4XT1C 1R5WB 3VG9B 5IV2B 3ARBB 4JFEE 5C0GA 3QI9D 2WINB 1N2RB 2JE8A 2D7TL 1U3ZA 5ID0A 5IGXL 1C5DB 3N1GC 3SDXF 4QOKA 1AH1A 1MRDL 5H35B 3F7YB 4Z7WA 5FAAA 3ZYOA 5GJSH 3LMJH 4BSWA 3VD4A 3WS3A 4KTDL 4QRPB 1AGEB 1PQZA 4QRSB 4I18B 4C4KT 3VGHA 5DUBA 2W9EL 1UJTA 2XZCH 5CEZD 3BGMA 2DLIA 3O6LL 3O6KH 1QRNA 3MROA 1DBKL 4WU5A 5BXFA 3CDGB 4OUOA 1EDQA 1U8HB 5KSBA 4U1HA 4XVUD 3VJ6B 5DEGB 3MLRL 2D9QB 4TULL 1NCUA 4NYLB 3MMEB 4N1EA 2X9WA 1JNLH 4QRRD 3V0VB 3MLUL 2W0LA 4GRMA 1FN4B 1RK1B 4OJFH 3HC3H 3L3GB 2IEPA 3F7PC 4PP2A 3A6OA 3IFNH 4U2YA 3MRGB 1ZT7A 4PJIE 1QP1A 1D5IH 2OI9B 1LO0H 4ZS6D 1DL7H 3ARFA 3GB7A 3RVWD 3GKZA 5CJ8A 2Z0BA 5HPMB 2VN4A 3O3BB 4DQOH 3QNXB 3VWJC 3VXSE 5HYJE 4RDQF 3TIDA 3CFKA 4JY4A 3BH8A 1REIA 3NTCH 5ESAA 4WY7H 4F7MA 1JWSA 4G8EA 2M1KA 1TQCB 4LARH 2XWJA 2VLKA 4M48H 1CLZH 4EUPB 3X14A 4OTXH 4PGDA 5C0BE 2ZCHH 5C2BH 5DQDH 4C4KO 1T1WB 2ZUWA 3VXQB 4UAOB 1NCWL 2Z31D 1ZVSA 5C0JB 2R9HC 4J3OC 4WUKH 5GISL 4IRZH 4QXGH 3DETD 5DD1H 5D4QA 1OB1B 4ZNEE 2MKLC 1RIUH 2VH5L 2J8OA 3O0RH 5EBMB 2FEDC 1CFVH 3EO1A 2FGZA 1K8DB 1T2JA 4Y5VB 2EDXA 2K9UA 2G9HA 1EEZB 2KZ1B 2IBZY 4LHJB 3S6CA 3OAZH 1ITBB 1B0GA 3G6JE 2NQCA 2VN7A 2QV2A 4MVBC 5C0NC 2DKSA 2QTEA 1IGIL 1CFNB 3OKLA 4F33A 3UBXI 4OIBA 5INCA 3L3KB 1P2CB 1HYRC 3H42L 4I9WD 4UDTA 2W0FA 3GMLB 2CIIB 2H6PA 3VXMB 2AQ3A 4R4NC 1CGSL 1JNNL 2UVEA 5FV2A 1JNJA 1R5IB 3PGDB 2D4DA 2CIKA 2KL6A 4H0GA 1LEKA 4K3DH 3HMWL 3SDAB 4CN6A 3VWJB 2C7UA 1RFDH 5E4EB 3Q5YA 4RRPG 5IMLB 4JPKH 3MUZ1 4POZD 4NC0B 2R23A 4MNQA 2GCYB 1NFDE 4F37F 2VDQL 5JNYA 3QXWA 3SKMB 3LRHA 4XAKD 4I2XE 4IDLA 2FLRT 3NCBB 4LEXH 4V1DA 2J4WH 3IDJB 2EECA 5EZOH 3DJ9A 3MA7A 5J8OA 2L4OA 1LE9A 2VIRA 4QTHA 2BXYA 43C9A 1BVLB 3L5JA 4U0QB 3SKNB 2UY7A 3RWDB 3S37L 4P2RA 3Q6FA 2NY6B 4PJBE 2IH1A 2DWDA 3SGEH 3QRFM 5DS8A 3GJFB 4MMXC 3BD3A 3BQUC 5T3XE 2AXGB 1BFOB 1FO0L 1N64H 3LRSA 4GUPB 3GHBH 4WFGE 4NSKA 3IJSB 4L8DA 4UOW1 3VXRA 2BNRB 2PYEE 4FXKA 2XRAH 2R2HA 5D1XD 4OLYH 2GTZA 1YNKL 3BPNC 5B39A 4MJID 4UB0L 5ADOL 4LKXA 5IV2A 2KH2B 1RZ7H 4Z5RA 5ANMA 4Q2ZB 1ZLWH 2W38A 4MXQC 3MRLB 4ZFOA 5LVEA 3S8WA 1N4XH 1CD8A 2XQBL 1QBLH 2E8YA 1ZV5A 1KLGB 5D6DA 2XWTB 3REVB 1PZ5A 3AFLA 3GIVA 4MNQD 4GRLA 4KMLB 4M4PA 2VL4A 4W6WB 4HIHB 2R39A 4YIQB 3V2AR 4C83A 4G80B 1GGBL 4PP1D 5E4EC 4JRYB 2WBJB 1MCOH 1B2WL 2HJKB 3NPZB 1VFBA 5D96B 5DD3H 4LDOB 2FHCA 4NO0A 1T1YB 3U46A 4NCC2 4AEFA 3O2DA 1QFPA 3TP4A 3R0MA 2FEDD 3MRBA 1WIOA 4X80H 3QHFL 3MGOB 4N8VG 3BE1L 1WZKA 2QSTA 5FCUL 3E3QC 3MBEC 4P2OC 2H9GA 2PXYA 3MCG1 1EFQA 4P5KB 5TDNB 5AZ2L 2IQAB 1XGUA 2FD6L 4G43B 3FFCD 3FB8B 1MPAL 1T83A 2B1HL 5T3ZH 3CLFH 3KPNB 4APQC 3EZJB 4FQHB 4P3DB 4APQA 3O4OB 4YC2B 1UEYA 3SJVB 2V2TB 4P9HL 5D2LF 4FQXD 4HEME 2WWMC 4UT6H 2AP2A 2J88H 3DPBA 3KR3H 5L0QC 2CLRA 1GGIH 5GXBB 2HLAA 5IB5B 2N7AA 1ZXQA 1HNGA 3MLXL 4EI5A 1YNTB 1A7RL 5GGSY 1VESA 1KLUA 2E6JA 3OQ3B 4HJ0C 4KROD 2WUBL 4FHBD 3MRHA 3VD3A 1YY9C 4I18C 3TA3B 4XWOC 2DLTA 4A2LA 4HGMA 2NLJA 3P77A 1D5MA 4KJYA 1S7WA 3BPLC 4L9LC 4JY5H 4YXHH 1WAAA 3WMSA 3U9PL 3CCHA 4LK4A 1DE4A 3MRFB 2WNGA 3QFJA 1CDUA 4N9GA 2CSPA 3IXTA 1KCUL 1GAFL 3B6SA 3LVEA 3IKCB 4WENB 1WBYB 3RHWK 3RKDC 1JWUB 2EE9A 4UILH 2VLKB 4XNYL 1MUJB 5CWSB 1HOCA 4O51A 4P4KA 4JGMA 3IAQA 3BH8B 5DFTA 4TVPE 2OJEA 4OGXL 3K7UA 5DI8B 4GRWE 1RJYB 2KQMA 1NUNB 1A8JH 4DVRL 2NCMA 5TJWK 5DD0L 5DJXA 3KPLA 1JYVA 2EIEA 4GRMB 5DJ8A 2ZSVA 4DTGH 4EOWH 3PV6B 2CUIA 3GMRB 3REWB 3INUH 2HFFA 3KG5A 1KCSH 3L3JA 4M4RA 2N1KA 1OCWL 3TO4A 3PDOB 5GZOD 3LD8B 5J6GA 1XF2A 3MV9E 4L4TD 3LZFL 5EIIA 4MAUH 4WFHD 5SWSB 3O3EB 5GGRY 4HV8A 4WO4A 2ZCKL 3DVNA 1UM4L 3W5NA 4W6YB 2NY6D 3VXNB 4IHOB 3M17B 4J23A 1S7RB 5FHAL 3C5ZD 2E7HA 4YZFF 2JJUA 4FXGB 3JV6B 5FOBB 4HJJH 1S7UA 3RRQA 4RAUA 3O3AB 3O2VH 3WHXA 3ARXA 1HWGB 2HN7A 4JQXA 4LPVA 4OQTH 5FB8A 1DN0B 2ADGB 2X5PA 2EYSA 4TSBL 3BP5B 4ONGL 3TN0C 3HZYB 3VFPA 3INUL 3WNLA 1CICC 4LGSB 3AXLA 1TVHA 1I3RA 3QPXL 4M1GH 5ISZD 4P2OD 2OZ4H 1DBMH 3W9DA 3RWIB 3PWNB 2P43B 5FM8A 3WEXA 4X4MA 4LSPH 3PIQB 5IMOB 1MRCL 2DM4A 4S0SD 4PG9A 5HXMA 1HNFA 2Q3ZA 4BZ2H 3K81A 5B8CB 3D39B 5C6PB 4OGXH 1IMHC 5F88B 2B0SH 3NCFB 1QFOA 2Y07L 3OHXA 2Q76A 3OJVC 2RAMA 2QQLH 1ES0B 3PWJA 1AR1D 2GITB 5B8CC 3U0TA 4KTDH 1FE8H 1T20B 2AEQL 2IC2A 3EOTL 3FO2B 2I5YH 2V9TA 2YSSB 4UBDC 4AG4L 5DT1L 1R3LA 1IGTB 4KRNA 1J88A 2XN9D 1AXIB 3UJJL 3VRIB 1BJ1H 5EU6A 1NLBH 1UM6H 4IMLA 4J6RH 5C0DA 1T22A 4JPWL 2Q8AL 4HCRL 4NBZB 3SOBL 1RHHA 3B9AA 4FQIH 4YX2H 5C0BB 1EEYA 1KEGH 1NMAH 4N90E 4J2XA 5CSGA 3BH9B 3HNVH 1ND0B 5EOCH 2KZWA 1B4JH 1I9JL 2R1YA 5DRNB 4PJBF 1CN4A 3O11B 4QF1B 4KKLC 3TBWA 1U3JA 2AK4E 2IG2H 2NNAA 2ZNWA 4X6CA 1A7QL 3O3AA 4TRPL 3BESR 4U6YA 3QH3A 3EOTH 4LGPB 1MI5A 1EXUB 2GK0A 3PL6C 4KVNH 4OGYL 3CVHA 1QFHA 4YGVB 1JYXA 2OM5A 3SKNA 2QADD 1OLLA 4PRBB 2GY5A 5EIIB 3MOBL 4KXZI 4D8PB 2GJJA 3O4LA 5F89B 3ES6A 5H37H 4IMKC 3MCLL 2FH6A 1WFTA 2VUOA 4NM4H 5CP3A 1A6WH 4NC1C 4OAWB 1CBVH 2DIAA 3OKDA 4WUUA 4M62L 4X9GA 2EKJA 4WW1B 5A43C 4QHNB 1J18A 3TO2A 2OR9L 5I8CB 4KJWC 3FO0H 1T1XA 4OSUH 4NJ9H 2ZSWA 3MTRA 4RFOH 1AGBB 4UIKL 2J8UA 2O5ZL 1QNZH 5T1KD 3QIWC 3QDJB 4RWHA 4GBXA 3AAZB 3V7MA 4HGKC 2G60H 3FB6A 3Q6GL 4D3CL 4ZUUB 3HAEH 3P4NB 1G7JA 4MCZB 4HMDA 2Q86B 5F1NB 1DEEA 3MGAA 3QPQC 1HK6A 4X9IA 5MP6L 1EBPA 2Z4QB 4JO3L 4KDTA 5JOPE 4TUJB 2A6KB 1K8IB 2X4SB 1DQQA 1E6OH 4JFFA 4FP8H 5D96C 1NAKL 4HF5L 1JNLL 1QBBA 1QSFA 4K2UL 1ZTXH 3BP4B 4KPHL 4H88L 4X5LA 2Z91B 4QKXB 5IW1A 4MDIA 3HI1A 4BM7A 4CNIA 3D87B 5FO9B 4ZYKB 3TH4T 4ZD3H 4L4TB 4NZUL 2XWJB 3HPJA 4QRQB 4Y8AA 2AJZA 3C2SA 4JQVA 2ATKB 4DW2L 2Z93B 3H9ZA 4NJAH 4X6DE 5TE4H 1O7VA 2W9EH 3T77B 1HEZA 4KUZL 1S9VA 1RUMH 2AXFB 1FVDB 2V17H 1EHXA 4KI5C 4TVPH 1E6JH 3QAZC 3MRKB 2OR8A 2NW3A 5I2IB 5IMKA 2HVJA 4XH2A 5ALBL 3MRPB 3WIHH 4HS3A 2GT9B 3MACL 3FKUS 1R3LB 5L2KA 1FO0B 1FN4A 1KTKE 4Z7WE 4XC1L 1FLRL 3MJ8A 2H9GB 1I1YB 1A6UL 5T1LA 1HIML 3CC5B 1RQ5A 5DVMA 5JHDE 3MBED 5HVFB 1I1AD 5C09D 4PJCB 2GSGB 4Z7VB 1DVFD 2ORBL 4OCYH 1IRAY 4X6CF 3WS3B 1Y0LB 3BDBA 1A6UH 3W9DB 3C8DA 4Q0XH 2ZUQB 4HK0A 4UI2A 1C5DA 4OZGA 3GSWA 2E7BA 4PGEA 3RX8A 1BPVA 4JRYA 4FQLL 3HZYA 5I1IH 4L5FL 3QEUB 1FZOB 1QFUH 3T09A 4LOUC 1JF1A 4UU9A 4C58B 3REVA 3D48R 4GOSA 4IOFC 5FO7B 5T3ZL 3P4MA 5D7IB 4ETQB 2HKFL 25C8L 4FABL 3O81A 4FQLH 1TQCC 2B2XL 2A74A 3EYUH 1CXKA 1CZ8H 1G7MA 2DICA 5KVEL 4ODHL 4WO4B 5F7WC 3V6BR 4EN3B 1D5BA 2LU7A 4PREA 4NGHH 5SWSA 3OKNA 1ETZA 5LXGL 2CDFB 2VE6B 1TTUA 5D93C 4P9HC 2HTKC 1CDGA 2DQTH 1IQWL 1MEXH 3P4OA 1YZZA 3F58L 2FLBT 4I48A 4C55A 4LU5L 2Z8RA 1J8HB 4MQXC 3LY6A 1LO4H 1DBAH 3AREB 5EBGA 1GJIA 4P3WA 1FC1A 3V5KB 3RJQB 4KRMB 4Q9RL 3MNZA 2E7MA 4TVSa 3MXVL 1FYTB 3FFCE 4XBGB 1INQB 3ARBD 3RKPA 5TE6L 3TBVA 2MPAH 2XZQL 3DX9A 1NAMB 5DJ2B 1P69B 1KCLA 5BCAA 4UV7L 4K7PY 5E5MB 3JV0A 1EA9C 5DI8A 5CKAA 4GAJL 4Y4HD 3RWCA 2Y36L 5D6DC 3S5LB 5BMFL 1BAFH 3IKKA 4XRCA 1BX2A 3KWWB 4C57C 3BVNB 4HWEH 4Y2DA 4HUXB 3GSOA 1CDHA 3IETB 3LEXA 1G9ML 4JKKA 1YEEH 2UZIH 3TZVD 3W9EB 4NWTL 4PRPE 1JMXA 1S7RA 5E2UL 1L7TL 3B3IA 4WTWA 1DE4B 1S7TB 4WI6A 5KVDL 1JF5A 4NDMA 1D5ZA 1L6XA 4KTEL 4PJ7B 3ARYA 3ZE1F 4Z7UB 4ZQKB 1HHIB 3O2WL 1J0HA 4MA3B 4RX4A 5A2KH 3V9FA 2MFNA 1UB5A 5C0CD 3ZDYE 3V4VH 3NIGF 2YD2A 1KSRA 1FFQA 1RUAL 2QQQA 4LASL 4WEMB 2NY1C 5AG8A 3FFCB 3U4AA 5HYEA 3B5HA 3VE0B 5F1KC 3UPAA 1NCCH 3T08A 4JZNA 2C26A 1MNUL 1ZWIA 1MFDL 2APWA 4HFWB 3I6LD 4NRZA 3NH7L 1RJYA 4XBEL 1IFHH 3B3IB 4WHYH 1DQML 2ICEB 3EBAA 4YBQC 1CDJA 3TVMD 5DJAB 4E5XB 3DETC 3KXFA 4ZPTA 5EORL 1RUML 3KJ6H 4HUXA 2HFEA 1JPTL 1QSFD 5ANME 2AK4B 3MV8D 1Z9OA 1H3XA 1LK2B 5B4MC 4BUHA 3RA7H 4DAGL 4IRSD 3H9SE 4X8JB 3HR6A 3SE9L 5ISZA 2OSLB 4NKDB 4Z7OE 1LQSR 3DSFL 3I6KA 4WVRA 3HFML 3QULA 4PGBB 1SVCP 4DVBB 5CBAA 5JIPA 1LEIA 4G42A 1T0PB 1KLFA 5IOPB 1RZKH 1VFAA 3WL9A 5INDB 2DQFA 4J8RB 2EIDA 4RGOH 3RDTB 3LKSB 4FQJL 5HGGS 2WP3O 3O4LE 1RJCA 3MLWH 4CVZA 4Z0BL 3TIEA 1U8HA 4A6YB 1Q9LA 1P84J 4I9WE 1JHLL 1K6QH 4UOJA 3QDMA 5DFWH 4K55A 4PB9L 4YHPB 2YPLE 5CEXB 3EUUA 1BGXL 1PZ5B 3RUGF 1Z5LB 3KAAA 4XC3H 2R1XB 4M7LH 2QQKL 1BIHA 5DHVH 5J06A 2XV6B 4W4OA 1S78C 1URLA 2BNQA 2WINA 3L3OB 2ADIB 1AC0A 1JPGA 4PV9A 2EIZB 4WTXA 4CVUA 5EFIA 1TETL 5JUEL 3AB0C 3MOBH 3O2VL 2W0KA 1I85A 1WCBA 3KPNA 2VDMH 1BQSA 1BEYH 4PUBH 1OPGH 1S78D 1GOHA 5J57B 4EOWL 4OZIB 2XYCA 3F8UB 3G9VA 4L8CA 3OX8B 3U4BL 4M6OL 3HZMB 2E7LC 1FBIL 1MI5E 3FMGL 4Z7VA 1DBML 1SJVA 4PJCA 1QLEL 4HKXA 1E28A 1FL6B 4WO4D 5HYJD 1B2WH 1BVLA 3M1BA 1DLHA 1S9XA 2GFBB 1N5YH 4NO0B 3SBWA 1NCAL 1XGPB 3EW3B 2VZVA 1JUFA 1QFWM 4XAWH 2YA0A 8FABA 2P48B 3QQ4A 5T1MB 2IFGA 3RWEA 4TYUA 1MAKA 4N0UE 5DVLA 1YUHB 3DRTB 3MBXH 4GRLC 4W70A 4X6EA 4OLXH 1Q94A 3NIDF 1U8OA 1M7IA 5DD0H 2WV3A 5T3XL 4BKLA 4UOW0 2EDTA 1TCMA 4GAYB 3MRCA 4M5ZL 4MX7A 4JZJC 4PJFF 5EN2B 5E08H 3IFLH 3DX6B 3UBXG 3IDIA 4MSWB 1T21A 2CIKB 1MOEA 3MQIA 2XZCL 3PGDA 2FJGA 4LLWB 1U92B 2APTA 1PYWA 2OL3L 2NY5H 2MTPA 5E2UH 3D6GA 1UJ3C 3EZ8A 1G7PA 4ZSOA 1W0VB 2J88L 5EU3B 4I3GA 1LO2L 1SY6H 2ATKA 4U1NB 5E00B 2NY3C 2Z31B 1PLGH 2CDEB 3I02B 2VLKE 3HZVB 3GSNL 1Z0NA 3KPSE 1JZ3A 1MFAL 2EDNA 3BQUD 2ITCA 1W0YT 3QIUC 2GAZA 3RFZC 1MWAB 4MDIB 3K4DA 3RY5A 1GOGA 2QQLL 5KTEL 1MLCA 3KPSB 4O2FA 4F58H 3QIWD 3D85B 4LCWD 5FK9B 3TBYA 5KS9A 4HD9A 1BF2A 4K8RH 4TSCH 1FCCA 4XMLL 4Y1AE 2LV4A 4EEEA 5EZLB 5JNYB 1KIUA 2IANE 5TDPA 4WV1B 2YPLA 3CXDH 5EWIH 3HN3A 1F8TH 5ICYB 2VXQH 1MJ8L 4PYHA 5CILH 3PWLA 4NO0D 1NFKA 2MQ0A 1PW3A 1T7YA 3UYOD 4UQ3A 1F5WA 3ARDB 1W0WB 1J86A 3OX8A 2ICCA 3EHBD 4XX1G 1MF2H 1F8TL 4FFWD 1ZT7B 1IC4H 5HD8D 5F1OB 1RI8A 3BKJL 1KFAL 4QCIB 4HGWB 1DBJH 5EO1B 3VG9C 2MCG1 1S9YB 1ZT4A 4P3CH 4PRIB 4APQD 1GC1C 5C8JA 2FL5A 4URTB 3BDXA 5DQJA 4XMKH 5L2KE 3HE7D 3CSYA 4Z8FH 5KANG 1INEH 3D0VB 4ZO6A 4FMFA 4PJBB 3TBSA 3NN8A 1IL1B 3MXWH 1YEIL 1OQXA 4M6ML 5EZJB 3SEPA 1A1NB 4OJFL 1A3RH 3BGMB 4PY7B 1N7MH 4NQCE 4X7TB 1GGUA 2EDJA 1U8MA 4KRPC 1WWWX 4A6YA 1HHGB 1AGCB 3ZE2E 1CS6A 5DMGD 1DUYA 1JK8B 2CMRL 4P9ML 4Y19B 3CXDL 1XR8A 3EKCA 2YA1A 4UQ2A 3DHJA 4Z7NE 4JFZL 1ZT1A 1A5FL 2FRGP 1MI5B 5HI5D 4XZUB 3QH3B 3V5DA 3OZ9L 2EXYC 3RGHA 4QWWC 1N59B 2Y9RT 4AIZA 2BVTA 5HDQH 5JPMA 3TNMB 4JRYE 1LE5A 1U8NB 1IAOB 4X7EC 4JY4B 1XGTA 3MGTB 5HYIA 1VEMA 2YD9A 1B0RB 4OT1L 4X8XA 5FECB 2F9BT 4Y5XB 4JG1L 3PP4L 3ARFB 4RAVB 4HIXH 5I6XB 1DBAL 5E6ID 2H3NB 1SEQL 5DK2A 4DKAA 3BDYL 3KLHD 2P5EA 3ILQD 3V6FA 2DAVA 4UV4L 3MV8A 4H5SB 3A6CL 2DQUL 1CWVA 1EUTA 1QSED 5F9WB 3O6LH 3ZHKA 4K9EL 3G6JB 4ODWA 4Y19A 2A73A 4B41A 3BIBX 1A4KA 3ZLQC 5HHME 1QRNB 4WU5B 4X7TA 1ZWIB 5F88A 1HILB 3VCLA 3H9SB 1R5VA 3QB7C 5B3NA 5IB2B 4KH2A 4OZHF 5FGSA 5BV7C 3TBSB 5EZOL 1FZMA 5C07D 3N06B 1YEHL 4LEXL 5CP7A 4ZFOL 3BGAA 4TNVK 2OMNA 4KUZH 1YC8A 4HC1H 1UB5B 1YEIH 1OOAA 1HKLL 2WSKA 3PQYB 3MRNA 2NR6D 3TA3D 5SX4I 2F5BH 1S8DB 1QFWL 5L88H 3H0TB 3BPCB 3WSQL 3HAEB 2ZUUA 5I66A 2NY2B 2I25N 2BHUA 5I19L 5ABDE 1KTLA 4PG2A 3IDGA 5LAXA 4NO2A 4GW4A 3TWCH 4PJDB 2E5EA 3AS2A 4G6JL 3GNML 4JQVC 5JO5A 5BW7A 4N0FA 2O5YL 3U30C 1PGRB 4LPXA 5DD6B 4UIKH 2IANB 3BKYL 4YR6B 5JDSB 6FABL 2BSSA 5E2JA 3HE7C 3G6DH 2DN7A 2I60H 4PJHF 2JIXA 4M3KB 1BP3B 4QT5A 2NMSA 3DBXB 3L3JB 2C1PA 4XBPA 3ZT6A 5HYFA 1G0YR 2D9CA 5C9JB 4OCRL 3REWA 5IBUG 5TQ0L 3WN5A 4JE4B 3MLRH 5CZVH 4J3UA 5I16B 1GGBH 1HI6A 2E9IA 5K9QI 5T1DH 2YUZA 2I60L 3ZT5A 3MRDA 2K3TA 5IG7B 3BJLA 5LXGH 4JO3H 4NNXB 1TIUA 2PN5A 3D25A 1I8MA 1E27B 5TE7L 1LEGB 4HX1A 4ZUWA 1S9WA 3IT8D 4YHNB 5E00A 4NHCL 4H0HB 5FO8B 4LU5H 3MLTA 4M1DL 5SWSD 1YPZF 2FATH 4LLUB 3B2UD 5I76A 4JVUA 1JWUA 1UKSA 4N0FB 3RUGA 1RUKH 1WBXA 12E8H 1KIRB 1EHLL 1CLOL 1GL4B 4KK5D 2NTFB 1A7NH 4RAVA 4RISL 4K71C 4Y2DC 2GJ6B 3UPRB 1XGRA 4YQXH 4DGYH 1AD0A 1V8HA 2B5IC 4AEEA 3EGSA 5DZOA 5D72L 1AKJB 5JZ7C 4RGMC 2JCCE 5C0FA 4AT6B 4OZIF 4XCYA 1JUFB 8FABB 2EDRA 2VDOH 3F6IA 3BAEH 4Y4FD 2NY0B 3HMWH 2MQ3A 1YY8B 2X4OB 4YDJA 4U1SB 3FQRA 1J1OL 5ID1B 2DTML 3DO7A 2EEDA 2JJSA 1OT1A 4G6AC 4XXDA 4Y88A 1OAYL 3UMTA 3U0PA 1OT2A 1RUKL 5FYLH 1CD9B 2CDGA 4HWEL 3C9NB 4JHZA 4Y0GA 1F4AA 4ODVL 3UYRL 5IFAL 2XY2A 5D7LA 3SOBH 1QSEE 4OZ4A 2XACC 2O61A 3ZT7A 3MR9A 2YBRA 1YN7A 4IRJC 1YNLH 5CD3B 1BQHG 1A6VH 3O4OC 4YC2C 4LCCA 1EEQA 1I7TA 4LSUL 3GMNA 3BD5A 4R6UA 5JHDB 2I27N 3CFDB 4JM4L 4PS4H 1RPQA 4DGYL 3L7EB 4GKZA 3KPRB 3OKMB 4U6HA 2VQTA 5ENWA 4ZPVB 1U95A 1VEPA 4N1CA 4KTYA 4I77L 1RULL 1RVFH 3ULUD 5IJVA 2ZJSL 5DWUL 4UNUA 2LVEA 4HG4J 2B7DT 5DT1H 2CJUL 2CRYA 2Q7YB 3BZFA 4EI6B 2H8PB 5AG9A 5D1QB 3VGDA 3BKCH 2PTTB 3ECBA 3V5DB 5DHXB 1FLTX 5FGBA 5FYJE 1BLNA 2B5IB 5I1EL 2VXSH 1HSBB 4GMTH 1H15A 3VD7A 5JW4M 1MAJA 4YQXL 4OD1L 4TSBH 3RWHB 3FN0H 4OLVH 3HI6H 1FNGA 1KC5L 1JHKL 4A6YH 5BQ7A 2YK1H 1QSFB 2DL2A 4KGLA 1U8LA 4I3RH 3QISA 1CL7L 1OWWA 5A40E 1W72H 4LPYA 1H8SA 1RVFL 2GAZB 3PV7A 5KVGL 1NMBL 2ITCB 4KVCL 1D5XA 1I7ZA 3DXAE 4PRIA 1MIEH 5IWLA 4IIQC 3FT2B 4NZRH 2VLMD 1MCIA 3KYKL 3PWPD 1CFSB 2YBRB 3IJHA 3PWUB 4AQ1B 1OM3L 5EOTB 3ILPA 2IH3B 2JCCB 2WLYA 2ICEA 2VXSL 4KV5F 2B2XH 4IJ3B 2N4IA 1AGBA 1DR9A 3NIDE 4U05A 5B38B 2NZ9D 3CMOH 3VFMB 1MFCL 2UWEE 3TO4C 4TTDD 3DROA 4G3YL 1FZKA 5HHXL 4JB9L 3B2UC 3I6GB 4WUUD 3NCCB 2AAVA 3U9PH 3TM6A 3U79A 3FN0L 4PTUA 4UAOC 1ACZA 4DAGH 3Q3GB 4P2QB 4X6BA 4V2CB 2R4RL 3O4LB 1HQ4B 2R56H 3QDJE 5C09E 3HNTH 1G6RL 3DX8B 5F21B 4CN4A 2VL5B 1FFNB 5GRVL 5FDWA 3I6GA 1DLHB 2IADA 3KPQA 4BH8B 4Y5VC 3P40A 2D3VA 3SO5A 4X99A 5IFAH 3LAFA 1CTNA 1ADQA 3CAFA 5GS1A 3VXUB 5JHLL 1XEDA 5B38A 1MY7A 1BREA 3DUUA 3NFPA 4LSRH 4PBWD 3QQNA 3LS5L 1CFTA 2DKMA 4YHZL 3ZKMD 5BO1L 4F3FA 1J8HD 1O7SA 4DUXA 3PWUA 5DJYB 1OTSC 2RB8A 3RWCB 3ULUF 2CMRH 3GI9L 3LQAL 5C08B 5F44A 2Y06H 5BZWA 4KROB 2FYYB 1QTYT 3PDDA 3BSZL 1FQ9C 5ESQA 4YE4L 2DIJA 4OM0H 1B0WA 3QFJD 4MNGA 1HI6B 2DWEB 3C87A 2CXGA 4WFFD 5L2JB 3P2TA 1HDMA 4PLNC 2WQRA 1X5XA 3DUSB 3W81A 1TQBC 5KVFH 2D0HA 4DK3A 5CCKL 5JLZB 1SMAA 2H32A 1FNSH 2FX8L 3A0OA 2CUHA 4AZ8A 3G6JA 15C8L 4AL8H 3G08A 3NZ8A 4X0KB 3VFTB 3CVIL 3H3KA 4PJ8C 3JV4A 4U7MA 4EQ2A 1R24A 4DN4L 1MVFA 1NUDA 5I15H 5DURD 3SQBA 5FYKE 1E6OL 5ILTL 3BQUB 2VABA 1TVHB 1OCWH 1NL0L 4XPGH 3TLRA 25C8H 4NPYA 4FABH 1QRNE 1RZGB 3EAKA 1FIGL 4YUEH 3UJTH 1KTDB 4ZOCA 5DJ0A 4PV9B 3NZHH 5LBSL 4FTVA 4O2EB 1E4WH 4XZUA 1PFCA 3ZHDA 4UDUA 4UT9H 4X4YB 3OXSB 1PSKH 3MR9B 4YK4C 4K3JH 1WICA 4PJCE 5GS3A 2CLZB 3JTSB 4MB5A 4P2QE 1X3DA 3G04A 1DSFL 4V1DE 3NACL 5IVNA 2DQJL 2PYFB 4HV8B 1WTLA 1KT2A 4QXTA 1NEZB 5AD0B 5T1LB 1RJLA 4U31A 5DUML 3IDNB 5JOFA 4QRSA 5HHVL 15C8H 4AL8L 2VXQL 4RZCB 2A9NH 3ARUA 3SDCD 4M7KH 1DANT 4PJBA 4PJ5B 2PO6D 5ALCH 3O41A 5HPOA 4HCRA 3R8BB 1T0MA 4LHUG 2EH8H 1RURH 5DZNA 1BVKB 2Y5TB 1G7IB 4YUEL 3UJTL 4HSQA 3H3BC 1VFAB 4CADB 4KI1A 2X1OA 2YZ8A 1YQVL 1S9YA 2ZCLL 3VXRE 3ARDC 5C0RL 4JGUA 4QTIH 2P5EB 1JVKA 1CXHA 2H3NA 3R1GL 4BUGA 2X6MA 2AXFA 1T03L 1F4XL 2VABB 2HT3D 3HZKA 3GMPA 4U7KA 5ISZB 4CVWA 1LMKA 4HIXL 4M7ZC 5IB4A 2AK4A 4PGCA 5ETUB 1WAAF 5DVOA 2VO5A 4M00A 5C6TL 5HHVH 1OAQH 2HMID 3SGJA 1OF2A 5HJ3A 4NQEB 4EDWL 4E5XA 5FGBC 5IVXA 3B9KD 3H7LA 2H32B 4NZUH 2VKXA 4PB0H 2XT1B 3W0WE 5KG9B 5J11B 3MRFA 1A5FH 5FUZH 2XA8H 1NAMA 4PJFB 2R29L 5I17A 4LASH 1OAKH 4JPKL 4L8BB 4JFFB 3QIUB 5IJKC 2XKNB 2DWEA 4WEUD 3P77B 3PP3K 4J4PD 4YEFA 5GPRA 5MENE 3HI5L 3ARSA 3ULSB 2PXYD 5FUZL 2JIXD 4W6XB 1FAIH 1BMGA 1Q9WB 1P84K 1V5JA 2AJVH 3G5ZB 2H45A 5TE4L 4HGWA 1G9EA 2FECL 4KDTC 4LCYB 3DHMA 3TPUA 1T2XA 1FL5A 3HKFA 2VUYA 3ELAT 1NH6A 5DQDL 3WBDA 7FABL 4G6KL 4WHTA 5DD6A 3T0BA 3GUTB 1SM3H 4WTZG 2VRAA 3S97C 3SDDB 1U8KB 1NEZG 3C5SB 3CZFA 5IK3A 4JM2A 4UTBH 5HGDB 3SE4A 2AK1H 3QEHB 4BFGA 3MOAL 1U8IB 3KDMB 4PG2C 4RBPK 1SJHB 2WK2A 1I9RH 1ZEAL 2KPNA 2VC2H 4BZYA 1ZHNB 3FB8A 3MRNB 1A14H 1MAMH 3I50L 3Q3GA 4P2QA 2F5AL 4LKCA 4HXBL 3GK8H 1MLBB 1HYSD 3EOAB 1IGFH 1QBLL 3BKJH 5MI0C 3ZKMC 4KAQH 4HEPG 1N0XL 4MD5A 4Q9CA 4WHCA 3IB4A 1E28B 1H8NA 2X4UB 4UB0H 5ADOH 1MWAA 1NCWH 3OGCB 4OI8A 1LO5A 3RY4A 3HHRB 1KBGH 3QEGH 4GT7A 2VDRL 1F4WL 2ATPA 2WBJA 4NJ9L 3EYUL 1KB9J 3RZWA 1L4IA 2F54D 3WKML 4ONFL 1I8KB 4OB5L 5I1GH 1PYWB 5EFIB 3D69B 3VFUB 3SKJL 3ULUE 3T3PE 1MAML 1A14L 2BNQB 3I50H 3QWQB 1TXKA 2J4WL 4TNWF 5DTFA 4KUCD 1ZHLB 2P5EE 3MRMB 5FO7A 3NOIA 4OLYL 1C5BH 4U1GB 1A1MA 4OF3A 4Y2OA 4Y5XA 2R2EA 3TJHD 3FB7B 4BK4A 5KAQG 2UWEB 2VDQH 4X6EB 2VZ1A 4DEPB 5GS1C 3RDTC 2R2HB 2ZCHL 3ME0A 4EDXB 1CGYA 2BNRA 4NQDD 2YWZA 4PJ9C 4K3DL 3AS0A 1RFDL 4LQ1A 1S9XB 2GFBA 1CFVL 4J8RA 4WW2C 2DQFB 4NQDE 2GSGA 1EPFA 1U91B 4R4FL 5GS0C 5CEYA 5HVWA 1KIQB 1JYWA 3KLHC 4LCIL 5I1DA 2B8OT 5I75C 1J1OH 1I1AA 3SE9H 3QDME 5GHWL 2YOCA 2HTLD 4UMGA 3SDCB 1C5BL 3IDJA 2HT2D 4M6NL 3NCJL 3V8CA 5MEQB 1B6UA 1S7QA 3MLSH 4OGZA 4HXAL 2BMKA 5EO0B 4EXKA 4N8VB 1FC2D 3B9DA 3FQNA 5JR1L 5MENB 1LDPL 3D9AL 2P5WE 5JZ7D 4XVTH 1TTFA 1SJHA 1QLFB 3P0YL 3V5HB 4I4WA 1MFNA 1WJ3A 3BIKB 3DGGA 4WGWB 1K5NB 1TENA 1P7KA 3C5SA 3CZFB 1IKNC 3UJIL 2PW1B 4R2GC 1UKTA 3FQTA 4L4VB 1TPXB 4ZTOH 4XTRD 3ARDA 4MA1B 3WFEL 1C16A 5FM5O 4GG6B 4XP1L 4QXWA 2CRZA 1CE6B 1ZLWK 4G8GA 2HRLA 4AM0A 3K8KA 1BBJB 4L4VE 1KN2L 1SBSH 4LCUA 2D7OA 3LPFA 5CS7A 3G5ZA 4TQEH 2ZCKH 3EOBA 1UZ6F 4QHNA 5T33H 2CJUH 5HBBA 1JZ7A 1FL3A 3RGVB 2Y23A 4MB4A 2B1HH 3MNWA 3SKUD 5DFVD 3SE3C 2BERA 2CQVA 3WFCH 3D3VD 4HT1H 1BD2B 4MNHA 5K9KA 3RWGA 4K3EL 3V6ZA 1K8DA 1P4BH 2QSCH 2R0LL 4ODSL 5FUCC 3ARTA 4OCXL 1UENA 4ZS7L 3W0WB 5IW6A 2IPUK 2ID5A 1A6ZB 1UCBL 4CDGC 4LLVA 2R0KH 1QFUL 3CDYA 1AHWB 3M07A 1HQRB 1OF2B 5HJ3B 4S10A 4F7CB 1P5VA 2WANA 4JDZA 2OI9C 4YO0A 2VNCA 2DS4A 3FONB 4MAUL 4XRCB 5A2JH 1WBYA 2JJWA 4OF6A 1SJXA 2PO6C 4LSRL 3S9DB 4G9FD 5KVEH 5BRZD 3QNXA 3RTQA 3EFDH 1XCTB 4FOMA 2BRRL 1U8PA 1BOGA 5HHPB 4WO4C 4LSTL 3CVHL 4MA1C 3L3IA 3L5WA 2MOVA 4QHKJ 3VFOB 7CGTA 1G1CA 4YHOH 4OFIA 4RGMB 1BD2A 1FYTA 4HS6B 1BGXH 2ARJB 5EU6B 2PYED 4K71B 3WXVL 5FGCE 3DVGA 3L5XH 2P49B 1MHCB 3L95B 3N9GL 4OF5A 4X98A 4D0CA 1N5AA 4YX2L 1QLRB 1GSMA 5H2BB 2BSSB 3MROB 5JDSA 1WC7A 1KLUB 2IANA 4YR6A 1CT8B 3DURA 4Z0XB 3B5TA 1FNSL 2FX8H 3BN9C 5D7LE 3K2UH 2Z92B 5DK3A 4YXLL 4XAKE 2ZUVA 3K46A 3E0GA 3OXSA 4ENEC 4ETQA 3KYKH 3BIKA 1KCRH 1RAMA 3D2UD 3IDGB 3FQXB 1DP0A 4HH9B 2RJMA 4UZGA 5MHSE 1YEGL 1C1EL 5L6YL 4PRDA 4ZFZB 4APQB 1BF8A 1OGTB 3W2DL 3D1MC 2FZ3B 1INDL 4M5ZH 3S35H 1R5WA 3R8QA 2B1AH 2R1WB 1X44A 4PRID 1TZGL 1DN0A 3S3PA 2A0LD 4P49A 5MEPA 2FO4B 2YZ1A 3UTPE 1EEYB 1A6TA 4PJGE 1RU9L 2OS7A 2BSED 5E6IB 3PWPB 1CXIA 3O8XB 1JZ4A 1EO8H 1G7LB 2EYTA 1YECL 3UO1H 1RK0A 4MA7H 3KJ4C 4X0KA 4ZFGL 2EXWD 5K9JH 4E42B 3S88L 4X80L 1F90H 3UZQA 3K8LA 2AJUL 2IPTH 4P46C 3E3QE 4HFUH 3E6HA 2R0WH 4GAGL 3P73A 1BECA 3RDTA 3OHXB 1F2XK 4JFDA 1RK0B 2ED7A 4YHOL 3HAEG 1E0OB 2DL9A 3T1WA 3P11H 1OY3B 2GT9A 1ZS8B 4GRLB 1NGWA 5AWNH 1JN6B 2DJSA 1T5WB 4K7PX 1RZKC 4DN3L 1A1MB 2NW3B 3BN9D 3UZEA 1GIGH 1AKJD 3WEXB 3QUYC 5ESQB 1LP9B 5EOCJ 5E8NA 4NQEE 2W9DL 2VAJA 2WAHA 2EC9U 2AGJH 5F9OL 3U7WH 1Q38A 4XPHH 3C6LC 4LKXB 2VAAB 5CINL 1OSZA 1YMMA 1HOCB 4O51B 3PGFH 1H3VA 3I75B 4Q9QH 5HHMB 1JTPA 4GUPA 4OZGB 3EFDL 4FXGA 1MCNA 1T7ZA 2ZJSH 3WS6C 4CNIB 4P46D 4N9GB 2R69H 5GS1B 2LU3A 4IRJA 1YEGH 5E6IC 2J8HA 4MD5B 3RWDA 3W0WA 4MA7L 5IW6B 4YDKH 2WBWB 1U8MB 4ZUSB 4ZUTA 5GRJL 1QFWI 1WC7B 4MCYB 4NQXA 4PJ5E 1CGXA 4XCEB 2ZZUT 1UQSB 5DSCB 3V95A 2LFGA 4LVOB 1JBJA 3P11L 1T80A 4YBLC 2OL3B 4D0CB 4JDVA 4OQTA 4R97C 4RMUA 4JGJA 4WEBL 3RVXC 1NC2A 3MJ9L 2ZSVB 2Z8SA 1U8IA 3KPLB 3QEHA 1Y18B 3PWVB 1NMAL 3RZCA 5CBEB 4PJ7A 1A9BB 2OZ4A 3PXHA 4DW2H 4KVNL 4YFLF 3HE6B 4OD2A 3GSVA 5ICZA 4U1LA 2RQ8A 3SPVA 3R0NA 4POYA 3NABH 4G6ML 4Q7DA 4OFYD 2FSEA 1HIMH 1I7UA 2XTLA 2NW2A 3HPJB 3IS1X 1J87A 4KUCF 3ROLB 5DRXB 1D5XB 1KBGL 1OGAD 1X6NA 1AE6L 1T0NB 5EO0A 3Q0HA 3QUZA 3STLB 4KMTH 3UTQB 1A22B 2X40A 4ELME 1WIPA 4Y16A 5DO2D 3CFBA 3WUWA 1TQBB 4HPOL 3MGOA 4U1KA 3SDXA 3MJ7B 2VTFA 4OD3H 4TUJA 3TH2T 1FE8L 2AEQH 2AVGA 5E24E 1BQHB 1BLNB 2GK0B 1RZFL 1DEEB 2DJUA 1YPZB 4XI5D 4HG4K 4HJ0D 4K7PL 1DLFL 3SDCC 3LEYH 5F9AC 1TJIL 2VDPH 1BBJA 3EIFA 2CXKA 1R3HB 2L7UA 5K59F 4FQIL 2P5WA 3T2QA 2JB5H 1YMHB 3EYQD 2F53D 3GGWA 5HPMA 3GSVB 2A74B 4CJ1A 2EYRB 3RQ3A 4M62H 4EUPH 4MGXA 2ZWLT 5CSBA 1BJ8A 4NRXA 3QXDA 5HHQB 1QFWH 4PFEA 5DQ9B 1XCQA 5LGKA 2VXUH 3IF1B 5E9DE 2V2TA 3B9KC 4IMLB 1KCKA 1P4LA 3O0RL 1U8OB 3UTTB 5CIPH 3QIWB 5FCUH 5JA8B 3VWKA 2GQHA 1JGDA 5FKPA 4IDJL 4OF0A 1D9KC 1ZEAH 4HKJA 5LCVL 1KV3A 3QRGL 5BZDB 4XCEA 4U1HB 3VJ6A 2UVFA 3SDCA 1FFPA 5FYJD 3VFSB 1JE6A 2Q76B 1LDPH 3D9AH 3Q6GH 3V0WH 5IQ9B 4E42A 2DD8L 1X4YA 1EJOH 1EO5A 1IGFL 3HUJE 1OP3K 4GG6F 1SY6A 3MRBB 3ULUC 1QD0A 2EC8A 5IVZA 4ZAKC 4FTVB 4O2EA 1AP2B 4Y4FA 3UTPD 4L8CB 3UROR 35C8L 5A2FA 3MJ8B 5IEKB 2YD5A 1N6QL 1RV6X 2R1WA 5DUPL 4EDXA 3SGEI 1FGVL 1TZHB 5CJ5A 5J0BA 2GTWA 5BVPH 3BWAA 2H32H 4HS8H 3OSKA 4LGRB 2B39A 3P9WB 3TNNB 2R29H 5IB3A 4HQQL 3NCJH 4HBCH 4RAUB 3JZ7A 3JV6A 3U83A 4NZJA 5MHSD 1XCQB 5ITFB 5C70A 5A1AA 2VYRE 5F7EH 1UJ3B 2C1OA 3CX2A 2DQCL 5DC4B 1R24B 4OFDA 3LKQA 3IRZA 4LAQL 1HZHL 4RFNC 1HEZB 2NXYB 1CT8A 5EPMB 1HSAB 1BIIA 1FYTE 3SKJH 3VXPA 3G6JF 2XG4A 3E6HB 1QPXA 2DYPD 4U3HA 1QLRA 5GGVL 3RVVC 3GJFH 4PJXB 4YK4B 1GRWA 4NNXA 5B8CA 2DWDB 3O9WC 1FVEB 1CF8L 5GGTL 2OTWB 4LCWA 3Q6FB 1F4WH 4H0IA 4MNGB 3L5IA 1LEIB 2A2QT 1H3WM 1Q8MA 1DQLH 4G7VH 3BP7B 3LQAC 1G0DA 5GGSB 3RWIA 2FYYA 3GZKA 3GEWB 3I6KB 3LPWA 3ALWA 5KZCD 2E9JA 2NY1D 1DQQB 5CJXA 2V7NA 3RTQB 2DQDH 4DJMA 3OV6A 4X5WA 3VMPA 5BJTA 1OAKL 2P42B 1OP5H 2FBJH 2NR6C 3TA3C 3UBXA 4X4ZA 1OGTA 4DZ8A 5I8KH 2V7HB 5KVDH 2VQ1A 1JWSB 3FFDA 1N6VA 4G7YH 4Q58C 4ELMB 4GBXD 5EC1B 1M71B 3WO4B 3CSGA 1JI1A 2DQUH 3T0EC 1JNHA 1T2QH 1NFIB 1CLYH 1GGIL 4GRWH 2VMFA 1RMFH 4KK8D 3GMQA 5F3HB 3T65A 3MSPA 3MRGA 4NN6C 4U2ZA 3MRIB 2ADJA 1XR9B 5TF1H 4MXWL 3TA3A 3U0WL 3MMEA 1Q9KB 3OJMB 3QXVA 3CDCA 2HFFB 4HKBB 2FDBP 3GMRA 3W82A 3DROB 1XR9A 4H20L 5CEZL 1AI1H 5KW9H 4LPTA 4GXVH 2XKNA 4LNRA 2IGFL 4E9LA 2X1PA 4JFDE 1NC4B 4NDMB 1KT2B 4QXTB 4QY8B 1V7NL 4GSDL 4KHTH 3WFBL 4TQEL 1C16B 5E9DD 4MQXD 4JCLA 4M1CD 1IQWH 4XWGH 3OKEA 2R9HD 2OMBA 3T3ME 5B3JF 1MCOL 4YJZL 2HVKA 3B9KA 1GXEA 3VGEA 4PGDB 4QHKI 4GRWF 4YNYA 4ZTOL 4EUPA 5FYLD 2VQ1B 4G6KH 4Z7OF 4NT6A 3MV8B 1D6EA 4KROC 3FAWA 3BGFB 2X4TA 2KBGA 4X6DB 3ARFC 1UH2A 2BC4A 3BE1H 1RZKL 2PXYC 4XB7A 5F71A 1IGML 3ZKND 3BI9X 5GGUA 3AY4A 3LS4L 1KN4H 4F9PC 32C2A 4KI5E 3ZYIA 2D7PA 5E8NB 4HXAH 5E5RB 5EULV 5I1DB 4H8WH 3QDMD 4MXVE 2LQRA 1MFBH 1OTSD 3SGKA 3T0DA 2DLFL 1N59A 2OTWA 2PW2B 4JHWL 5D1QC 1NGWB 3RX5A 3RHWF 2PF6A 4PJXA 4ONOA 3RBGA 4CJ0A 3RI5K 2BNRD 4PJ5A 4OCYL 5GGTH 5DR5H 3Q5TA 2X4NB 5HD8C 5FIEA 2LE9A 3QR2A 5CEZE 4AM0B 1ETZB 1J7VR 4G8GB 3S7GA 1D5BB 2DQGL 4PREB 4XNYH 3RKDD 3Q48A 1A21A 4OKVB 5TF1L 4UILL 3FB7A 2CUMA 1Q1JH 1SY6L 4GQPH 3DIFB 2XWTA 1JGEB 4JLRB 4OLXL 2PKDA 4FNLH 1DN2A 3BJ91 3O2DL 4PUBL 4JO1L 4JVWA 5GJTH 5ID0B 5DEZA 1ZANL 2CR3A 3MLPA 4PJ8D 1T03H 1AI1L 3HE7A 4ESKA 1I3RB 2BSRA 3HC4L 3V52L 4K3JL 3VFUA 3WXWH 4P3DA 2NX5E 4JHWH 4WDIA 3NFNB 5L0QB 3LKNB 5C0AB 4NWTH 2APVA 3DYMA 4I0PA 4FQCL 1EFXA 1NANI 1MJ7H 4G8FB 2ZG1A 3LRSB 3GKWH 2WIIA 3VGAB 2ARJQ 5C71A 2CLVA 4GW1A 4PR5A 4U1GC 1ZOXA 2QQNH 5TH2A 1S7XB 4ZOEA 4FQ2H 4EBQH 3VXNA 5BS0B 2RR3A 4V2BA 5T3ZE 3KPOB 3KLAB 4XNQA 3DVNB 2WWKT 4BH8A 1B6DA 3KR3L 2X42A 4LOUD 4YHLH 5CUSL 1I1YA 3P0VL 2MMXA 5EZIL 3SBWC 5C0CA 4X6BB 2GJ6D 3BHBB 1F3JA 4OCMC 5L2KD 5K9OA 2A77H 3E1F1 4PJEA 4JRXD 3WIHA 3UPCA 1MLCB 4IBLT 1QVOA 1GGYA 4R7DB 1KLGA 2YC1A 1RJZA 4KMQA 3RUGB 4F7PA 2MCPH 5BZWB 1FVDA 1IQDA 5ANMB 1C12A 4DN4H 1OW0A 2CKBL 4X5XB 3T77A 3ILPB 2EXWC 4KHXL 2DQEH 4LCYA 1N8ZA 4NOFA 3S3JA 1W8NA 4M6OH 3MYJA 4R90H 2FX9H 1U92A 3WJJA 3IXAA 3DTXB 3GSQB 1EUUA 1H3PH 3SCMB 4FFYH 1YECH 2NY5L 3PDGA 4ZFGH 4PP1C 4O4YL 1M7DA 3MZTA 3LEYL 3NCMA 4XMLH 4BKLB 5IVXE 3HG1B 4J4PC 3U7WL 1U2CA 2YD3A 1A6ZA 4P2RB 4JO2H 3IFNL 3MPCA 4WNQB 2XTJD 3R06A 1G9NL 4GMTL 1XGYL 1UWXH 5FDWB 3I2CL 3BW9A 1IEHA 1JYNA 1HQ4A 4DN3H 1PX4A 2OXGA 1LILA 3HUJF 1RUQH 2ZKHH 5JXAH 1RIVL 2DQHL 4I3RL 2BVPA 4YPJA 2XNAB 2LTQC 2AJYL 5DRXA 2VR4A 4RX4D 1LO2H 4KK6D 1FG2A 1CYGA 5TDOA 3VDBA 2Q7YA 1XH3B 5FF6A 3BZDA 4L3EB 1LD9A 2XKSA 4XC1H 3A6BL 3GMPB 3WFHB 4G8FA 5C92A 2BOBA 4I0PB 2J8UB 3WS6A 3MCKB 3MLUH 2PW1A 4NQCA 3C08L 4NN5C 4WWKA 1G7QA 1T3FB 2AERT 1XT5A 4NP4L 1F4XH 1GGTA 3V5HA 2NY3B 1Q0YL 1P2CA 3MRJA 1A2YA 1S5HB 5MI0B 4RFNB 4WIQA 2VWEE 3C6LA 5BV7L 3H42H 4JKPL 5L6YH 3WD5H 3C9NA 1ED3B 1QO3B 2G2RB 2IF7A 1OARH 4L8BA 3X3GL 3MBEA 5C2BL 5CSZB 1VGEL 4M7KL 2ZOKA 4I18A 5T1LD 2IQ9L 4FQXB 1KIQA 4OB5H 4ZS6C 2APFA 5I1GL 1IKFH 3TIEB 1I7RA 5B4MD 2JCCF 4QOKB 2JKXA 4QHLA 4ODTH 4WTZA 1D9KD 1HH9B 1H3TA 3QUMA 4YPGA 2YUWA 4BQBA 4GW5B 1F6FB 2J5LB 1LO0L 3O11A 4DVBA 5CBAB 5DRNA 1MHPH 4P5TD 3BP6B 5GSVA 4Z8FL 4MHHI 2VDKH 3QUKB 4Q6IA 5J13B 4HMCA 3L7EA 4GKZB 5JIKA 1J05B 5CLWA 1FGVH 5JORA 3Q1SL 4ZFFA 2V17L 2VZUA 2W60B 5DTFB 4LRNL 5DGQA 3CUPB 1AJ7L 4HJGB 3KXFB 2YSSA 4MAYC 1UADC 3ULVE 5D6CB 4HX1B 5FEBA 4POZC 1MCRA 2PR4H 1Q0XH 1Y6NR 4PRHA 1U58A 4G6JH 3U0PB 2P46B 5IMMA 2P8LA 2X4UA 4JFFD 1A7QH 5F7DB 4QXUH 3V6OE 5HHOB 4BSWB 1ZSDB 2QADB 4KJQC 1FNAA 3WSQH 4N0YH 5DJ6A 1ORQB 6FABH 5F3BB 3UTSB 1IZKA 2P45B 5TGBA 3WD5L 5FCSH 4Y16C 5C08A 2JIXB 3EDKA 3T2NH 4Z7QE 4Q9RH 5C6WH 1GIGL 3EGSB 1KELH 1E6JL 4PJ7E 3RY6A 2FECI 4OCLC 5F3HA 3T65B 2AS5M 1WZLA 4G5ZL 1P1ZA 1OQOA 2AABH 1WQVT 5CIPB 5D72H 1J8HE 3RIFK 2C3GA 2X7LB 3U4EA 1OD9A 1UYWH 3MUHL 1ZKAA 1JZ2A 1ZAGA 3JV5A 3S4SA 1CICA 4E0RA 3TN0A 5BOPA 2H6PB 2HMIC 1S8DA 4X5WB 3QUXA 2RCSH 3I3EA 4JCMA 5JLZA 4Y4HA 4GQ9L 1VGKA 2QHRH 5TGBB 3BDYH 4S1SL 2YXMA 1GZQB 4PJDE 3KYMB 1UB6A 2EDHA 4O2FB 5HYSA 2ITDA 3B83A 4RCAA 5EBWB 3QIUA 5D7KD 4PRPA 4LLQA 1QRKA 1EZVY 3QUML 4K23H 5D2NC 3WIHL 5D1ZD 3GI8L 4YFEA 2AEPH 5DF0A 3DV4A 2RFXA 3G5YB 3NAAL 1OTTC 1RZ8A 5DMIH 1CIUA 4CL7A 5E8PA 4YXLH 5I74B 1LGVA 4H8WL 2XXCB 3OKNB 4L29A 4LMQI 3O3UN 4EN3A 1ADQH 4U3CA 2FX7L 5CZXC 5BMFH 1WIUA 1J9CT 1T21B 4BQ6A 1I8IB 3DX6A 2E9BA 3PL6B 4NBYB 1P5UA 2OK0L 2EO1A 4GW4B 3V7AG 4S1RH 3T2NL 4RMRA 4ZUVB 5FA4B 1F2QA 4XMKL 5I6XC 3ARBC 2JTDA 3CCHB 2J2ZA 1U8LB 2A6IA 2F19H 3BPCA 4WJ5B 4KAQL 1T5XB 5JW3H 1UCBH 1S7WB 1I4FB 3FRPG 4ZXBA 3CMGA 2YPKA 4QRRA 3QUMB 4OCRH 4Y4FB 1G7IA 1NAMH 1KF9B 5F3BA 1NKOA 4PJXE 3WNOA 4FQPA 1MHHB 1ZHKB 2YRLA 1I7RB 3S37X 3FN9A 1KPUA 3EOBB 4D9LH 3VXSA 5HYJA 1R3IL 1KG0B 1JL8A 4JRWA 5BXFB 5DEFA 3H9SA 5IEHB 4HMEA 1SMOA 2QR0A 2Y5EA 5IQ9A 1H3GA 1ZVHA 3U0WH 5IROA 3WHE1 3WFBH 4QOKD 3D0VA 5EUKA 4P2CG 2R0LH 5F7KC 4X4YA 3CUPA 4HJGA 3FO9B 2JJTC 5IUSA 2LU4A 2EIZA 5ERWA 2ADIA 1NANH 4LRIC 5JXED 4FQHA 4S1DC 1T3FA 1NGYB 1YN7B 5D1ZB 1DQLL 3IFOA 1XGUB 4UT7H 2XWBB 4F2MA 5TDNA 2DKUA 3MA9L 2CDGB 2VLRE 4X4XA 5FECA 1N0LA 2NPLX 4A2MA 4UQ3B 1FNLA 4OIAA 5E2TL 1VA9A 3P30H 1F42A 2OTPA 3TT1H 1XH3A 4RWYL 1IEAA 3CSPA 5MERA 3SE3A 3KPMB 4ZS7H 4HWBH 2AV1B 4L4TA 2BJML 3L9RA 4WFGD 3LDBB 1CGVA 4ZYKA 5F1IA 2BVPB 1CVSC 3AREC 1GVIA 5EG6C 4G7YL 1MHEB 3MLXH 1EVUA 4FQ2L 4EBQL 2HJKA 4PTTB 5FYKU 5C0EB 4P57A 1MH5A 4ISVB 3TBYB 5KS9B 1WWAX 3C5ZC 3VD5A 3E8UH 5JR1H 5IJVB 4PJIB 4WNQA 1A1NA 3VXOA 4GBXC 3QIBB 1D3CA 1E4KA 1NUFA 4NKDA 1NGQH 3N1FC 5E8OA 2B4CL 4QO1A 4BFEA 1CXEA 2X9YA 3VG0H 1IVLA 5E0QA 1U0QA 2HA1A 3HZVA 3LV3B 3E6FA 3LB6D 3KGRA 3LKOA 1TCRB 4JQIH 3D69A 5JQ6H 2NY4C 3AVEA 2YUVA 1W0VA 1OLZA 4U0RC 1CK0L 5J1TC 3VXRD 3ZE0E 5J6HA 2Y72A 3IFLL 2EXYD 5JPNA 1Q1JL 4HIEA 3IJSA 4L8DB 1AR1C 4PY8J 5C9KA 1S9WB 3EYSH 3DX7A 1M7XA 3C5JA 4R7NB 2FBJL 5FOJA 1CDYA 1P7QB 4LLQB 1RJZB 2YC1B 3VE0A 1NSNH 1QVOB 1J8KA 5DHVA 4M6AA 2IAMD 5F9WC 3GFUA 1FG2B 1QBML 4OV5A 1UB6B 4WW1A 1MFEH 5E56A 3DRTA 2FJFA 1AGFA 2ED8A 5FHBH