2AAVA

Solution nmr structure of filamin a domain 17
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
b'GAMVVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Filamin A
publication title The structure of the GPIb-filamin A complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aavA00
1LD9A 3KR3L 3EYOA 2VNCA 3GJFA 4OD1L 4KDWA 3HMXA 4BKLA 3L5JA 4XX1G 1F97A 4I18B 2IANE 3UYOD 5T5FL 4IRSA 3PJSB 1L0XA 1F4YH 5F3BA 2ITDB 4MNGA 3REVA 5K9QI 2BVUA 1QOKA 2YD6A 3QCVL 1JRHL 1I8LA 1KJMB 1VENA 3A6CH 1FE8H 1MWAH 4H1LB 2R2BA 5E8DL 3RGHA 4C56A 4IMLB 5I1EH 3FHAA 4X4XB 5IUSA 4LF3A 5DMGD 4RGNB 3AAZA 3QZWB 4OCNC 3V4VL 2X4QA 5FGRA 4HS6B 2H2SC 4Y4KA 1LDPL 3DRTB 3H42L 5I18H 3MFGB 4PG2A 1RUQL 2VKWA 1HH9B 1KN4H 5A2LH 3ZYOA 1KG0A 1IAIH 3DI3B 2DS4A 4XPFH 1LK2B 4PYGA 4E42B 3PWJA 1AO7B 2XNAB 4GRLB 1P9MA 3F5WB 2OR8A 4M43L 2VXUL 3ARBD 3RWJB 3RUGF 3VRJA 2ICES 3DX7B 3RUGA 3U30C 1KFAL 5MERA 1D5IL 1YEFH 3DROA 1J1XL 2ICEA 5HPOA 3HG1D 3FOLB 4NN7C 4BZ1L 4F57L 4X99B 4G9FA 5C07A 1T21B 3ILPA 3G6AA 4G3YL 5AG8A 1QQDB 4JRXA 1J9CT 4HH9A 4XP4L 4FXGA 5DK0A 3SDAB 4TSBH 1BJ8A 5IMOA 2R15A 4AEHH 2BRRL 2Y23A 3V7AG 5JW3H 3IS0X 4PB9L 2Y5TA 3MFFB 1A2YA 3BD4A 5CUSL 4LSTH 5F89B 2DIAA 4GBXA 3HZVA 2W9DH 4YBQC 2HJFB 5KAQG 2G5BB 2R29H 4NO3A 1JNLL 1G1YA 4DTGL 1IGCL 1H15A 2H32H 1HHKA 4LVHC 3EUUA 1XIWC 1KCUH 3SCMC 4MCYB 4U2YA 4R2GC 1YZZA 3OJVC 1KB5A 1KJ2A 4HV8A 1AGEA 3QFJD 1CGSH 4P3DA 2R2HB 1AP2B 4XPAH 2QEJA 3FL7A 3IDYC 3OB8A 1A1NA 1YEDA 2OJZL 2W91A 3MNVB 3IU4H 2Q8BL 1LEIB 4KRPC 1A7RH 1CT8A 2ADIA 2YD5A 2WNGA 1U92A 5DQ9A 1S9XA 2EYRB 3WEXB 4EVNA 2J8UF 2ZSVB 4U6VL 1I3GL 4ETYA 3SQBA 1KXTB 2P24B 2P5WA 2YZ8A 4YUEL 2ICCA 5L7XL 3DWTA 3S4SG 1IEBB 2R8SL 1A14H 2IF7A 2A83B 3VCLB 2G75A 1ADQL 4M4RA 3RX7A 5D70L 5E4EB 4JPWL 3QEUB 5EPMA 3I85A 4ODSL 5DSCA 1UYWL 4R96B 4PS4H 3DVNA 4G8GD 2J8HA 1DQTA 3HG1B 4YDLB 4QXTB 5KANI 5B39A 4GSDL 5IFHL 3L3IB 2OZ4A 3ZSTA 1YN7A 5IFJB 5CP7A 1V8HA 1KIRA 3BPLB 1F4WL 1I9JH 1G0YR 2CDEB 4I4WA 4W81A 5D8JH 1INDH 4G8GE 4ELMF 2HFFB 4ELMA 4G8IA 3WDHA 3MLSL 1UCBL 4FXKB 4OSUL 1QPPA 1QFUL 4BH8B 5F9OL 1GGCH 2G60L 1HXMA 1KPRB 1F3RB 1PAMA 1IGML 5C0JA 3DGCR 3E0GA 2AJ3A 1VFAA 5DWUL 2OK0L 4NO2A 2VO5A 1FZKA 4U0RB 4CU8A 1A6VL 3KJ6H 3HC3H 3LRGA 3M1BA 1QLRA 1T3FB 4JLRA 1YMMA 4Y16A 2GCYA 5TQ2H 2K9UA 2KH2B 5IJVA 3QDMA 4JHBA 4Z76B 4LEOB 3QFJB 1L6ZA 4OIAA 4DK6A 3L1OL 5L8JB 5T5NG 3P0YH 2YK1H 1FSKC 4KQ4L 5HHMD 5D1XC 2OTWA 1QSED 2EZ0D 5D7IE 2VXSL 5EWIL 4HUXB 3T3PF 3WFHA 1INEH 1DQJA 1XGUA 3NCBB 4OLUL 4HAFA 2VLRD 5D1ZA 3E3QC 4NKOB 2ZUTA 1QSEE 3EDEA 4OCWH 1DUYA 3B8SA 5C6TH 4JAMA 2QHRL 1MY5A 3QPQD 5E6IC 4MMXC 4NQUA 4U6TA 3INUH 3RVVC 3OKDB 5MP6H 3MLTA 5FKAA 1UWGL 3PDDA 2IPUK 3FO9B 2HAZA 1RZ8A 3EFFA 1NSNL 2Q86A 4HCRH 4AMKH 5J11B 2ENYA 2DYPD 2BNQE 2CLRA 1R5IB 4R4FL 1M71A 1PZ5B 2P42B 4NQDA 1LO0L 5HYJA 3CFEA 2R0WL 2YPLB 1DBMH 3BPOC 4KKLC 1CICD 1JWSA 1JVKA 4JB9H 3B83A 2JELH 5EUOF 5EUOA 2DI8A 3UTTA 4BZYA 4ODUB 1RURL 5HHXL 5LVEA 3MYZA 1D6EB 2EDEA 1EHAA 2DWEA 1RIVL 2X1QA 4G7YL 4R4NC 4OCSL 1MVUB 5I1HL 4D9RD 5CIPH 1FPTL 1YEJL 3MV8B 4D3CH 3WUWA 4L9LB 4ALAL 4GMTH 3ARFB 3OQ3B 1MIML 4NBZB 4GKSB 1DBAH 4D9RE 1JZ4A 1J0YA 1PX4A 3EO1A 3NA9L 5EZIH 3QCUL 1XFPA 4YHIB 1MCDA 1HSBA 5HHMB 1QNZH 4PJ8D 2GKIA 3RVXD 3T1WA 5TE4H 4YXKH 3DUUB 3ES6A 2BP3A 3HB3D 3WE6A 4OCLC 3WHE1 3F58L 5T33H 4PJFE 2JB5L 2VLRB 3VFSB 6FABH 1OAXH 3P9LB 4HKZA 1KPUB 4LLWA 1RPQA 4CADA 3UPCA 2Q7YA 3FQRB 5F8RC 3O0RL 4IRJD 3WMSA 4FQJH 2HKHH 1T1YA 1S8DB 2XTJC 3MOQA 5AUMB 3R06A 3DO7A 3LEYL 4XVSH 2AXGB 4X7EC 3BH9A 1IQDA 1A6WL 4OBRA 3HNVL 3TJEL 5C09A 43C9A 4DQOL 1RD6A 2DYPB 5GS1B 5JHDD 4XZUA 3Q2CA 1GZPA 3MNZA 2ARJQ 3F12B 1GGBH 2XPGB 1FNFA 2DQDH 5IT2L 3W81A 1CICB 5KSAD 2D7OA 3CFIC 3O4LA 4XBEL 5JXED 3FHQA 3TA3B 2VZTA 3C08L 2AK1H 2NX5D 5IG7B 2E7LA 1N0XL 2EDOA 5D7LB 3FO2A 1TETL 2YUWA 4DGIH 1LMKA 1UWEL 3DURB 4PRBA 1S9VA 4NHUB 3UJTH 5DMYA 3VMNA 2NX5E 5I1JH 1YQ2A 4YXLH 3B9KC 1W2KT 5A16B 5GGTA 4LKXB 3CAFA 3PWPD 4JVUA 1ZHBA 5IB4B 1MH5B 3QH3A 1S3KL 5KTEH 2XKUA 15C8H 1MAJA 3PP3H 1S7SB 5IB1B 1A9EB 2DM4A 2V5TA 4I5BA 1Q9OB 4OLXH 5CLWA 4HWBH 3PWPE 5E99H 1X4XA 5BS0A 4P46B 1U8HA 3RL2A 1C12B 3HKFA 3SHSA 4WEBL 2BVYA 1RUPL 3VGAC 1AKJA 2JCCE 3IFLL 2COQA 4X6CF 2EIBA 4XNYH 2DQIH 1TJHL 4XCFL 1FLRH 1RQ5A 3IJSB 4MA7H 1MHCB 4LNRA 1RJCA 2GW5A 43CAB 1FYHB 3VXUB 2VXVH 3FJTA 4U3CA 2RAMA 1I9IH 1XZ0B 3VWKA 3RAJH 5D2LE 2ZOKB 3BE1L 3O11B 2R9HC 3ABZA 4IRJB 4HUUB 3G5VB 5E9DD 4P2RD 2LTQC 4QY8B 2XWJA 3SDCD 2ARWA 4J1UA 1ED3A 4O58H 3BPNB 4XC3H 4L3AA 4LPTA 3O6KL 1GAFH 4NQCB 4RAVA 5E9DE 1N3NA 4JVWA 4PTTB 1RUML 4P2RE 1WBYA 3VFUA 4FQ1L 3CDGB 4P23A 3S5LA 2BDNH 5JHDB 1WAAE 1BWMA 3P77B 2AEIT 3C5SA 4DUXA 3C6SA 2F74A 5KSAB 1U93B 4U0QB 4XMLH 4P2CG 5I1KL 2NY2D 1YPZF 1RJLB 4BK5A 4J3SA 1OQXA 4D8PB 5IWLA 1J1OH 3AREA 2YD7A 4JRYD 3BEVA 1OP5H 3I6KA 4IDJH 3IGAB 3F7QA 4JANA 3S9DB 5DO2D 4XTRC 3MCKA 5E7BA 3ARXA 5SV4A 1RUKL 1LO4H 1I9EA 4JRYE 5HYSG 4WY7L 3IDNA 1FVDA 4J8RA 3TWCL 1A7OL 4X0KB 2BSRA 4IJ3C 3RIAF 2APTA 3AFLA 3X11A 5CP3A 4PJEB 3WIIH 1Y18B 1SBSH 1CK0H 3NIFE 3DYOA 4JDTH 2Z92B 2B0SL 4MAYD 4JY5H 1P4LB 3RI5F 3N1PC 1S9YA 1ZLUH 3LOWA 3PDGA 4Q6IA 3IVKB 2F8OA 3PDOA 4YNYA 1WIUA 3LSOB 2NXYC 5GSVA 4UNVA 3DLQR 5DVMA 3QIBB 5K59F 1N7MH 4LSRH 5D72L 3BGFB 5DJ8B 2VDNH 3OX8B 5FFLA 5HVHC 1IEAA 4GRWF 4N5EC 3LEXB 3DBXA 1K4CA 4TYUA 1P69B 2VL4A 1AXTH 4JY4A 1EAJA 3VA6A 1NGXB 3CDYA 2ED8A 1GIGL 5T1KA 4KUCD 3T0VA 3FZUC 3L3OB 4P59H 5BVPL 3C9NA 1QBAA 4WO4D 4OZ4B 3UC0H 1D9KC 3HE6A 2H41A 2DLHA 2NY2B 2RCSH 5EIIA 3UYRL 5TDNB 1C16B 4PTUA 5EN2B 3VXSD 1UKSA 2PR4L 2X6MA 4G80B 3GMOB 3O3BB 3U2SA 3QXTA 4YZFE 4JPVH 1XGQB 3EJYC 1EV2E 4PGDA 1T6WA 5GHWL 3Q6FA 2N1KA 5L0QB 1RU9L 4OIBA 1VGEH 2BFVH 3ZDYF 4EXKA 4RAUB 2XV6B 3KYKH 5FA3A 2AKRA 3FOMA 4N0FB 3CXHJ 1JV5A 4Y5XC 2IBGA 2A6JA 5DFWH 3SN6N 4W68A 5KVDL 1JI2A 5SV3A 5IHLB 4XCEA 5HDQL 3HUJB 2O5XH 2R1YA 5DJ2B 1D5XA 5DC4B 1UM4L 3W11C 1DE4B 4OZFH 5I66A 4UV4H 4MDIA 5EOQL 2F5BL 3PL6A 4ZS6D 4ZUSA 3SE9L 4WWKD 1BD2B 2Y36H 3MXVH 2FBJL 4Y2DB 1LE5B 1R3HA 1WF5A 4X5LA 5FUOL 2FJFA 4HQQH 4Y19B 1UKTA 4UT7H 4E5XA 1G9NH 3BN9D 3TV3L 2HFTA 3IDMA 3JWDH 5DTFA 3H0TB 2D03H 1J88A 2YS4A 4M1CD 4ZAKC 2BCKA 2OTUA 2E27H 2R23A 2LAGB 1E4WH 1S7TB 4NN5B 1TJIH 1FORH 5B39G 3TLRA 5C0FB 3OKLA 4HIEA 1JP5A 1OF2A 3IRPX 4FQXA 4XPBH 5EIQA 5CEYB 2Y4SA 1HHJA 4APQD 3VG0H 2X7LB 2RBLA 2P8MA 1QR1B 4NRXA 4LHUD 4XCNA 5J9PA 4HUVA 1EHXA 3HS0A 1T1XA 3VXME 2IAMD 1Q9WA 1BQUA 2MPAL 4DGVL 1WCBB 2JE8A 1YC7A 3TO2A 1SEBB 1MRFH 1U8PA 25C8L 3F7VA 4G6MH 3MA7B 3VXSB 1W8OA 3KLHC 1V3MA 2QADC 1D6VH 4RMTA 3D39A 2BHZA 3QUZD 5FDWB 3S97C 4P2OB 3RTQC 1DCLA 4Z7VA 1KCSH 5DS8A 4RMVA 1H3PL 3FMGH 2Q87A 3UZQA 3QQ9D 1DQDL 1MFBH 3ROOA 5ILTH 2VXTH 4XP1H 4YFDB 3QXWA 4DAGL 5DVLA 2IQ9L 3MJ8B 3A6OA 1R5VB 4U1JA 4LU5L 3T2OA 1KOAA 3IJHB 4EBQL 3ECBA 3TPUB 1CFVL 2BK8A 3DNKA 4WWID 5TE6L 1OCWL 1WTLA 4OF5A 5EFIB 3W5MA 2GITA 1IGJB 3CVHB 4G6JH 3QPXH 1CDUA 1CF8L 2DKUA 3U4EB 3DIFB 4GXUM 3N1GC 1CFBA 4Q0XL 3TJHD 4KI1A 4ISVA 3ORJA 1JHKL 4IOIA 1LHZA 1EGJA 5H37H 2A6IA 4TSBL 5SWZD 3GBMH 1VFUA 4ODXB 3TZVB 3D5OF 5J6GB 2BVTA 2W0PA 2WK2A 4LIQH 3QQ4A 1LP9E 1E4KC 2YSSB 3L3KB 5SWZE 1JK8A 3ULUL 5EO1B 1VSCA 4H1LH 4O02H 2GFBB 2OS7A 4GKOA 3OF6D 1I7RB 2O5YH 5I76B 2J4WL 4BFEA 1M7DA 5HTSA 1EEZA 1OD7A 2QV2A 3L95A 3TH4T 5C0RL 2FATH 1OGAB 4MCZA 4EZMA 2DN7A 1TQBC 4BA8A 3G08A 1JMXA 1KTRL 2I25N 2FIRT 2ZUVA 4APQB 3V5DB 2VLKA 4JDVB 1GPOH 4N8CH 1YY9D 2D3VA 2Q1EA 4LHUB 3FFCB 4QHMB 2NZIA 5EBLA 5AD0A 4FTVA 4OFDA 3MJ7A 2Q7NA 5IB3A 1RZGB 1BF2A 5HGBA 2D9CA 3LN5A 4YEEA 4XAKD 1OP3H 2VDQH 3X13A 2FYYA 4GLRI 4S1QH 4J12A 3REWA 4NT6A 5CINL 3L5WA 3VRLF 3V4PL 3HZKB 3WNKA 5IHUL 1FGNL 3MLYH 3ARGC 3CFDB 4HMEA 3QNYB 1HHGA 4NWTH 1A14L 1W0VB 3CFBA 1OARH 1YQVL 2BVOA 2I9TB 3VWJA 3SY0B 4M1DH 1KPVA 1MCSA 4LRNH 5IQ9A 1HEZB 5E2VH 4HIHA 4S1SH 3O3AA 4QHNA 1U3HB 2WBJB 2EDNA 4QRSA 3S7GA 3WSQL 1J5OL 2A6KB 3CNKA 2DWDA 4XPTL 4LSQL 4XX1E 4X6EB 1A6TB 1J0IA 1H3VA 3A6BL 4MGXA 1CXHA 4HUWB 2EYTB 3GI8H 4HGKC 3TT1H 1CFNA 5ETUA 3V6FB 3CX5J 5HDOA 4ZFFB 3HZMA 3ESVF 4J3VA 4BSWB 5FECB 2GAZB 3FT3A 3I3DA 2CR6A 2NY0D 1F90L 1NANH 1MCPL 3CLEL 3MRFA 1NH6A 4KK6C 4EUPA 2H9GA 4H25B 2JB6A 2A38A 3U9UA 1HYSD 1HSAB 4I9WD 1LGVA 4GAFB 3VDBA 2BMKB 3QEHB 3B5TA 5D2NB 4S0SD 3ZE2F 1JGLH 4NKIH 3IJYA 2GJJA 5DJ6B 5C0AA 2VDRH 1UEYA 1S7XA 4P5TC 3QEQD 3ET9F 1YEEL 4I9WE 1G0DA 2P44B 4KZEH 3EGSB 5BOZG 3MJGX 5EUKB 3EO9L 4R3SA 5JPNA 3QEQE 4MJ5A 1EFXA 2IH3A 3GSWB 1WWBX 1UJ3B 5IGXL 1EAPB 1MI5A 4NNPL 3HI5H 2VITB 1ACYL 2VLLA 3TEUA 5I9QC 5I17A 3QI9B 4PJHE 2WINA 4PJGA 5C0IB 2AJUL 1NLDL 5B8CC 3U6RB 1JHTA 5HHPA 3KPRD 3PV6B 3INUL 4YFEA 4QXGL 2Z8VC 1SEQH 1AQKL 1R3KB 4F37F 4E41D 3T4AA 4KQ3L 4YDIH 1WICA 4GG6E 1BHGA 2CK2A 3V9FA 2IADB 4FABL 3C6LA 3KPRE 2X89A 5DR5H 3D25B 4PJDA 1GCFA 3SKNB 1JZ8A 1LEKA 3V7AE 3WO3B 1DBBL 2UY6A 3MOBL 1Q72H 3DI2B 3GMPB 4GXVH 5DJZA 1G9NC 5HGDB 4HXAH 5E8OB 4HEPG 5I1IL 1CDBA 3JWDC 3TYFB 4K94H 2P8LB 4XT1C 1FG2B 2ZUYA 1KCVH 2AJSH 5AYQA 4G5ZH 3VFRA 4WW2B 4F7PB 4Z18A 2OR9H 5B4MC 3FKUS 4MJIA 3SEPA 4X4ZA 2FEDD 1I3RB 3MRNA 5I1DB 2ZUSA 5JORA 2OL3A 2VDPL 5DQJA 4UTBL 3DX8A 5ID1A 1HKLH 2R0LH 2ESVD 5C3LD 1BFOA 3RA7H 3KPSA 4YLQT 3BQUD 1NBZA 5B38G 1H5BC 2MCPH 3NH7L 1K4DB 2PYFB 2VQTA 3BZ4A 4L4VE 4XCYB 5F1SA 4BQ6A 5J1AB 4P57A 2ESVE 1NCBH 4AH2A 4S10A 3SDDA 1KACB 1FLTX 4U4BA 5I73B 5IIEA 4PJ5E 3KPNA 1HCFX 3OKEB 5TE4L 1ZK9A 4LLUB 3D69A 1M7XA 3PGCB 3RPIB 3BPCB 1A4KB 1J1PL 3CK0H 4QF1B 1T22B 1EEYA 2Q6WB 3MRLA 3O45A 3O9WD 4ZUUB 1YDPA 3FB5B 1BEYL 4JHAH 4ENED 4J2XA 5LJYH 1FNEB 5FV1L 2HH0L 4IM8A 5ESQB 5HXMA 3L3JB 4HIIA 4A6YH 4KHTL 3PIQA 3T3MF 3T1FB 5A2KH 4E41B 4X6BA 4I18C 3JUYA 2O93L 4KKAD 4L4TD 1LEGB 2XN9D 2A9MH 4DZBB 1QA9A 3BAEH 1HHIA 4RZCB 4PRHA 3EYUH 3QUKA 1CG9B 1GGBL 5K9JH 2XN9E 4KKCC 1OTUD 1AD9A 5BRZA 2A6DA 3LV3A 4FOMA 5C9JB 1WLHA 4Y2OA 1JIBA 5TFSL 3U4BH 4RGNC 3C60D 1XH3A 3EOYG 3MLVL 1VEMA 4G43B 1UZ6F 3U36B 2AI0H 2GUOB 1WVZA 1AIFA 1I1AB 1S7UA 1JF1B 3IAGC 1A9BB 1MIEH 4K3EH 3UJJH 2FZ3B 3CXHK 2HN7A 1CU4H 2BNRB 3ARVA 4Q9QL 4ZPVA 2X2YA 3LQMA 4OZHE 2YXMA 3KYMB 3SO3B 3P11H 1J87A 1RK0A 3GSVB 4I13B 4CMMA 3N50A 4GRLC 4MX7B 4JM2B 5D1QD 2ZG3A 2P43B 3TN0D 3S34L 1MFAL 1BP3B 1A8JH 4M7KH 3ARDD 3BKJH 3RWDA 7FABH 1CD1A 3B3IB 2QSTA 3PGDA 4MXVE 3PHOA 3PQYE 2PYED 1T03L 4XNYL 3AXLA 3TF7C 3RZCC 4X6FB 5CAYB 4I77L 1OM3L 2VIRB 4XRCA 5CBAB 1GHFH 1I9IL 4C57C 1DVFD 2UVEA 2PYEE 4KRNA 4NN6B 1GGIL 4ZD3L 1PKOA 3AS3A 3QUXA 1NMAL 1B0RB 4Z7WB 4M6OL 5C1MB 3HE7B 1CGXA 4JEGB 1JWMB 3QDJA 4PGEA 5DEGA 4PJXE 4JZJC 3BXNA 4B41A 3VGHA 1OSPL 4OLZL 4L4TB 2AS5M 4ZUVA 1NKOA 2XZAH 5CJ8A 2VH5L 2BDNL 3O8XD 1QFWM 2W60A 4TPRL 2IC2A 2NY6D 1YMHB 4OBSA 1A3LH 1RZIA 2XA8H 5DMGC 1ZLVK 3C60B 1Q8MA 4GS7C 1R0AH 3ROLB 4HJJH 1BFTA 4M61A 4TQEH 4PR5A 1IGFH 4OZHB 1NGPH 3BEWA 1U8QA 2VISB 1TQCB 2YRPA 4LLQB 2YPKB 3OAYK 4WHYH 3RJQB 2C3WA 2FWOB 5HGAA 1BLNA 3OPZL 2F9BT 4MNQA 4RIRB 1NCDL 1II4E 1U8MA 3X17A 3JWOH 4RA3A 5D1QB 3ARBC 5IP4A 3TN0B 5ISZE 1DL7H 3IDXL 2HVJB 4QEGA 1EXUB 1KTKE 4KMQA 3DX6A 1JNHB 2F54B 3KDMA 4YDLC 3RGVD 1Z9OA 3ARZA 2Q8AH 4I0PD 1KTLB 1QSFB 4JN2A 2VN4A 4WDIB 3IDJA 1ZGLA 4QXUH 3CMOH 1D5BB 1MJJB 5C0GA 4N8VG 3BO8B 1DVFB 2DQCH 4LCCC 4JQXA 1PDKA 2WIMA 4P9ML 1NCCL 4OTXL 2YC1B 5DF0A 2XRAL 3B9VA 1P1ZA 1CGTA 3TBSA 2B1HH 3IDIA 4LSVL 2DQEH 4U0RC 2AJZB 1ZWIB 2FB4L 2FO1A 4K94C 1GZQA 4PP1D 2QSCH 3WLWD 3O8XB 1JJUA 3CFCL 3KWWA 3TNMA 2NY1B 4HC1H 4QOKD 4I0CC 1B9ZA 1P7QA 4JFDD 3RNQB 5C08B 3NZHH 4XNQB 2YR3A 2FHBA 3TFKD 5H35B 4ACPA 4QOKE 3V6OE 5D7JD 4JFDE 5EU4B 1NMBH 2G9HA 5IW6A 3FO1B 2D7PA 3MBEA 3QRGL 3QWRD 5INCA 3V52H 5B3NA 3KHQA 4DN4H 3CXDL 5DRWB 1QFWI 4KJWD 2NTFB 5J12B 4BJLA 3OXRB 3HI1B 4KH2A 3D18B 1QPXA 3PWLA 1MUJB 4XI5D 3VDAA 1RULH 5C0CA 5TF1H 2UYLA 1VADB 1WGOA 2EC8A 3FCTA 1HQ4B 2YKLH 4JKLA 3VE0B 1MCKA 1MCJA 4W4OA 5FO7B 3IFPB 5JOFB 1FAKT 4Z8FH 1ADQA 3TNNA 1J10A 2AGJL 1XF4A 3CX5K 4FFYL 4U1LA 4Y5VA 5EORH 3TCLA 4OZIF 3RGVB 4OD2B 2V5MA 3G5YA 2Y36L 1UM5H 2OBGA 1A6PA 1RFDL 4I0PB 3FQWB 2HMID 1HWGB 5K93A 4EQ3A 1KIPA 1QBML 4IMKC 4LPYA 3EOAB 4L3ED 1EZVX 5JA8B 3CIQA 4OLVL 5E2UH 1B4JL 4YXHL 3Q1SL 3VMPA 1JGVH 1AGFB 2V5YA 1CGUA 1OPGH 2GSGB 3JVGC 4L3EE 1BZ7B 1UZ8B 2PETA 3T2NH 4N0CD 4OZGB 1DANT 1VKXA 3IT8D 2KUTA 3IKKA 4Q9CA 5DJDA 3T77A 1INQB 3KXFA 2Y6SD 4IRZH 5DRZA 1GJIA 3NACL 4MJ6B 5E24E 2IFGA 1Q0YH 4KK8D 2KL6A 1BAFH 4QOKB 4YIQA 1H8OA 4C56D 4QYOB 5ALCH 1XGTA 2EZ0C 2JJSA 3X12A 2NY5H 5IVXF 5IVXA 2WAHA 5TPWL 4X6DF 1YECH 4X6DA 3ZE0F 4NO5A 1JN6B 5GRXG 1A1MB 5FOBB 4C56E 1E0OB 3PV7A 3DMMA 5DQDH 4OGYH 1OGTB 4NCC1 2NMSA 1Q94B 4Z5RA 2APBA 1BBDH 3I3EA 3CZFA 4Y4KD 5D6CA 4TVPD 4C55A 1OL0A 4EEEA 3OAUH 3QPQC 3C2SA 4M9OA 3MLUL 5IVZB 4XWOD 1I3VA 5DMJB 3O6MH 3X14B 3AMLA 1IM3B 5E00A 2BC4A 3S3PA 2G2RA 3LS5L 3NFSL 1NC4B 4O9HL 5E5RB 8FABB 2BSTA 2EO9A 4PREB 2FR4B 1KULA 3SGDH 4XP5H 2V2XB 3QPXL 4MZ3A 4JDZA 3TBVB 2P8PA 4XNMA 1F5WA 5BQ7A 1FGVL 2CQVA 3B6SA 3ARUA 1Q38A 3KLDA 1NFDB 2NW3A 2WUCL 4AL8H 4YX2H 4QRUA 5D6DA 4RX4A 2MSPA 3EJZD 4G9FD 2ZJSH 5C07D 3RUGE 1JZ2A 2BZDA 1CICC 2BXZA 1I1YB 4G8EB 3JWNC 4G8FA 4PLKC 4LPXA 3S37H 2ITCA 4IIQA 4XXCA 4M3JA 3DETD 5C07E 1LD9B 3O4OC 1S9KC 1NCUA 2ATKA 3EYOB 3ARWA 3GJFB 1FJ1B 1BIIA 2AJXH 2F19H 1CXEA 4GBXD 4BKLB 4AIZA 3LCYA 1NDGA 3H7BB 3SBWC 5A2IH 4UIKH 4NGHL 4CN1A 4IRSB 2BSSA 5C92A 3M07A 4MNGB 3REVB 1V05A 2EDKA 3BKML 1I9RH 4FQ2L 4KROD 1ORQA 4BELD 4N0YL 3BN3B 1MFNA 4PJ8C 3MXWH 5BOPA 1IFHH 4LF3B 3RVXC 2YUVA 3AAZB 3K1DA 3HB3C 2X4QB 2VDQL 2APWA 5JW4M 2OR7A 3W0WA 4AZ8A 1G7QA 3CVHH 3D48R 3JWOC 4OF7A 5KG9A 3BMWA 4Y4KB 3GKWL 2Q3ZA 3U7YH 1FFOA 1FNAA 4F15B 4IRJC 2ORBH 2P5WD 1UGNA 5I8OL 3BFOA 3VXOA 1Z9LA 1KG0B 2Y5EA 3VI4F 4M1DL 4FHBD 5C2BH 2J8UE 3PWJB 2VLMD 4ORGA 5E2VL 5FM4A 1L4IA 3VGFA 1T21A 4L5FH 3HFML 3VRJB 1QQDA 2VLME 4HKJA 2ICEB 2YOCA 2GEEA 2IEPA 4X98B 4CBPA 4G9FB 5C71A 3GHBH 5KSAC 3G6AB 4OB5H 2UUDK 4OI9A 4JRXB 5JXEC 4HH9B 4FXGB 5DK0B 4PGJA 1N6QH 5IMOB 3GBNH 4PRPA 5DRNA 4PYHA 5J4MA 4KV5F 3NN8A 5EBMA 2AEQH 3HA0A 2Y5TB 4PV8A 3OKKA 1A2YB 5DHVA 1R5WA 3WXWH 3SGEI 2AABL 1KNOB 4MB5A 4GBXB 3HZVB 4H26A 1G7HB 2A77H 3DJ9A 1MJ8L 4NO3B 5JOPE 5FO9B 1H15B 4EI5A 3BSZL 1HHKB 4JM4L 3RHWF 3O6LL 4ODTL 2R2HA 3V4UH 5HHOA 1DQLL 3NIGF 1CTOA 1HIMH 1YMMD 3BKYL 4Y16D 1PD6A 3QDMD 1UA6L 1KB5B 1KJ2B 2FECL 4HV8B 1AGEB 3BHBA 2FGWL 4P3DB 4L8CA 3JTSA 2ZCLH 1YMME 4XAWL 1A1NB 2ZSVA 1YEDB 4G6KH 3RU8H 3ESUF 4U1KA 2NR6D 2YRZA 1CT8B 2ADIB 3EYFA 2Z31B 2FJHA 5D1ZD 4X80H 1UB6A 5DQ9B 3TBTA 1P6FA 4EVNB 3VCLA 5GS0L 5BJTA 3T3PE 3WS6C 3QIBC 4QRRE 3QEUA 4OFPA 4K3JH 2P5WB 4BZ2L 1CXLA 1NGYB 4LKCA 4R96A 3S36H 4ZFZB 5CGTA 2EDBA 3SE8H 1ZVHA 3SDCC 4UTAH 1P4IH 4YE4L 3K0WA 2G75B 2EH8H 4JJHA 4LSUH 2DAVA 4DCQA 3PHQA 4P2QA 1CFTA 4LLYB 5EPMB 2CMRL 2DKMA 5DSCB 1Q72L 2XXMB 4NRYA 1CZ8L 1HE7A 3DVNB 4XCCH 1T0PB 3MJ9H 2GY7B 3A0OA 2W38A 4FXKA 4M5ZH 5FKPA 3T0XA 3SDYH 5I8KH 2HG5A 5CP7B 3ZE1F 5HYJD 3MLPA 1HXYA 1M05A 2ADJA 3IYLW 3BOVA 3V5HA 4I4WB 1A7NH 4J6RH 1OAZH 4ELMB 2Z9TA 2NY2C 2OR9L 4G8IB 4B53A 3UTTD 3BW9A 5KZCD 1OW0C 5HYJE 1XIWA 4NZRH 3RJDA 4ZYKB 4JFFA 3E1F1 1KEGL 5GGQH 1HI6B 4FQCL 2ED9A 3U79A 1SMAA 5EUOE 1I1FA 5C0JB 2HRPH 3QHZH 5JQHC 5EOCL 4DEPB 3KGRA 1IC4H 1KBGH 1IL1A 5DO2C 5L6YL 2AJ3B 1VFAB 2ZP0T 3VFMA 4KAQH 4NO2B 4Z76A 1MRDH 2VR5A 1FZKB 5EU3A 4ZXBB 1ZANL 3D3VB 4DKEL 3M1BB 2NY5C 4JLRB 1C08A 4YHZH 4Y16B 2IPKA 2Y1VA 2X05A 2CR3A 2E9BA 3ZKSD 2GCYB 2NY3D 5IJVB 7CGTA 3QDMB 1NMCB 2AQ1A 2Z91A 3MRIA 2J5LB 4M7LT 1PGRB 1XF1A 5IROA 3BUTA 4M7JL 4AG4H 2OTWB 1LO3H 4HS8H 3U9PH 4MAYC 3WFHB 1DQJB 1XGUB 4NC1C 2XZCH 3P9WB 5C8JA 4ZOAA 3OKDA 4LPVA 1FH5L 2UZXB 2XQYK 4V2BA 4A6YL 4QRPD 1DUYB 3VJ6A 4JAMB 2XQBH 3RWHA 1QBBA 4OCXL 2DD8L 1JE6A 4QRPE 2X1OA 3MLTB 3QEGH 1MFEH 1R5IA 5CEZD 5FKAB 4NN5C 4MHHG 4JQIH 4OCRL 1T83C 4R26H 1KEML 5DHYA 3EFFB 1RZ8B 2Q86B 1W72L 3EYUL 3R8QA 3EYSH 4H0GA 5C09D 3SJVE 2J2ZA 1RV6X 4Z0BL 4YH6A 5JTWA 2BHYA 4ODUA 1M71B 5ECJE 4NQDB 1KUMA 1MCWM 5HYJB 3CFEB 5GRVK 4WO4C 3SE3A 4GQ9L 2VKXA 5ACZA 1JWSB 2E6JA 2AXHA 4U6HA 1H3WM 3LPGA 5EUOB 3UTTB 1MVUA 4OM0L 4JJ5A 3MV8A 4WFGE 4POYA 3CSGA 4L9LA 3ARFA 1BVKA 5JNYB 3SKJL 1NLBL 5BV7L 4MZ2A 4S0TD 1ZTXL 3MCLL 5D1XA 3WUWB 5FYJD 4YHIA 3I75A 5HYIA 5FO8A 1HILA 2DBLH 2VLJA 2BHUA 2ZZUT 2J88L 4P49A 3VGGA 1NBVL 4PJIF 4PJIA 1AC0A 3EO1B 3IETA 3H3PH 4H5SA 5FYJE 3WFEL 4J3OC 5BS0D 4QRQA 1AFVL 4LVNC 5AWNL 2P5EE 1HSBB 2EC9U 2PTTB 4CJ1A 1ETZA 2PCPA 5FGBA 1A7BA 1Y0LA 1P4BL 4ZS6C 3WE6B 4HFUH 2W9EH 3FT4A 4WIQA 4WU5A 4WWKC 1G84A 2GK2A 4KMTH 5DD1L 5DA4A 3LIZL 1S8DA 5DFTA 4JE4B 4HPOL 1Z0NA 3QCTL 4NM4H 4LLWB 1BF8A 2NQCA 4CADB 1J8HD 5FOJA 2Q7YB 3N1MC 3WKNA 3VWKD 4YQXL 3TYGL 4X6CE 4TULH 3BN9C 3O2WL 5C0BA 3WFDL 4P99A 1T1YB 4N1CA 4YHLL 3QA3A 4PJ7F 4PJ7A 3WL9A 2VC2H 4M1CC 2X40A 3R06B 1MVFA 4KJPD 3DO7B 1J8HE 5KVEL 3FQTA 4W4NA 3VRIA 4MDJA 1JYVA 3FONA 3WYRA 3BH9B 4AEIH 3P2TA 5C09B 43C9B 4APQC 3FO0H 3FTGA 4CRPA 1X5KA 1T20A 3DOSA 3NIDF 3MV11 5D7LA 1GZPB 1FZJA 3MNZB 3WIHH 1L6XA 4MA8H 4Q6YA 1R0AL 4HHAB 2IAMC 1S7VA 3O4LB 5H8DA 4KUZL 1VHPA 2X1XR 3LKSA 4UT6H 1MWAA 4OF8A 3E6HA 4R90L 4FA8A 4M93C 4WUUA 4F9PC 2V7HA 4OV5B 4PRBB 3ARED 4JZNA 2W92A 1JGDA 1S9VB 3BJLA 4UAOB 2KDGA 4LBEA 4XMPH 1YPZE 3QUZC 1I7ZB 1A9EA 1Q9OA 1D5MB 2GQHA 1JI1A 3RY6C 3QQ9C 2FEEL 4WGVB 4HPYH 1ZHBB 5TQ0H 3QH3B 2DQTH 2DOCA 2D7TL 4K23H 3SO5A 4I5BB 5GGSY 4JY6A 1QUNA 1A7PH 4KRPD 3C5ZD 5BS0B 4UOW1 5HSFA 1U8HB 2VZUA 3RL2B 3ULSA 3SQOL 2GJ6D 2XG5A 1X7QA 4ZO8A 3TJHC 1YNLH 4QLRA 4WU7A 1AKJB 1E27A 1G7MA 3DSFL 3HMWH 1DBKL 2GJ6E 1TVHA 3P4OA 4LNRB 1ZLSL 4C54A 1B90A 3EOBA 1QLEH 4S11A 2FH6A 4TNWK 5FYLL 3VWKB 2X9WA 1TVBA 1V7NH 5C86A 1IARB 2CKBL 4I2XA 5T3ZL 2XWJB 4BQ9A 5FB8A 4WUKH 1ED3B 4TVSa 4OJFL 4F33B 3ULUF 5K59E 1QACA 4RAVB 2CDFA 4BH7A 1BOYA 1N3NB 1U93A 4MXWL 2CIKA 5T1KD 1WBYB 3VFUB 4GRWE 1ODAA 4HIXH 4D9LH 4P23B 1FC2D 4JFZH 3S5LB 4EIZC 3V6ZA 1YA5A 1PYWB 2GT9A 1YY9C 3MRKA 5FUCE 3UZVB 3C6SB 2E7CA 3U48A 2F74B 2DQHH 3HE6D 3SKOB 1O0VA 2X4SA 1YYLL 1NMBL 4PGZA 4WTXA 3NPSC 4FFZH 1OVZA 4H20L 4UBDD 5CJXA 4YFLI 3MRGA 1X3DA 1DLFL 3AREB 2ERJB 4H1LG 4N9GA 3BEVB 3I6KB 1A5FL 2UWEF 4PRAA 2UWEA 2JLLA 4JANB 1UH4A 3BH8A 5JQ6H 3QZWG 3MCKB 3QFDA 5GRJL 5I1AA 4J7RA 2LAAA 1JZ3A 3GKZA 1JHLL 1JPFA 1P7KA 3IDNB 4QTHA 1FVDB 1WV7T 2HKFH 1SJHA 2OMNA 2BSRB 5EOTA 2Z92A 3VFWA 2QQLH 3ZDYE 4Z8FL 3X11B 2R1WA 4MB4A 1YEGL 1A6AA 1LK3H 4U6YA 1OWRM 1MNUL 3NCJL 3PL6D 5EH1A 3E3QE 1ZHLA 2F5AH 1F58L 4Q6IB 5CD3A 3PDOB 3MV7D 4YNYB 4WW2C 2CXKA 4U1IA 4JFHD 5JOEA 5GSVB 3WBDA 2LVCA 4P5MB 2XKNA 3RKDD 1NPUA 2WM0A 4P9HH 1F45A 2NY0C 3MV7E 3VXRA 2CO6B 4JFHE 3DYMA 4K07A 1JGUL 1IEAB 4Z0XA 1YEHH 2FBOJ 4TRPH 2YXFA 3DBXB 1K4CB 3FRUB 1HYSC 3MV9A 4X4YA 4JY4B 2VR4A 1N5AA 4FQXD 4W6YB 4K3DH 3QP3A 1HH6A 5I73C 5IBTH 2C3XA 3MRRA 4YHMH 4Y4HA 1QP1A 3C9NB 4Z7NF 1E4XI 5CWSA 4PJBE 1PZUB 4RMSA 3F7RA 3HE6B 4IOFD 1C7TA 4P0DA 5IESH 5EIIB 4BFIA 3LMJH 4PTUB 1QR4A 4MNHA 5BXFA 3W2DL 2FX9L 2BJML 3R4DA 5M7QA 3MODH 2DQGL 3D39D 3U2SB 1NGQH 4N0FA 4I0KA 3P4MA 4PGDB 3HC4H 4NSKA 5DVNA 1MJUH 1HINH 4ERSH 1UJTA 2A9NH 3D39E 5GGRA 3CX2A 5FA3B 2AKRB 1ZE3C 3FOMB 1IC5L 1JV5B 2A6JB 2OX5A 2C4XA 4HGMA 2NY4D 4XCEB 2R4RL 3KJ4B 3WO4B 1WBZA 2R1YB 1D5XB 3QJHA 1SVCP 4O00A 4OKVB 5I66B 4MDIB 3MX0A 3PL6B 1KCRH 4ZUSB 4YGVB 4KVNL 2X4NA 4OM1H 4WGWB 3ZHLA 2HWZL 3H0TA 1R3HB 5LGJA 1MJ7H 4X4MA 4LASH 1F8TL 3R0NA 1CFSB 5F7LB 2R0KL 3TO4D 5E1HB 4E5XB 2FEDC 3S8WA 4NOFA 3I50L 3IDMB 4QWWD 1K5NA 5DTFB 3IXTA 2OP4L 5MI0B 5GZOD 5BVJB 5CLTA 3QIWD 2BCKB 2OTUB 2R23B 2X7LA 2EE6A 3BQUC 1N6VA 1TTGA 3GHEL 3SO3C 3OKLB 4HIEB 1BJ1J 4LLDA 1OF2B 4FQXB 5CIPA 1CDYA 1U3YA 1HHJB 1EVTC 2OTPA 2P8MB 4BQBA 3MXWL 5CGYD 4LRIC 4XCNB 5J9PB 1IFHL 4HUVB 5GGTL 4JKKA 4ZSOA 2J6EL 3HS0B 1T1XB 2FNBA 4FTVD 4KTYA 2DB8A 3H6JA 4JGMA 1NAMH 4P2OA 1EJOH 3TO2B 3O9WC 1U8PB 1OP5K 4ENEC 1KGCE 4QT5A 4GAJH 2RJMA 2XWBA 4FTVE 3VG9C 4NN6C 4MAUL 1KJVA 5DMKA 5T1DH 2C4FU 4ONHA 5I71C 4OQTH 1FVCB 1N26A 4M1GL 1R5VA 4UILL 5TE7H 1Z9SA 2VDOH 3IJHA 4Z7VB 5DS8B 3TPUA 1X5FA 3WJLA 4HBQA 5E7FA 1K6QL 3QNXA 1I1RA 5DMIH 3ROOB 3RZWA 2FHFA 2SEBA 1MQKL 3P40A 3VRLE 5EOCJ 2AAVA 4U1JB 4KKAC 5L88L 3MLXH 4CVUA 3ECBB 1I3UA 1FBIH 3GJFH 1MHEA 5J13C 4PJCA 2DTML 5I1CH 2GITB 3KPPA 5IB5A 2NY4B 4EN3B 5DJ0A 1DSFL 2DQUL 1EO8H 1OTUC 1ZLUK 4ISVB 4JVPA 1IAIM 3VFNA 5LG1A 5LKNA 2A6IB 3QXDA 3C60C 3TBYA 5DVKA 3RY5A 1N0LA 3E8UH 4GAGH 1L7TL 4OV6F 3QQNA 3QQ4B 4F7EA 5MEPA 1V3JA 4NJ9L 2IBBA 3FN0L 3SGJC 1BQLL 1A3RH 4F9LC 1JK8B 5M94B 3X3FH 5IFAL 1NAKH 4BUHA 4PJ9A 1OAQH 3V5DA 1IQWH 2DMBA 2FDBP 4J3WA 3WKML 1B6UA 5E8EB 1EEZB 3FFCA 2ADGA 4MCZB 1L9NA 3GO1L 4GRMA 2EIZA 2FD6H 3G08B 5D1QC 5E2WL 5C0AD 3TN0C 3G5ZA 4TVPH 4YHKL 2P49B 4ZFOA 2VLKB 2AXJA 3OR6B 1F3JA 3ARDC 5DUPH 4LSPH 4MQ7A 1I8IB 5EU6E 5EBLB 5AD0B 3CLFL 5C0AE 3RTQA 1KIUA 5F7YC 3MJ7B 3Q5TA 5IB3B 2XG4A 1EFXD 5GRUH 2H6PA 5HGBB 1J0HA 1MI5D 4NOBA 3X13B 2ZCHH 1WT5C 4K7PH 1DVFC 2XACC 5L9DL 2YD1A 3REWB 4NT6B 1ZLWH 4LCWB 1KCKA 3DXAA 5KJRL 3TVMD 5FUZH 4ONGL 1HHGB 4FZ8L 1U3HA 2RQ8A 2WBJA 1P4IL 1ZT7A 3CFBB 3ZKMC 2BVOB 1NCTA 3B9AA 3VWJB 3O41B 3LPFA 3C6LD 1QFOA 2F53D 3IFOA 2X89D 4HIHB 3TM6A 3QG7H 3O3AB 3O2DL 3O8XC 1H9VA 4QHNB 4FQIH 4QRSB 1D7FA 2NY6C 4AYFA 3V6FA 3BVNA 4GW4A 4Y4FA 2F53E 3CH1B 4FNLH 1N64L 1WWWX 4ZFFA 3S3JA 2DWDB 3QDHA 1A7NL 5IW3A 1IM9A 2GAZA 4P9HC 1OAZL 3QRFM 1ZVSA 1CFQA 3OG6B 4KJYA 2XWTA 5ETUB 3L5IA 1CLOH 3L3GB 4JG1L 1KB5H 1FC1A 1KJ2H 4KTDL 4MJID 1AI1H 2MQ0A 5GISL 3NZ8A 3FT3B 4KGLA 1KBGL 4GKNB 5I74B 1J11A 2YD4A 4ZS7L 1C5BL 5DJ6A 4JPIA 4RGOH 3MRFB 1GXEA 3QG6B 3U46A 4EUPB 2H9GB 3PGFH 2JB6B 3U9UB 2HP4A 4KPHH 5D4QA 5DZLA 3H9HA 4KGJA 5EUKA 3O3UN 4R8WL 1LVEA 3GGWA 1IAII 2OSLB 3IJYB 3SDDD 2MCG1 1S7XB 4L9DA 4CJ0A 4NNYA 1YNKH 4YK4B 3EDDA 1BFVL 3RGVC 4R3SB 3ZTJH 4YHOL 2PO6A 2CRMA 3ARGA 4L1DA 5B3JF 4MJ5B 1EFXB 2IH3B 4I0PC 1MI5B 3S35L 4NKMB 5I17B 1T5XA 2R4SH 1VACA 2WINB 4PJGB 2IADA 3OKOB 1DLHA 2OZ4H 1JHTB 4PUBL 5HHPB 1A1OA 3I6GA 4JPKH 4M6MH 1FVEA 3T4AB 1GVIA 4OD3L 4PP1C 1RZ7L 1J18A 1CDJA 3T3ME 4PJDB 5CFHA 3HNSH 3WLWC 4ZFGL 1LEKB 4Z95L 1V3KA 1JNNL 5DJZB 3V6OC 1LE9A 4JHWH 5BRZD 5DYOA 4RFEB 2BY2A 1DP0A 3TFKC 3SE4C 3CUPA 3AS0A 5F7EH 5D7JC 3VFRB 3GSUB 4V2CB 4LSDA 4MJIB 4XCYA 2B4CH 5HY9A 3HNTL 3MRNB 4Y1AA 3BD3A 4JFEA 2OL3B 1UADC 5DQJB 4TNVK 3DX8B 5ID1B 3K2UL 1UZ6E 2BOCA 2ZCKH 4KJWC 1BFOB 3KPSB 3T0ED 1MRCL 1NBZB 5DLML 2EXWD 4QGTA 4X7DC 3BZ4B 4XI5C 3IFNL 3U7WH 5DT1L 4P57B 1MFCL 2QQQA 4AH2B 4MS8D 2IALA 3T0EE 1T2QH 3WN5C 4OT1H 1IGIL 5IIEB 3DUSB 3D85A 2AJYL 2DM2A 1CLZH 1GGYA 4P5KA 1JTPA 3S3SA 3ZT5A 3AMKA 3U0WL 3D69B 3MQIA 1R3IL 3TPKA 2W9EL 4PRIA 3MOAL 5ICXB 4CAGA 4UINL 1EEYB 1ZHNA 4K9EL 3MRLB 3O45B 1F42A 2HMIC 4Z77A 1YDPB 5I6XB 2WWMD 4XVJH 3WS3A 4DGYL 3QUXD 3LHPH 4CU7A 4DZBA 2VC2L 3PIQB 3NCCB 1EGJL 3BWUC 1S7QA 4FP8H 1VCAA 3N9GH 4X6BB 1N4XH 1WFUA 4N0CC 1S7WA 2NZ9D 5LCVH 3V0WL 5D71L 1TZGH 4YC2C 1FZMB 2EDQA 2Y6SC 3WNPA 1KIQB 3IDGA 3LD8B 5C9JA 1QA9B 4M5YH 1EVUA 1HHIB 4KK8C 4PRHB 3G6DL 3QUKB 3T4YA 3WIHL 5H2BA 5CKAA 4G43A 3N85H 1I8LC 4MQXD 5HBBA 4H88L 4YWGH 5BRZB 2A6DB 3LV3B 4YHNA 2NY7H 5F6IB 4ZTOL 2M26A 3T08A 3BZFA 1XH3B 4S1RH 5E5UB 1H5BA 3U0PA 5T1LD 4M62H 4OLYH 1C5CH 1AIFB 1S7UB 2EO1A 5HJ3A 2FCBA 2I9LA 1XF5A 3Q6GL 1FRGH 1ZGLP 3U7AA 4RCAA 4I3RH 4Y4KC 4LMQE 3PWNA 5GRZA 3LB6D 4JM2F 4JM2A 4JG0H 1NCAL 2HN7B 5D93C 4ZPVB 4LQFL 4Y5YB 4XVUD 4XWOC 3D2UA 1OTSC 1MHPL 3PWVA 1T04A 4MNQD 5MEOA 1RJYA 1RK0B 2DL2A 3QULA 5DK2B 2NNAA 2R2CA 4GMSH 1SQ2N 1A7PL 2R69H 3QXAA 3RBSA 1FO0L 3W9DA 4MNQE 3RWDB 1QFWL 1AJ7H 4DN3L 1MFDH 3PGDB 5HI5D 1EMTL 3PHOB 5KVFL 3BP4A 5A1AA 5CEZH 2WP3O 3EJZC 1L0QA 4XBPA 3AXLB 5T3XL 5DXWA 2L0DA 3N1FC 4NQTA 5EO9A 1B2WH 2N4IA 4XRCB 1T1WB 4M8VA 5F72S 1FNSH 3ULVL 3DETC 1H3TA 3DARA 3GBLA 1V7NL 3QUXB 4ODHL 4GBXC 5GQBA 2I60H 5HPMA 1F6LL 1GOGA 3QDJB 4PGEB 5DEGB 1RMFH 3D0VA 4M6NL 5CJOL 5JO5B 5IM7A 3BXNB 1FFQA 1UVQA 3WHE0 2W60B 3BT2L 1JTOA 4R0LB 1L7IH 1PKQE 3QDGA 4U1SA 4KROC 3GSRA 2ZUXA 1AY1H 2YMXH 1RZIB 5F1NA 1ES0A 5I8CA 2ARJA 5FYJH 1WWAX 4G6FB 2JTDA 3ZO0A 2ADFL 5DDHA 3VH8A 3PP4H 4KVCH 4BUGA 5GJTL 3C2AH 1MSPA 1PFCA 5GSRB 5DD0H 3U83A 4PR5B 5I75C 2EE2A 1MY7A 4M03A 3BEWB 5DVOA 1U8QB 1J7VR 1X5IA 1DQQA 5HHNA 3ZYIA 3BKCH 1BM3L 4LARH 4QTIH 5KS9A 1UXWA 4RRPA 5HGAB 1BLNB 2HVJA 4MNQB 1JNHA 2F54A 3K81A 1U8MB 2LFGA 3S98A 5JUEL 4TSAH 1Q0XH 3RZCA 4TSCH 4RMQA 1FCCA 1IAOA 1NDMA 1K8DA 1EDQA 3EHBC 5FGCE 4UDTA 2AEPL 1MJJA 4CVXA 3DX6B 3KDMB 2IANA 4J4PD 3AUVA 5LXGH 1HYRC 2EDTA 2AJVH 3ARYA 3O81A 2MHAA 4Q2ZB 3WV0A 4F58H 5CZVL 4JN2B 5E95B 3IDJB 2HFEA 1ZGLB 1EK3A 5F8QC 4JZJA 4JO4H 4P3WA 4OZIE 4OIIH 1NBYA 1PLGH 3P30H 1IZKA 4NHCH 1VESA 3WCYA 1U8IB 1NCNA 4M7ZB 1P1ZB 1W0WA 4OGZA 4JRWA 4G7VH 3VFOA 4XWGL 1GZQB 1VDGA 4XMKL 4LCIH 5BW7A 5JHLH 1VGKB 4Y16C 4ZODA 3KWWB 4NFBA 5H35A 3TNMB 3GK8L 1NMCC 4TUKH 5EU4A 2B4CC 2J5LC 4K2UL 1P7QB 4OGXH 3QHTC 3OTTA 2NR6C 1IC1A 4XNXL 5F88A 4CW1A 2G9HB 5DUMH 4YHYB 1EIBA 5DD5L 3HI1A 5IW6B 3MBEB 2EDJA 5D1ZC 1MPAL 5CP3H 1A0QL 3DMMD 1GOHA 4LHUG 4KMLB 1NGQL 1Q1JH 4ZQKA 1UENA 5INCB 5IVXE 1EUUA 2B7DT 5ADOL 4X6DE 5FHBL 3M8OH 3ZE0E 4C4KO 1PW3A 1CD8A 4GUPA 3VE0A 4Q9RL 5T1MA 5JOFA 3PWLB 1FAIL 1OAYH 1AGBA 5C0CB 3OV6A 2PXYD 2UYLB 3GRWH 4LAQH 4OD2A 5DD3L 5I15H 3FCTB 3MMEA 2WIIA 4ZOEA 3OAZH 1E6JH 1F6AA 3PXJA 3HLAA 3TNNB 1XF4B 4U1LB 4Y5VB 3TCLB 1TNNA 4GRWH 2FH8A 4LCCA 3MUGA 5GGVH 4RX4D 3G5YB 5D96C 4GFTB 5F96L 1A6ZA 3QJFA 1ZHKA 1XF2A 5MEQA 1TJGL 5FA4A 4KTEL 1F4XH 2ATPB 4I3SH 5DUBB 1KIPB 1PG7L 4NM8H 3F6IA 2Z8RA 3BD5A 2DTSA 3RWFA 5DJAA 2QSVA 1VKXB 5ITBL 5HVWA 3C87A 5DJDB 3BWAA 3T77B 3KXFB 5DRZB 3S88L 4AIXA 4L4JA 2GHWB 4LHJB 1BJMA 3C5JA 3HAEB 2H45A 2NY3C 35C8H 4EI6A 3Q3GA 4H8WL 2UZIL 4M9PA 4JKPL 4YIQB 4WTZG 1Q94A 1C1EL 1XGTB 2EEDA 3X12B 2O61A 2R2EA 1DQML 4NZTL 5IVXB 1E4JA 1Z3GL 3IS1X 4NO5B 3UTSA 3W0WD 3KLSA 3VFGL 3VMOA 1RUAH 3GSQA 3DMMB 1BVZA 5ID0A 3BDYH 4Z5RB 3CZFB 5D6CB 1AO7D 1NC4A 2WUBL 4G42A 1MEXH 4G8GA 3KG5A 4KKBD 2PKDA 5CGMA 2QR0A 3RP1A 1ZS8A 1NFDF 4BYHA 1AE6L 1AO7E 4A6YA 1I85C 2BC4B 5EA0L 1VEOA 4JR9H 1G7IA 1U3JA 2G2RB 2RFXB 5DZNA 3RVTD 2BSTB 1NUGA 3VI4E 4IMKA 4JDZB 5BQ7B 2P8PB 2WWKO 1J0ZA 4XNMB 3B6SB 4WVRA 6CGTA 2C3GA 3ISWA 4LSSH 3SDAD 1BGXH 3N06B 5FCUH 2NW3B 3RL1A 4ONFH 3OJMB 4KI5F 1MCQA 4QRUB 4R7DA 1W72A 1WWCA 3GIZH 4DKFL 1U95A 4NP4L 2B2XH 1FJ1A 1KJ3L 4G8FB 5DHXB 4JQVA 1R24A 4HBCH 4WENB 4N0UB 3RDTB 2R56L 5INDA 1T5WB 2ITCB 3CFJA 2E7LC 4C59B 4IIQB 1NCWL 3H7BA 4PRPD 4XPGL 3LKRA 3PNWA 1TCRA 3OZ9H 4XPHL 2IQAA 2ATKB 1J86A 1BIIB 1JPST 1AH1A 4UAOC 4XVTL 5D7IA 4HKBB 1RIHH 2DLFL 4PRPE 4AIZB 2A1WH 5IJKA 4KV5E 1NDGB 2EH7L 4Z78B 1JPGA 1WZMA 4NQEA 4EI5D 2BSSB 1MAML 1HHHA 5HHOD 2DLIA 4JFXA 1Z6JT 5CMAA 5E0QA 2OYPA 1CR9H 2VR9A 12E8H 1MOEA 1ORQB 3SPVB 2F58L 5HHOE 3WXVH 2A0LD 3VGDA 2ZSWA 2AXFA 2LABA 1N8ZA 3C8KB 3LS4H 3QBTB 3VW3H 3V7MA 5K9QG 4MLIA 3W0WB 1B88A 3MSPA 1G7QB 1HZHH 3WFCH 2BNQA 4D9QD 2RIKA 1J05B 3RVUD 5KG9B 4O5LH 1KN2H 1T7XA 1FFOB 3MROA 1QBLL 3VWKC 3LZFH 4PY7A 1KENL 3VXOB 4D9QE 2J1KA 4NPYB 2DLTA 3W39A 5HDBF 1ULVA 4KJPC 4ORGB 1UH3A 3D1MC 4P3CL 4WI9A 4X98A 5FK9A 1I7TA 2M2DA 3HG1E 4HKJB 5F9DC 1H8SA 1JPTH 2JJWA 1DN0A 5C7XH 1A4JA 4NQSB 1VFMA 4YBLC 4DW2H 4RWYL 4NWUL 1KNOA 2I5YH 4WCYL 5LGHH 5JZ7D 1G7HA 1U6AH 1KYOJ 2IG2H 3O2VL 2K1MA 3VXTA 4PRPB 3JV4A 5DRNB 5FO9A 5IWLC 3NN8B 4JFFD 5EBMB 4PV8B 1N2RA 2EDWA 3DVIA 3OKKB 3AREC 2ERJC 4X7SH 5DHVB 1DFBH 1R5WB 4RGOL 1UC6A 4H26B 1WZ1L 2V17L 1YNTA 1WCQA 4PJFF 4WW1A 4PJFA 4UU9A 1FFNA 3CVIH 2CGRH 3OJ2C 4GW5A 3K4DA 4PJ8A 4EI5B 4JO3H 5IBUB 3DRQA 2H2PD 3MZGB 5HHQA 1F4AA 5HHOB 2HFGH 3FQNA 2OM5A 3ZHDA 3EYVB 4XNUL 4RMUA 3QFJE 4G9DA 5JXAH 3C5ZC 1ZEAL 3BHBB 2Z31A 3THMH 1UM6L 4L8CB 3JTSB 5J6HB 2FL5A 1FIGL 1SM3L 2LU7A 3IF1A 3S96A 4U1KB 5K33A 2FSEB 3X3GH 3GNMH 1NGYA 3EYFB 2FJHB 4ZFZA 1UB6B 3TBTB 2XI9A 2YA1A 3OKNA 3VU2A 5BJTB 1PSKH 4PP2A 2QQKH 3CFKA 4LLYA 5ALBH 4LKCB 4KHXH 1HDMA 1WIOA 4NN7B 4U1GB 1YEIH 1XCTB 1ZKAA 1UB5A 4DVRH 4HF5L 3BUYA 4DCQB 4U1NA 3PHQB 4P2QB 1CFTB 1U58A 5FUCC 2YPLD 3WD5H 2ZG1A 4XNZB 4NC2B 1YY8A 4HAGA 2AV7B 2NX5A 2CKBA 2CUIA 4FZEH 4NRYB 2IFFH 2WLYA 5FKPB 2EE3A 3DPBA 3ZLQC 4TTGA 2YPLE 5DEZA 5D7SL 4EUPH 5HYQA 4ZYKA 2HG5B 1KCLA 2Q76A 1HXYB 1M05B 2ADJB 5AYUH 1HI6A 3V5HB 3FB6A 3HE6C 2DMCA 4OI7A 3IKCA 3T65B 1L9MA 3BRDA 3L5XH 2XZQH 4BQ8A 2I27N 4LVHB 5IQ7H 3BW9B 3VXQA 4HLJA 3N1QC 1IT9H 1XIWB 4J3XA 4UBDC 2VDLL 3SCMB 5BO1H 4ZXBA 3MV8D 4ZOCA 4HK0A 4JFFB 4R2GB 1F6FB 1BOGB 3ARFD 5KANG 1MREH 3D3VA 4N90D 2ZCKL 5EB9A 5IEKA 4BM7A 5EZOL 1I1FB 2JCCF 2X4PA 2JCCA 3R8BB 1IL1B 3MV8E 1QVOA 3VFMB 5I30H 5EU3B 4HGWB 1EO5A 2OQJA 3GJEA 2EDHA 4C58B 1YEKH 3MRPA 5ADPL 1C08B 4NDMA 2IPKB 5D2LF 5D2LA 3IXAA 2W9LA 3AB0C 4MVBD 5B21A 2Z91B 3MRIB 5HHME 1RVFL 1K8IB 4K8RL 3KJ4C 3WO4C 4ODVH 1YJDH 4X83A 5DJYA 1FNLA 4PJIE 5D5MF 5D5MA 3PL6C 1OHQA 5E2TH 5E9DA 4NJAL 1AGDB 3LH2L 2VLRE 4P2RA 3UEZA 5HVFB 2VTFA 3SDCA 2KQMA 2D7MA 5LBSL 2IBZY 1WAAF 2JKXA 1WAAA 3OMZA 4M02A 5C8JB 5CJQH 2UY7A 2FX8L 1MCFA 3VJ6B 4B7LA 3RKDC 1IKFH 5C0BD 1N5YH 3RWHB 1RZJL 1QSZA 2X9YA 1TPXB 5E94A 1IGYA 3Q48A 5MI0C 1TZGL 3QHFH 3LQAH 4FMFA 3ALXA 3NFNA 4OFYA 4KZDH 1BPVA 1ITBB 5F7FA 3A67H 1A6UL 2VERN 5C0BE 1NANI 1MCOL 5DHYB 3FRPG 3BP5A 5AZ2H 4EOWL 4OF0A 4PJ7E 4FQXC 3RVWC 4PLKD 2OL3H 4JFOB 3TA3D 4WRLA 4NZUL 5D7LD 1QKZL 4V1DB 3QIUA 1T7ZA 4KRLB 1NKRA 4M3KB 4KK9D 2DDQL 4KXZI 4FQQB 5ACZB 4HLZG 3ARSA 5GGUA 4U6HB 4IOFC 3NIDE 2FECI 3TT3H 5JNYA 5D7LE 3UPRB 4K71C 1B4RA 4JJ5B 1CBVL 4WUUD 3EFDL 5LQBL 2YPVL 1BFSA 4YR6A 4OCMC 1BVKB 2GK0A 3B2VL 3R1GL 1DBJH 4R4BA 1TENA 1S5IL 5A43C 1I8KA 1DN2A 1FSKB 4YHPA 4P46D 5D1XB 3AY4A 1KC5L 4JGJA 3I75B 4PFEA 5FO8B 4GMSL 1HILB 4LEXL 5KW9H 2VLJB 2PTTA 4KDTA 1WBXA 3V0AC 3JV0A 4EDWH 3OL2A 2QKIA 4PIRF 4PJIB 3GI9L 4H5SB 3IETB 3HCVA 5F9AC 2NY4C 4QRQB 1E6OL 4M48L 2KQNA 1ETZB 3VXUD 1W0YT 2PCPB 3UTPD 4XP9L 1Y0LB 4OKDA 3FT4B 3NCMA 4WU5B 1F02I 3MA9L 3HPLA 3MREA 4OF6A 3VXUE 5J56B 2LU4A 3UTPE 2DQJL 1MCNA 4KY1H 4JCMA 4F3FA 2KKQA 3TO4C 4NQCD 4RDQF 3HI6L 3PE9A 5C0BB 4QWWC 3MLZH 3QA3B 4PJ7B 3VGBA 3WFBH 3LRHA 4JZOA 3WL9B 2K7PA 5GZOC 5ICZA 3QIWC 1NL0L 4NQCE 4WO4A 3FQUA 1S9WB 3FQTB 3VRIB 3ULUD 4MDJB 3D6GA 4KWUA 3FONB 1IAMA 2DJSA 2HRLA 1L7IL 4HHAA 4I48A 5JHDE 4EIGB 2CJUL 3K74B 3FTGB 3MBXH 1T20B 4HT1L 1FZJB 1G6RL 3E6FA 3BIAX 4TOYL 5CGYC 3GSNH 4OV5A 1CLYH 1YYMH 2O5ZL 4KVCL 2YD2A 3C2AL 3SOBH 1S7VB 2CLVA 3BIKA 5A3ID 3LKSB 2B5IC 1I7ZA 1MWAB 1RK1A 4NZDA 1FDLL 3E6HB 1D5MA 1LQSR 4JCLA 3F7YA 3IAQA 2J6EA 4WUUB 2V7HB 4LK4A 3QWOB 4JZNB 3S35X 1E4XL 4NRZA 1JGDB 4LBEB 1EHLL 2A74A 1XF3A 2B1AH 2AK4B 2CUHA 3ZTNH 3MTRA 1CLCA 5GRYA 4HSQA 2VN7A 4WNQA 1AQDA 3L7EA 3UJIH 1KELH 5HI4D 2EC9T 2GTZA 2VXQH 3K46A 5LAXA 1IBGL 4JY6B 5BMFH 1QRNA 1LO5A 3PABA 4PJEE 5LXGL 2E7BA 3V0VA 3ULSB 5J3HD 3RWGB 2X9XA 2CXGA 3G6JF 3G6JA 3D87B 1X7QB 4WU7B 3KR3H 4Z7UF 4Z7UA 5I1LA 2C3VB 3QIBD 2XTJB 1E27B 1G7MB 4OD1H 1RZKH 4CVZA 3MRMA 4JHZA 1TVHB 3P4OB 1PLGL 1U8OA 3PUCA 1DEEA 3EOBB 2NPLX 4X8XA 5T5FH 4OUUA 1JTTA 3OR7A 4F33A 1FN4A 2AEWA 4NQXA 3VXMA 2V6HA 1TVBB 1TCMA 1T0MA 1EFQA 3VXRD 4I2XB 3QCVH 1JRHH 5FB8B 1PYWA 3AC0A 3KNBA 3MPCA 2IAMA 1QO3A 3MV9D 4U7SA 2CDFB 4KJQD 4BH7B 2DRUA 2CIKB 2VDKL 2W59A 3SKOA 1MF2L 2YA0A 2KBGA 3V4VH 4AM0A 3CSYA 3V6ZB 2GT9B 4IOSD 4Y4HD 5IB2A 3MRKB 4PB0L 1RZFH 5IKCA 3BP7A 3GUTA 4YK4C 5FYKD 3QUZA 3MACL 3ZL4L 3UP1A 3RQ3A 4DUWA 4PBVC 1LDPH 4RGMB 2D9QB 3H42H 1RUQH 2X4SB 3TH2T 4Z7NE 5I1GL 3QXUA 2UV3A 3MRGB 5FYKE 2JK5A 1CTNA 4N9GB 4PRAB 2UWEB 3LQZB 1ACZA 4QNPF 2VXUH 4TUJA 3BH8B 3P9MA 3QFDB 2XY2A 3TVMC 1CDHA 5I1AB 4G6AD 1KFAH 1D5IH 1LO2L 3WHXB 3GRWL 2VQ1A 1J1XH 1YJDC 5FAAA 5KSVA 1JPFB 1P7KB 4RFNB 2BSED 4QTHB 1OAKL 1LP9F 1LP9A 3LKOA 3C6LC 4BZ1H 1SJHB 3LRSA 4F57H 5SWZA 2VOTA 1QD0A 5EOTB 1BVLA 4G3YH 3VFWB 1BD2D 4RQQB 2OI9B 4YBHA 1H3UA 5I19L 2R1WB 1BECA 3HUJE 3MRJA 4XP4H 4Y2DD 2WANA 1KYOK 1CL7L 3RX8A 1CDCA 4Y19D 1BIHA 1A6AB 2BRRH 4P5MA 4U6YB 4PB9H 1BD2E 3O2DA 4NC1E 2GJZA 4OLEA 3UBXA 5CUSH 2YHGA 3OF6A 5CILH 3LQAC 3NGBB 3T8XA 1ZHLB 4Y19E 5CD3B 2Y07H 1JNLH 4U1IB 4HJGA 1IGCH 4DTGH 1WEJL 4U1MA 3DHJA 5HGGS 3FRUA 1PY4A 2XKNB 1KXQE 3TIDA 2V2WA 3NAAL 3LKPA 5EO0A 4XP6L 3U1SH 4F7CA 4XXDA 3VXRB 4PGCB 4LCYA 2F8XC 4NYLA 3LDBC 4Z0XB 5LWYL 2ZPKL 3MV9B 2Q3AA 1E28A 1EA9C 1JFQL 4X4YB 4UB0L 1N5AB 4YDKL 1NEZA 1A7QL 2OJZH 3SDDC 2Q8BH 3LEVL 1HH6B 2FEEI 4NUGL 4OF3A 5DRXA 1RHFA 4FQLL 5JR1L 3MRRB 4Y4HB 4JFYA 5CWSB 3KPLA 2MJWA 1UACL 5CCKL 4U6VH 1OAUL 1I3GH 4P2OD 2FX7L 4UV7L 3I9GL 4HWEL 4OCYL 3VXSE 4BFIB 4YUEH 4ZSOE 2IWGA 4MNHB 4B50A 5DEFA 5L7XH 5BXFB 4OAWA 5I6XC 3AM8C 2R8SH 3WUZA 2K7QA 4IJ3B 1ADQH 1ZT1A 5D70H 5AZEL 4JPWH 3LKNA 5JDJA 3P4MB 1QYGL 3MLRL 4ZUWA 3QUML 4NSKB 4PLNC 4ODSH 1K9TA 2R0ZL 5B22A 3QO1A 1U8NB 2BVEA 4B0MM 5GGRB 5JIPA 4GSDH 5IFHH 4OKVA 3EKCA 4O2CA 3LD8C 3HRZA 4YGVA 3U82B 1F4WH 1JPSL 1WC7A 3TZVD 4LCUA 2NXYB 4HKXA 3MLSH 3C09B 1UCBH 4PJAF 4OSUH 1WBZB 4PJAA 3QJHB 2X4RA 5ENWB 3MRHA 1CFSA 3ZTJG 4YPGA 5F9OH 5JPMA 4NFDA 2G60H 2X4NB 3LN4A 1MCRA 1IGMH 2DIJA 5BVJA 5IV2A 5LGJB 1NUDA 5DWUH 2OK0H 3OAYH 3P0VH 1F4YL 1A6VH 4JN1H 1T89A 1XGRB 1OGAD 3K4AA 1K5NB 3QEQA 3IXTB 1ORSA 1YUHA 5L8LB 4PJ9D 4NUJA 3CU7A 3A6CL 1FE8L 2ZOLA 3QAZB 1MWAL 2W65A 3T0EC 5I1EL 1OGAE 2EXWC 5J89A 3L1OH 3FFCD 1D9KB 4PJHA 3AGVA 4KQ4H 3UMTA 4LLDB 3ARRA 5CIPB 2YUXA 3IB4A 4MS8C 2VXSH 1JGEA 5EWIH 3WDJA 3DX9A 4D0DA 3T0BA 3FFCE 3GMMA 3WXVL 1XMWA 3CDFA 1WSST 4ZSOB 4GG6A 5I18L 4WEUD 1KN4L 3KPRA 1FVCA 1G6VK 3MUY1 2QHRH 4Z7VF 1IAIL 5F44A 4GKZA 4XPFL 1IC7H 4QT5B 2WZPD 2XWBB 2LVEA 2WWMC 3GMRB 4Y5XB 1KJVB 5IEHA 5DMKB 3LZFL 5ELIA 4ONHB 1UT9A 1UWGH 3QUXC 3H9SB 3DXAD 1YEFL 1U3HD 2WBJD 3QNXB 1F00I 2NZ9C 5JLZA 4EN3A 4ZG1A 2DQFA 2SEBB 4R4FH 1IAKA 1LO0H 5TH2A 3SGKA 1RZKC 2R0WH 4J23A 5GRVL 1MHEB 4PJCB 5DD6A 1ROWA 3KPPB 5IB5B 4AEHL 1RURH 5JW3L 5HHXH 5DJ0B 4MQXC 4Y4FD 4L4VA 1KLGA 4LSTL 5JIHA 3HPJA 1IM9D 4L1HA 3VFNB 2XZZA 2I5YL 2W9DL 2ESVA 2R29L 4G7YH 3QXDB 4OCSH 3TBYB 3WIHA 3T0AA 3BQUA 1Z5LA 5ACMA 3EYQD 2AVGA 4PJ5A 5I1HH 2QLVB 4F7EB 1KCUL 1FPTH 1YEJH 5MEPB 5E8EA 2CO7B 4ALAH 3GM0A 1U36A 5CSZA 1T2XA 3LB6C 4PLJD 1Q9LA 3S4SA 3CVIL 2YBRA 4PJ9B 4NNXA 3R0MA 1C5DB 3OR6A 1CGSL 3NA9H 3QCUH 4XVUC 5IF0A 4XPAL 3VGEA 1I8IA 5D2NE 2ADGB 4Q58C 4GRMB 3IU4L 2EIZB 3O9WA 5C3TA 1A7RL 3G5ZB 4ZFOB 1VFBA 1C7SA 1F3JB 2QADB 2VZSA 3F58H 2JB5H 4MQ7B 3BIBX 3WUWG 3QI9D 1FYTA 2C4FT 3RTQB 5HI5C 1Y6KR 3CC5A 4K7FA 1KB9J 1FO0A 2PO6D 3JBG7 3TH3T 3X3GL 3O0RH 3GNML 4LCWA 4XAKE 2H6PB 1G9EA 2VAJA 1J12A 4KRMB 5BZDA 4GW1A 2BVPB 3LEYH 5B3JE 3O41A 3VA2C 5K9KB 5ALBL 2X42A 1PG7X 3DXAB 1A6WH 2PTUA 4PS4L 2K3TA 4AY0A 4PGBB 3TJEH 4DQOH 1ZT7B 3ULVF 5C0ND 5L8KB 3CH1A 1I9JL 1TZHA 4Y8AA 5D8JL 2V2TA 1INDL 1J0KA 3IFOB 5IT2H 1MCCA 4GT7A 5E8NA 2ZUQB 3NFPA 5FF6A 5EBWA 3C08H 2YD3A 1N0XH 1GGCL 1TETH 3BVNB 2H26B 4GW4B 4Y4FB 3SGJA 3L3GA 1UWEH 1IM9B 4GKNA 1ZVSB 1CFQB 5L2KA 4KJYB 2XWTB 2V9QA 3KJ6L 2RB8A 3HC3L 3QG6A 1MREL 2A73A 2MQCA 1TQBB 4K55A 3NZ8B 4JFED 1S3KH 4MXVF 5TQ2L 3PQYA 4GAYB 4X8JB 2OSLA 3ARDA 4JPIB 4S2SA 3P0YL 3U46B 2YK1L 2XA3A 4E0RA 4CU6A 4QXWA 4JFEE 5IMMA 2PYEA 3H9HB 2W0LA 3PWUA 5JW5A 4WEBH 3GGWB 5KSBA 5KSBF 1INEL 1RUPH 3IFLH 3ZKXC 1CGWA 1EO7A 3DGGA 1HOCA 3D85D 4W4OC 2F15A 1TJHH 4NKMA 4NNYB 4ODVL 4XCFH 4OCWL 4PJXF 4PJXA 1UCTA 4J4PC 4PJGF 4Y5VC 5C6TL 3OKOA 3OXSA 5E70A 4PRID 2PO6B 3ARGB 3TIEA 3RX5A 1UQSA 3BE1H 3ALPA 4QHUA 4BQCA 2X09A 4UQ2A 4DWHA 5MP6L 1O7VA 1T5XB 1SMOA 1VACB 5CBEA 1SJEA 4AMKL 3T0DA 4HCRL 3OWEA 1CE1H 3WJJC 1DLHB 4PJDF 4PRDB 2IPUG 1A1OB 5E4IA 3I6GB 1RUMH 5GS2D 4E41E 3K80A 4FQ1H 1FVEB 3GJFK 1DBML 4HIJA 2I07A 1EERB 1ZOXA 3QO0A 4JB9L 1JZ6A 1OSZB 2JELL 4RFEA 3KLAA 5I1KH 1S78D 2Y7QA 2NLJA 3GSUA 2MWCA 4X5WA 1I1AD 3NA4A 2KZ1B 2E5EA 1LE9B 4LHQB 5DYOB 1G7PB 5FV2A 2JJSC 2UVFA 5ERWA 3CUPB 5ISZA 3EAKA 1KV3A 4HUNB 2BNRD 4D3CL 1U8KA 4PG9A 3S5LG 4GMTL 3EZJB 4NC0B 4O51A 3WIFA 5HY9B 3DMMC 1F3DH 4WY7H 4Y1AB 4JFEB 5E8PB 1DBAL 3MC0A 3TWCH 1A7OH 5DZOA 2D0FA 2BNRE 4JM2D 1GRWA 5EZIL 2BOCB 4K3GA 3DUSA 1G7JB 3H3BC 3D2UD 1QNZL 3FQXA 2YN5A 4YXKL 1TLKA 5EC2A 2PXYC 3HR5A 2IALB 1ZVYA 5ICXA 5T33L 2B0SH 5I9QB 6FABL 3D85B 1OAXL 3KPTA 4P5KB 4MA1B 2UUDH 4HK3N 5ESAA 4YGAB 5B8CB 1FV1A 4R97B 5D6DC 2W1NA 4FQJL 4PRIB 2HKHL 3UBXI 1ZHNB 1PX3A 5D72H 4Z77B 3HE7D 3GMLA 4OZFB 1ZLWK 1JBJA 4XVSL 1CXIA 5I0ZA 4XXCC 5AAMA 3WS3B 2D0HA 1FZMA 4Z7WE 1KLUA 1OD9A 4MSWA 1KIQA 1CGYA 5ICYA 1NC2A 2W07A 1GIGH 4X7FC 1S7QB 2BRQA 5I8EB 1A64A 3V6OA 1FZOA 1S7WB 5TDPA 4JFDA 5BVPH 4L4TE 2DQDL 2WQRA 3IDGB 3V5KA 5CEXA 4OLWH 2EDLA 2AK1L 5D7JA 3V79C 1H3XA 3QUYA 2PW1A 4KU1A 4DGIL 3T4YB 5H2BB 3UYRH 1CLYL 5FXCH 1HQRA 4HS3A 1EBPA 4QCIA 3UJTL 5JA9A 2PR4H 4YHNB 1DUZA 5I1JL 3O6FA 3ZYJA 3BZFB 4YXLL 1IMHC 1H5BB 3GFUA 3U0PB 5GHWH 4HX1A 4ZFOL 4HWZA 5EG6C 4Y5YA 5HJ3B 1RU9H 2I9LB 5KTEL 1XF5B 1CIUA 15C8L 5HYEA 4WV1A 4UDUA 1NAMA 2X4OA 5DK2A 5I16A 3PWNB 4OLXL 1OWWA 4HWBL 5GS3A 5E99L 3OB0H 5SWSA 4BSVA 4K7PY 5KVDH 1P2CB 4KKBC 3D2UB 3PWVB 1QTYT 1T04B 5MEOB 5HDQH 1X4ZA 1RJYB 2F54D 3QULB 2NNAB 4Y8DC 1UM4H 4ORZC 3RVTC 5F9WB 4AK1A 5EOQH 2F5BH 3QXAB 2DQIL 3W9DB 1MLCA 1FLRL 4MA7L 3ZMRA 2JJTC 1QSFD 4HZLB 1WZLA 2FBJH 2F54E 2VXVL 1T1WA 5FUOH 3SDAC 1FP5A 5F9JA 2IAND 3RAJL 4JO2H 3BP4B 1NQBA 1RZKL 1QG3A 4XBPB 1QSFE 3TV3H 4U1HA 5EO9B 2C5DC 3L6FA 3ZKMD 4O58L 3CD4A 4XC3L 1GAFL 5JO5A 1NFKA 5MENB 4Y0GA 1UXSA 2VZ3A 1NGZA 4R0LA 4DVBA 1CVSC 5HPMB 5HYSA 2BY3A 1FL3A 2NY1D 3D0VB 3ME0A 5IM7B 3AVEA 4EI5C 4Q74A 3IDUA 5C08D 4XMLL 2F8VA 3STZA 1UVQB 3PG2A 2E7MA 1AHWA 2APFA 1IGTA 4CN6A 2MPAH 4DGVH 1DDHA 3OKMA 3KPQA 3QDGB 1RZFL 1KT2A 4U1SB 25C8H 1J1OL 3FFDA 5GSRA 4ZTPH 3GSRB 5C08E 4IHOB 3WNOA 4IDJL 1ES0B 2EEAA 5F1NB 5I8CB 2ARJB 2A0LC 1XAUA 5DDHB 2AQ2A 4A2LA 2ICWJ 3VH8B 5SX5H 4POUB 1H3PH 1LO4L 1M4KA 1DQDH 3LPWA 3RVUC 1T2JA 3RY4A 4F2MA 1TZIA 5IR1A 4DAGH 1DQQB 5HHNB 2IQ9H 4UUJA 5E4EC 4LU5H 5KS9B 4EBQH 1CFVH 1UXWB 5TE6H 1OCWH 4WHCA 1T4KB 3WIIL 1SBSL 3M17A 1CK0L 5EZJA 4U1GC 5GS0D 1CF8H 5C0DB 4YO0A 4JDTL 4JY5L 4Q0XH 3RZCB 4P48A 1JHKH 3BPLC 4XNZC 4Q2ZA 4C83A 1IAOB 1NDMB 1K8DB 3STLA 4UDTB 4PV9A 1IILE 3KPOA 4WFED 5E56A 4ODBD 1F11A 4CVXB 1ZA3A 2IANB 3H8NA 5J7CC 2V7NA 1N7ML 4LSRL 1L0YA 3ZZ1A 5CILL 2VDNL 2E3VA 3ULUH 2MHAB 1U8IA 3C8DA 4ZDHA 4WFEE 2HFEB 2Y07L 3BRFA 5JZ7C 4JZJB 1U8JA 4FN0A 5TGBA 2J4WH 5BCAA 1R3LA 2FJGA 5I0DA 1AXTL 1NBYB 3KYOA 5C0RH 3U1SL 1Z0MA 3ALWA 4NQVA 2Y9RT 4GH7B 3HC0A 9CGTA 4UOW0 1VGKA 4OZGE 2VABA 4P59L 1W0WB 4M4PA 3AS1A 2XYCA 4E9LA 3VFOB 1U0QA 4FG6D 4X5XA 3RWIA 3UC0L 4D0BA 2H2PC 4GS7B 5JIKA 2RCSL 3RNKA 1FFPA 1KB9K 5TDOA 4ZUTA 3UX9B 2N7BA 5GIRB 3JV5A 5D7KD 2J8UA 5IROC 4JPVL 2D31A 5CINH 2CKNA 1LDSA 4H0IA 3V4PH 2C1PA 3JXAA 5IHUH 1FGNH 2X4TA 1VGEL 5D7KE 2BFVL 5F88B 4CW1B 1FNGA 3UTSD 1HKFA 1YQVH 4LVOB 3KYKL 4ZQKB 3ARBB 1NC4D 3UTSE 4JFQA 2L7JA 5J11C 5FM8A 4GUPB 5C0EA 1TPXC 2O5XL 5T1MB 1Q9KB 4MJ2A 2Z35B 1SYSA 5AG9A 4UV4L 1AGBB 3WSQH 1J5OH 5KVMC 4XPTH 3MMEB 3MXVL 4LSQH 2WIIB 3A6BH 3L7FA 5MHSD 4HQQL 2ATPA 1P53A 1NFDE 1F6AB 5DUBA 5FHAH 3HLAB 2QQNH 4UT7L 2JJUA 1LNUA 3MYJA 4LCCB 1G9NL 4N68A 3MUGB 2VE6A 4KI5D 4TN9A 3SE3C 5MHSE 3JWDL 1A6ZB 3QJFB 1ZHKB 1XF2B 5MEQB 5FA4B 2D03L 3K4ZA 5DI8A 3BZDA 4M00A 5ITFA 2E27L 1F90H 3P0VL 1E4WL 1MCPH 3CLEH 4XB8A 4XH2A 1TJIL 4JN1L 4YJZL 3CMGA 1FORL 4KI5E 3ZHKA 2HA1A 4L9LC 4IRSD 4R6UA 4XPBL 5F7DA 4OGAD 1M7IA 3ARFC 4JFPA 4UMGA 1DZBA 5GZND 2L7UA 3P73A 5FYKH 3VG0L 3RWFB 1F4HA 3HAEA 5DJAB 3KYAA 5SWQB 3T0WA 1YEEH 4L8SA 4NQED 3BWAB 5IMLA 4MNGE 2LE9A 3EO9H 3C5JB 1MRFL 4QRRA 2NCMA 4MVBC 1SYVA 4G6ML 4NQEE 4EI6B 3Q3GB 5IGXH 2RR3A 4NNPH 1D6VL 1ACYH 4EUPG 2C1OA 4AENA 2GSIA 2AJUH 1Y6MR 1KCSL 3KS0H 5FGBC 1T1ZA 2E9WA 2O61B 1F2XK 1NLDH 2R2EB 3FMGL 5D9SA 1IC7L 2P46B 1MFBL 4KFZC 1BZ9A 5ILTL 2VXTL 4QXGH 4XP1L 3UTSB 1AQKH 1OTSD 3GSQB 2BNQD 4KQ3H 5ID0B 4TVPE 4ELKA 2AQ3A 4FABH 2RFXA 3FT2A 4DK3A 4G42B 4G6JL 4G8GB 1A21A 1ZV5A 4P4KA 2QR0B 1DBBH 1ZS8B 3ILQD 5GS1C 3MOBH 4A6YB 4WEMB 2YD9A 1G7IB 2HLFD 5I1IH 3EOTH 3D0LA 3GBML 3GEWB 4JRXD 3ARTA 4N0UA 4LIQL 3RDTA 3TA3C 3E2HB 5HDBE 4DKDC 1T5WA 2X4UA 3OSKA 2GTWA 3RL1B 2Y72A 4G9FE 4KK9C 4R7DB 1X5GA 1W72B 1GL4B 4O02L 4UOJA 1U95B 32C2A 5F7WC 4JRXE 1SY6H 2VDPH 4UTBH 1FHGA 1R24B 2O5YL 4HKBA 1G7LA 5JIIA 5LGKA 4U3XA 5INDB 3CFJB 4O4YH 1XCQA 2FATL 3LKRB 3PNWB 4Z78A 3NH7H 1TCRB 2IQAB 3J8F7 5D7IB 1CN4A 5DC9B 3T2PA 1GPOL 4N8CL 5F1KC 3NCFB 1REIA 1JPGB 3CDCA 4NQEB 4P46C 3SPVA 1X5LA 4Y7MA 2HLAA 1QSEB 1HHHB 1EPFA 4LFHD 2P7TA 1FL6A 4JFXB 3IRZA 3C8KA 5BV7B 1J1PH 5CMAB 2EDYA 1T80A 3VFPA 4S1QL 1BEYH 3DV4A 1CE6A 4IS6A 4KDVA 4YFLF 2Z31D 4LPCA 5A2JH 4QRPA 1J05A 2HH0H 2ZSWB 2AXFB 1N8ZB 3RIAK 3NCYS 2X1PA 2CUMA 3MLYL 4NWTL 2Y06H 1OARL 4LLMB 4KHTH 3BISA 3RIFK 4MLSA 2WP3T 3SJVA 1I85A 2R1XB 1ONQA 4NPYA 4LRNL 2BNQB 1I8MA 1AD0A 1S7RA 3QSKB 4R7NB 3BPNC 4S1SL 3UZEA 1F13A 3MROB 1CD0A 2JIXA 3RI5K 2P5WE 3MRQA 4PY7B 2YUZA 3BP6A 4ONOA 4WHDA 4Z7QF 1GGUA 3EHBD 2WBWB 5F21B 3W39B 3MZTA 3OAZK 4N9OB 1ZT4A 5FYLD 4NQSA 3VD4A 3ULUC 5FK9B 1I7TB 3GI8L 5TFSH 1D5ZB 3KPMA 3TT1L 3L3HA 5T3ZD 3MLVH 5FYLE 4F7TA 3O4OB 1DN0B 2EXYD 1A4JB 2DLEA 3CU1A 1U2CA 1S5HA 3WLBA 3NTCH 2Z93A 1CVRA 5T3ZE 4RGMC 4ELME 5A3IC 5FEBA 3VXTB 1MLBA 4Q9QH 2BXYA 1G6RA 3DO3A 2D0GA 3JV4B 3MGAA 5CJXC 4ZXBD 4MWFA 2P5EA 1N2RB 1JGLL 4NKIL