2ABDA

The three-dimensional structure of acyl-coenzyme a binding protein from bovine liver. structural refinement using heteronuclear multidimensional nmr spectroscopy
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COENZYME A BINDING PROTEIN
publication title The three-dimensional structure of acyl-coenzyme A binding protein from bovine liver: structural refinement using heteronuclear multidimensional NMR spectroscopy.
pubmed doi rcsb
source organism Bos taurus
molecule tags Acyl-coenzyme a binding protein
total genus 31
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1993-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 2abdA00
1MIZB 3EPYA 1HB8A 1Y19B 1GC7A 2EMTA 2FJ9A 2HE7A 2FDQA 4HDQA 4P7IA 3PVLA 3PZDA 3AU5A 4YL8A 1ISNA 1ACAA 2I1JA 3AU4A 4NY0A 1ST7A 1GC6A 1HBKA 1GG3A 2ABDA 2D11A 2I1KA 1NVLA 2D10A 5IJMA 4HDOA 1E5WA 2RQ1A 2COPA 1HB6A 2WH5A 3U7DA 4F7GA 1NI2A 1NTIA 4ZRJA 2J0KA 2D2QA 4ZRIA 3X23A 1MK9B 1EF1A 3ZDTA 3IVFA 3WA0A 4EKUA 2ZPYA 3QIJA 3FLVA 2LBBA 4CYEA 3U8ZA 2CQUA 2AEHA 2HRJA 2EMSA 2YVCA 1MIXA 2AL6A 4DXAB 1J19A 1H4RA 2CB8A 4ZRKA 1MK7B 3FP5A 2J0JA 3G9WA 1SGHA 3BINA 2J0MA
chains in the Genus database with same CATH superfamily
1MIZB 1KBLA 4JK8A 2EMTA 3AU5A 1ACAA 4NY0A 1GC6A 2ABDA 2D10A 1GGOA 4JKGA 1HB6A 1NI2A 1VBGA 2J0KA 2D2QA 3X23A 3WA0A 1VBHA 3U8ZA 3SBTA 4JKEA 1H4RA 2CB8A 2X0SA 1JDEA 2J0MA 2DIKA 4JK9A 1Y19B 2FJ9A 4ILGB 3E9PA 3PVLA 4JKBA 2R82A 1ISNA 1ST7A 1E5WA 2WH5A 4ZRJA 1EF1A 3FLVA 4CYEA 2CQUA 2EMSA 4DXAB 1J19A 3FP5A 4JKFA 3BINA 3E66A 4HDQA 3PZDA 2I1JA 3AU4A 3SBGA 1HBKA 1GG3A 2I1KA 4GXBA 5IJMA 1NVLA 4ILHA 4HDOA 2COPA 1DIKA 3ENBA 1KC7A 1NTIA 1MK9B 3ZDTA 4EKUA 3IVFA 3E9OA 3QIJA 2AEHA 1MIXA 2AL6A 4TKNA 4JKHA 4JKAA 4JKGB 3EPYA 1HB8A 4ILJA 1GC7A 2HE7A 4P7IA 2FDQA 4JKDA 4YL8A 5JVLA 2D11A 2RQ1A 3U7DA 4F7GA 4ZRIA 2ZPYA 3E9LA 2LBBA 2HRJA 2YVCA 4ZRKA 4JKCA 1MK7B 3G9WA 2J0JA 4JK7A 1SGHA
chains in the Genus database with same CATH topology
1MIZB 1KBLA 4JK8A 2EMTA 3AU5A 1ACAA 4NY0A 1GC6A 2ABDA 2D10A 1GGOA 4JKGA 1HB6A 1NI2A 1VBGA 2J0KA 2D2QA 3X23A 3WA0A 1VBHA 3U8ZA 3SBTA 4JKEA 1H4RA 2CB8A 2X0SA 1JDEA 2J0MA 2DIKA 4JK9A 1Y19B 2FJ9A 4ILGB 3E9PA 3PVLA 4JKBA 2R82A 1ISNA 1ST7A 1E5WA 2WH5A 4ZRJA 1EF1A 3FLVA 4CYEA 2CQUA 2EMSA 4DXAB 1J19A 3FP5A 4JKFA 3BINA 3E66A 4HDQA 3PZDA 2I1JA 3AU4A 3SBGA 1HBKA 1GG3A 2I1KA 4GXBA 5IJMA 1NVLA 4ILHA 4HDOA 2COPA 1DIKA 3ENBA 1KC7A 1NTIA 1MK9B 3ZDTA 4EKUA 3IVFA 3E9OA 3QIJA 2AEHA 1MIXA 2AL6A 4TKNA 4JKHA 4JKAA 4JKGB 3EPYA 1HB8A 4ILJA 1GC7A 2HE7A 4P7IA 2FDQA 4JKDA 4YL8A 5JVLA 2D11A 2RQ1A 3U7DA 4F7GA 4ZRIA 2ZPYA 3E9LA 2LBBA 2HRJA 2YVCA 4ZRKA 4JKCA 1MK7B 3G9WA 2J0JA 4JK7A 1SGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIZ B;  3EPY A;  1HB8 A;  1Y19 B;  1GC7 A;  2EMT A;  2FJ9 A;  2HE7 A;  2FDQ A;  4HDQ A;  4P7I A;  3PVL A;  3PZD A;  3AU5 A;  4YL8 A;  1ISN A;  1ACA A;  2I1J A;  3AU4 A;  4NY0 A;  1ST7 A;  1GC6 A;  1HBK A;  1GG3 A;  2ABD A;  2D11 A;  2I1K A;  1NVL A;  2D10 A;  5IJM A;  4HDO A;  1E5W A;  2RQ1 A;  2COP A;  1HB6 A;  2WH5 A;  3U7D A;  4F7G A;  1NI2 A;  1NTI A;  4ZRJ A;  2J0K A;  2D2Q A;  4ZRI A;  3X23 A;  1MK9 B;  1EF1 A;  3ZDT A;  3IVF A;  3WA0 A;  4EKU A;  2ZPY A;  3QIJ A;  3FLV A;  2LBB A;  4CYE A;  3U8Z A;  2CQU A;  2AEH A;  2HRJ A;  2EMS A;  2YVC A;  1MIX A;  2AL6 A;  4DXA B;  1J19 A;  1H4R A;  2CB8 A;  4ZRK A;  1MK7 B;  3FP5 A;  2J0J A;  3G9W A;  1SGH A;  3BIN A;  2J0M A; 
#chains in the Genus database with same CATH topology
 1MIZ B;  1KBL A;  4JK8 A;  2EMT A;  3AU5 A;  1ACA A;  4NY0 A;  1GC6 A;  2ABD A;  2D10 A;  1GGO A;  4JKG A;  1HB6 A;  1NI2 A;  1VBG A;  2J0K A;  2D2Q A;  3X23 A;  3WA0 A;  1VBH A;  3U8Z A;  3SBT A;  4JKE A;  1H4R A;  2CB8 A;  2X0S A;  1JDE A;  2J0M A;  2DIK A;  4JK9 A;  1Y19 B;  2FJ9 A;  4ILG B;  3E9P A;  3PVL A;  4JKB A;  2R82 A;  1ISN A;  1ST7 A;  1E5W A;  2WH5 A;  4ZRJ A;  1EF1 A;  3FLV A;  4CYE A;  2CQU A;  2EMS A;  4DXA B;  1J19 A;  3FP5 A;  4JKF A;  3BIN A;  3E66 A;  4HDQ A;  3PZD A;  2I1J A;  3AU4 A;  3SBG A;  1HBK A;  1GG3 A;  2I1K A;  4GXB A;  5IJM A;  1NVL A;  4ILH A;  4HDO A;  2COP A;  1DIK A;  3ENB A;  1KC7 A;  1NTI A;  1MK9 B;  3ZDT A;  4EKU A;  3IVF A;  3E9O A;  3QIJ A;  2AEH A;  1MIX A;  2AL6 A;  4TKN A;  4JKH A;  4JKA A;  4JKG B;  3EPY A;  1HB8 A;  4ILJ A;  1GC7 A;  2HE7 A;  4P7I A;  2FDQ A;  4JKD A;  4YL8 A;  5JVL A;  2D11 A;  2RQ1 A;  3U7D A;  4F7G A;  4ZRI A;  2ZPY A;  3E9L A;  2LBB A;  2HRJ A;  2YVC A;  4ZRK A;  4JKC A;  1MK7 B;  3G9W A;  2J0J A;  4JK7 A;  1SGH A; 
#chains in the Genus database with same CATH homology
 1MIZ B;  1KBL A;  4JK8 A;  2EMT A;  3AU5 A;  1ACA A;  4NY0 A;  1GC6 A;  2ABD A;  2D10 A;  1GGO A;  4JKG A;  1HB6 A;  1NI2 A;  1VBG A;  2J0K A;  2D2Q A;  3X23 A;  3WA0 A;  1VBH A;  3U8Z A;  3SBT A;  4JKE A;  1H4R A;  2CB8 A;  2X0S A;  1JDE A;  2J0M A;  2DIK A;  4JK9 A;  1Y19 B;  2FJ9 A;  4ILG B;  3E9P A;  3PVL A;  4JKB A;  2R82 A;  1ISN A;  1ST7 A;  1E5W A;  2WH5 A;  4ZRJ A;  1EF1 A;  3FLV A;  4CYE A;  2CQU A;  2EMS A;  4DXA B;  1J19 A;  3FP5 A;  4JKF A;  3BIN A;  3E66 A;  4HDQ A;  3PZD A;  2I1J A;  3AU4 A;  3SBG A;  1HBK A;  1GG3 A;  2I1K A;  4GXB A;  5IJM A;  1NVL A;  4ILH A;  4HDO A;  2COP A;  1DIK A;  3ENB A;  1KC7 A;  1NTI A;  1MK9 B;  3ZDT A;  4EKU A;  3IVF A;  3E9O A;  3QIJ A;  2AEH A;  1MIX A;  2AL6 A;  4TKN A;  4JKH A;  4JKA A;  4JKG B;  3EPY A;  1HB8 A;  4ILJ A;  1GC7 A;  2HE7 A;  4P7I A;  2FDQ A;  4JKD A;  4YL8 A;  5JVL A;  2D11 A;  2RQ1 A;  3U7D A;  4F7G A;  4ZRI A;  2ZPY A;  3E9L A;  2LBB A;  2HRJ A;  2YVC A;  4ZRK A;  4JKC A;  1MK7 B;  3G9W A;  2J0J A;  4JK7 A;  1SGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...