2ACQA

An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose-6-phosphate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anion binding site in human aldose reductase: mechanistic implications for the binding of citrate, cacodylate, and glucose 6-phosphate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
total genus 99
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 1994-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2acqA00
2I16A 1S1RA 3KRBA 4FA3A 4PUUA 4JTCA 4R9OA 2FZ9A 4DBWA 4Q3MA 2ACUA 4JTDA 2ACRA 1MRQA 5C7HA 3UWEA 4YU1A 4GCAA 4FZIA 3V36A 2WZMA 3VXGA 4LBRA 4WDUA 2QXWA 4XZIA 2IKGA 4XZMX 2BGSA 2HV5A 3UFYA 1MI3A 1QRQA 3GHUA 4XO6A 3R58A 3GHTA 3WG6A 4PMJA 1FRBA 1T40A 1X98A 2HEJA 2IQ0A 3V0SA 3QKZA 2IPJA 3UZYA 3LN3A 2FGBA 2PF8A 1RY0A 2FZBA 3UG8A 2IS7A 4LBSA 2FVLA 4Q7BA 1C9WA 2WZTA 3B3DA 3C3UA 3M64A 2IKHA 3S3GA 3F7JA 1IEIA 2PDBA 1PWLA 2PDCA 4NKCA 1ZGDA 3LD5A 4HMNA 3COTA 3NTYA 2PFHA 1X96A 4IJRA 2IPGA 1UR3M 3N6QA 1EXBA 5M2FX 4DBUA 5LIKX 3DOPA 4YVPA 3LBOA 2A79A 4YVXA 3R43A 4LAUA 1M9HA 4F40A 4OTKA 1Q13A 3FJNA 4JTRA 4XVEA 2PDNA 2PDHA 1XF0A 4XO7A 3CV7A 3LQLA 4WRHA 3R94A 2F2KA 5JH1A 1YNPA 3G1RA 3R8GA 3UZWA 3WCZA 3G5EA 4WGHA 3H4GA 2PDUA 2FZ8A 4PR4A 3V35A 3N2TA 3CV6A 3ONBA 4JQ1A 4JQ4A 1ZSXA 2HE8A 1Z3NA 1PZ1A 3WBWA 4I5XA 5AZ1A 2INZA 3EAUA 3ERPA 4LB4A 1Z9AA 1HQTA 2F38A 3T42A 1RY8A 1OG6A 2HVNA 5DANA 3CAVA 4GACA 3UP8A 3WBYA 4WEVX 2INEA 1T41A 1ADSA 1YNQA 2IPWA 2PDQA 2HVOA 3MB9A 4JIIX 3CMFA 3LEPA 1PZ0A 3M0IA 3EB4A 1YE4A 2DUXA 2PDLA 4AUBA 4MHBA 4XK2A 2PD5A 2DUZA 4QXIA 5HNTA 4L1WA 1RALA 1HW6A 4WDTA 3P2VA 1EKOA 2C91A 3LUTA 2ALRA 2P5NA 4GA8A 4FALA 4ASTA 3Q67A 5JH2A 2J8TA 2NVDA 1SM9A 3UGRA 2PDWA 5AZ0A 1VP5A 2ACSA 3CAQA 1XGDA 2PEVA 2IKJA 4ZFCA 3R7MA 3WBXA 4JQ2A 3UZZA 5LIYX 3RX4A 1VBJA 3BURA 4XAPA 1IHIA 3GUGA 3O3RA 2NVCA 4LAZA 4EXBA 4H7CA 4L1XA 3BV7A 2IQDA 4GIEA 2I17A 1GVEA 2PDIA 2BGQA 4DBSA 3BUVA 4QR6A 2PDMA 2PZNA 4H8NA 1S2AA 5HA7A 4HBKA 4FAMA 2HE5A 2PDYA 2ISFA 5LIWX 2ACQA 1XJBA 2R9RA 1S1PA 4PRRA 4LB3A 1MZRA 4GQ0A 3UYIA 3RX2A 4JQ3A 3GHSA 3BCJA 3H7UA 3LQGA 3DN5A 1QWKA 4QBXA 4ICCX 4XZHA 3U2CA 2PDXA 3Q65A 4WDWA 1S2CA 1JEZA 1EF3A 2CLPA 5LIXX 4JQAA 3LZ5A 2PD9A 3V0TA 3D3FA 1ZQ5A 1AH3A 1PWMA 2AGTA 2PDJA 2PDKA 4JTAA 1EL3A 1X97A 3RX3A 2PDPA 1AZ2A 3EB3A 1J96A 3MC5A 3R6IA 4IGSA 3GHRA 1R38A 5LIUX 3O0KA 1AH4A 4JTQA 1LQAA 1LWIA 3ONCA 1PYFA 4YS1A 1US0A 3H7RA 4XZLX 3UZXA 1K8CA 5KETA 4GABA 2HDJA 3LZ3A 1Z8AA 5HNUA 4QX4A 1YE6A 4YVVA 2PDGA 4RPQA 4IJCA 4PUWA 3LNMA 3LENA 4GQGA 1Q5MA 4XVDA 3V0UA 2DV0A 4PRTA 3R8HA 2R24A 1A80A 3M4HA 2VDGA 1AZ1A 2PDFA 3CASA 4XZNX 4JIRA 2IKIA 4JIHA 4EXAA 2FZDA 2IPFA 1AH0A 4G5DA 4WDXA 2BP1A 4DZ5A 3FX4A 1AFSA 1ZUAX 1Z89A
chains in the Genus database with same CATH superfamily
4P61A 2QQ6A 1LUCB 3BO9A 3TQVA 3HB9A 4ZOBA 3BG3A 3SCOA 1TVPA 2VUYA 2BDQA 2A2IA 2QCNA 4FZIA 3IAQA 1KKRA 1JJKA 2HS6A 4GNKB 4GZ7A 3AIBA 1UD3A 3BZGA 2BNJA 3TTSA 1TO3A 3CUFA 3A3HA 2WW5A 1GEHA 3THCA 3AXXA 3D5HA 5HDRA 4I5UA 1Y5XA 3OBEA 3AJ7A 4AZIA 3ARRA 3P5ZA 2GDVA 4RLIA 4GI9A 2PGFA 1SZRA 3WLKX 2E25A 1CECA 1TYGA 2O92A 5IOBA 5BRBA 1KFBA 4FR6A 3S47A 3MUCA 9RUBA 4GVIA 4AX6A 3F4CA 3K4AA 2GUUA 3VGHA 4RJEA 4I9TA 3WH9A 1CIUA 5C6MA 4HYVA 1EHNA 4KQNA 2V68A 5EMUA 3EXRA 1UUQA 4HNVA 4GC3A 1C8QA 2OT0A 4FF5A 5DXYA 2ODOA 3FKRA 1V3MA 5FESA 2MNRA 3NURA 1S3TC 1OFRA 2A5HA 1EA9C 1UB3A 2GOKA 3DU0A 4JFSA 1EBGA 3WMLA 1WA3A 3NJ3A 4L6HA 3HZ3A 4P5UA 3PN8A 1GYLA 1NQKA 1PBGA 5SWUA 4LVAA 2ZFAA 3MP3A 4XVEA 2G3IA 5HBFA 1UP0A 5FJOA 2EO7A 4PFMA 4I8YA 3GTIA 1VEPA 3N04A 3QZEA 1FWCC 1JUEA 1DTUA 3GG0A 5LGXA 2EHHA 4S2CA 4GZIA 2ZE0A 1XIFA 3PJXA 3KP0A 5HR6A 1JPMA 2AAAA 4LUJA 4WGHA 2PSNA 2G95A 1TCDA 2BY1A 5GJNA 1UW9A 1Z3NA 2QLYA 3MDWA 3VILA 1BWLA 5D04C 3VIFA 4Y9NA 4LS2A 4ADTA 3KLKA 8A3HA 5C71A 3AC0A 2WANA 1A47A 4RCXA 3I4EA 2B31A 2QHAA 4IMGA 2JE8A 1A50A 5BOFA 1Q8AA 2ZKMX 4WEVX 4RK8A 4LYKA 3QY8A 1V6TA 1WXJA 3UWZA 5I23A 3E74A 4QQ3A 2HVOA 3MB9A 4IT1A 3O07A 1B3YA 3GDBA 4QGCA 1MW0A 3U4FA 4PMRA 1CWYA 1KD0A 4UMBA 3EPOA 2P76A 2C18A 4EP8C 4HQVA 4D6GA 4DX3A 4MHBA 4IWWA 4HYWA 3ZLGA 4US5D 3RR1A 5F1UA 5FI8A 3P2VA 3LV5A 4U5IA 3S1WA 1PHWA 1W9DM 2GVGA 2G8ZA 5U7SA 2NVDA 3VD9A 4KETA 1SM9A 1V5XA 3VIGA 1DXIA 4YTUA 4I8DA 5KSWA 3WELA 1XGEA 4OIFA 3TJ4A 4QITA 4FXRA 2AL2B 4PTXA 4W5UA 3UZZA 2QCFA 4ZODA 4ZSTA 1J6PA 3U5UA 4C6OA 3M43A 1XLBA 2CESA 4AF0B 1M53A 2V9DA 2PWVA 1RH9A 5A5WA 2J8GA 1LRTA 1LWJA 3WQVA 3BICA 1SPQA 1GW1A 4GVHA 4NU7A 2PC8A 3SRHA 2QW5A 4DJFC 4RE2A 4K3ZA 2NWRA 3RLGA 2BZNA 4ADSA 3TAKA 5HA7A 1B3OA 3LX9A 1OFBA 1YHTA 4TX8A 4J7RA 1DQXA 3SRKA 1U5HA 2C0HA 2QCCA 3WBEA 4CQ8A 3LPOA 1UA7A 1CXFA 2CITA 3E2VA 3KBVA 3SRFA 3SR7A 1G94A 2FTWA 4AWSA 4P8WA 3Q2DA 2ZUUA 1BKHA 5AHLA 3A6OA 1N82A 1BVWA 2C15A 4R85A 4UR9A 4JKLA 1W1A1 4N9DA 3AHXA 3TR9A 1T96A 5DT5A 4S3CA 1TE6A 3U2CA 1GQLA 3O06A 3OLIA 4CKQA 5CEWA 4I7UA 2HRWA 1KM5A 4KRUA 3ARYA 1VFSA 3SURA 3DBNA 2ISSA 3TLQA 4CCDA 3A3WA 4GUFA 3WJWA 4EXQA 1VRXA 2Z6JA 2GDQA 5FJIA 1Q4WA 3TN3A 4GVGA 1BG4A 3PWAA 3RDKA 4C6MA 5AECA 4RXFA 3QHNA 4Z17A 1V6UA 2BV9A 1I1WA 1LQ2A 1ENUA 1E51A 5EYWA 3SCRA 3R2GA 4DVOA 1QMLA 3TSDA 3A4AA 4XBKA 4EANA 2ZIDA 3EX4A 1SW3A 4UOJA 2GGGA 3TOPA 4PYSA 1O1ZA 3CH0A 4MLRA 4BQ2A 3YPIA 2HISA 3RG6A 1A5CA 1VPXA 4FXFA 1H1YA 3VCRA 1YXDA 4MB5A 3QF0A 3IACA 4QX4A 3SZ8A 4JTTA 3P67A 4KEVA 3PHAA 4IJCA 5BU6A 3E38A 2OT1A 2NWSA 4GYFA 3NYDA 4K1WA 4TTUA 1POKA 3MMUA 1OFDA 1VIWA 2D73A 3EMCA 4JPGA 3HM7A 1EPVA 4NJKA 2VDGA 4FLOA 2VFGA 2YL8A 3M5ZA 3CASA 3UA4A 4CQ9A 4NY2A 2PLCA 3LTPA 4EXAA 3EWYA 3PP7A 1GZGA 2Q3RA 1XCWA 4CUCA 3IJ7A 2Z27A 2OODA 2P50A 1UR8A 5CAHA 2W92A 4CU7A 3CBWA 1EBHA 3FYYA 3WDJA 1SMAA 4PUUA 1B1YA 2ZZ7A 1P1MA 1ISVA 3SQMA 3G3MA 3HJEA 5C7HA 1QR7A 3MSYA 3FJ4A 3ZSSA 5ABGA 4HKPA 1O5XA 4EX4A 3AIVA 3UY8A 3S2MA 4HJWA 3C2VA 2YCLB 3QFEA 2BXYA 4K7YA 4GO8A 4NXKA 3EOUA 3BLIA 4EAYA 1YEYA 2WNWA 1I2NA 3GZ3A 1XIHA 1HXJA 3QKZA 4NAEB 1IZKA 2XZ9A 1A3XA 5ABFA 5DRIA 3VU2A 4RE0A 1XW8A 4LBSA 4EPEC 1NSJA 1CBGA 2I5QA 2EPHA 2XFWA 4O4WA 3CPRA 3TYCA 3W02A 3VM5A 4H9UA 1QNPA 4EVZA 1I1XA 5REQB 2CEQA 3MCMA 2Q8ZA 2J6VA 3H4WA 1ZGDA 4P2VA 1VHCA 2J78A 3NTYA 1TREA 8CGTA 1X96A 4JTEA 1PPIA 1KFWA 2IPGA 3TOYA 2E5BA 1VB9A 3G1HA 1LTDA 3OODA 2CLEA 4UIOA 3P74A 3EKZA 1R3RA 2KAUC 1DQUA 5PTDA 4NYUA 1E5NA 3B8SA 1TA3B 2A79A 1QXLA 3MMWA 4YVXA 2GSJA 4MZ8A 1ONXA 4O1AA 3SCPA 4AMCA 3GNOA 1S5VA 3KCJA 1O5RA 4DO6A 5K9CA 3N17A 1EJTC 1O7AA 3B0UX 3LQLA 5E0FA 5I6SA 2DZPA 3GIPA 2ZYFA 5CPSA 3BDKA 4U31A 3ZFHA 1A5UA 5EU9A 1UZHA 3ONBA 3LNPA 2DW6A 3C52A 4JQ1A 2QCDB 3DFSA 3T0AA 6PTDA 2EEXA 5TIMA 3AZSA 2NQ9A 4O1FA 3RK8A 4WZHA 3SDOA 5BZAA 3MVTA 2YX0A 6ENLA 1BYBA 4ALDA 4HA1A 4RW3A 1BFNA 3MKKA 2E4TA 5C7VA 4FO4A 2ZRZA 2BWGA 2RGLA 4AEOA 4MF4A 1EJSC 4IFKA 5EMLA 2FFCA 2J7FA 3VIPA 2VGGA 3HG3A 2WLYA 3W25A 1FFRA 4NZFA 3ZLFA 2ISWA 1PV8A 3USBA 4JKKA 3SUSA 4JTKA 3B40A 3B9NA 1AMYA 2I9UA 5AY7A 4QCEA 3TXZA 4MJ4A 2ISDA 3PNUA 1EKOA 2B7NA 5BYWA 2HBXA 4AB4A 1XFCA 1JYWA 3QV7A 4KBXA 2DZWA 2VENA 3U3HA 2I14A 4NZCA 1OVDA 1VP5A 1GQKA 2R1KA 2YB4A 3R7MA 1YNYA 1R47A 1FHLA 2P0OA 3C0QA 4JR5A 4GGBA 4PFHA 2I57A 4NHVA 2D24A 1UR2A 3M5YA 1AQ0A 3KRUA 5AKQA 4GBUA 3HMCA 4HA3A 3DDMA 5DY2A 1KM3A 1W17A 1KM6A 1JZ4A 1T6MA 1GVEA 2FDMA 3QEZA 1RBLA 4V33A 5HMEA 4JEQA 2Z4GA 1V51A 2D0FA 2D3NA 4CCCA 3MKVA 7CGTA 4UCFA 1Q7QA 3STCA 1JRBA 2XVPA 1ISWA 2E9BA 3W3OA 4LUTA 4ZB0A 1X7IA 3LLDA 4BF7A 5F4SA 3FSUA 3E0LA 3OEXA 4UQ9A 1XHGA 4M0XA 2A7RA 4I90A 4JQ3A 3VNKA 3S5ZA 1E9YB 3LTYA 3OHMB 3H7UA 4K36A 1DOSA 4S3GA 4XZHA 4WXYA 1EZWA 4LNYA 4QIUA 2E09A 4XKYA 1EF3A 2X2GA 3SSJA 5BU9A 1ZL1A 5FJPA 3QLLA 3W6YA 4Q4QA 4PTDA 2IXVA 3OQ8A 2XDFA 3V0TA 1TZZA 3CZGA 5TNVA 2WSQA 3L2LA 3MUIA 2WQPA 4DJDD 2Z1KA 4MPKA 4RE3A 3M0VA 2FZMA 3PSVA 4K37A 2HNEA 1X97A 4JFTA 2VL4A 3QHMA 3LBCA 2GJXA 2F6KA 1GPWA 2V38A 1BTMA 3W75A 1OC6A 2AMGA 1KXHA 4UTLA 3KZSA 1GKQA 2FB2A 2BBFA 1G7VA 4R9XA 2VGBA 2BOEX 3NXFA 5C2XA 3CEPA 1H5YA 1XRSA 4YS1A 3DHUA 2VEFA 3AMKA 1ESWA 4UQDA 4C91A 2RH9A 3HQNA 2XM1A 1RXOB 4MNJA 4XV0A 1UIPA 4L1GA 3VM7A 1J11A 1UWRA 1KR1A 1HKIA 3ARPA 4IXHA 4F3HA 1GOOA 2Y2WA 1GQJA 2C19A 4D8ZA 3GG1A 1EUAA 4N42A 5K7JA 3UVIA 3L0KA 1ZZMA 1QNSA 1TVLA 4XZ9A 3UWVA 1MW1A 4AD5A 3SB0A 4H7ZA 1E1EA 3B4UA 4ZQRA 3ANYA 5LGZA 2GSHA 1CX9A 3E2QA 1L6GA 1TE1A 3WQPA 1EDTA 2C6QA 1Q66A 2V3DA 3BANA 3NL2A 2XIQA 3L5LA 1M03A 1ITXA 3QPYA 2PTDA 3RLVA 2C7FA 3PY2A 1F07A 4JTHA 2WHJA 4MLJA 3LCLA 2HV5A 2WPGA 4UTHA 5LNUA 2TAAA 3A64A 3FVDA 3AAMA 1BG9A 3WG6A 1TZ7A 3SFWA 1KCZA 3VINA 3L4ZA 1WOBA 4NX5A 3KXQA 1CGWA 4E8CA 1P1XA 1EDGA 2IW0A 3L65A 2D1ZA 4R34A 1I60A 1MXDA 3KOYA 3UJ2A 3W07A 1K8XA 3KVLA 2FGBA 1UH3A 3UG8A 1TMLA 2EKCA 1MXSA 3MJMA 2A4AA 3LGEA 1TWZA 1CB2A 4AIBA 4BWLA 2G3JA 3EA2A 4N9BA 2VEIA 2VYOA 2PDBA 1PWLA 1ZBWA 3K1DA 2GK1A 2O0TA 3LMZA 3AYRA 1HT6A 4GUHA 5L9FA 1XD0A 4LXFA 2PFHA 2EPKX 2YB1A 4B15A 4W7UA 2V0TA 4MB4A 1T8XA 4ZQNA 3O9NA 4I9MA 4LVFA 4UFHA 3KFTA 3WNLA 4E8DA 3V18A 3RF9A 3AIUA 3URNA 4DBUA 1CI1A 4CU8A 3QRHA 3WSUA 1F6YA 1GTHA 1P5BA 1BGAA 3LBOA 1AMKA 3ES7A 2DZTA 1F73A 1M9HA 4K38A 4Z2HA 4F40A 1Q13A 2GGJA 4Y9MA 2E5DA 3U7BA 2FHFA 3D0CA 3ATYA 4IGMA 2QAFA 1A5AA 3EOSA 5FF2A 1FWEC 3R94A 1POJA 3TFXA 2DT3A 4PODA 1PKLA 3W1MA 3G22A 1NOWA 3V35A 2XN0A 3N2TA 3TYUA 3DYPA 4A8RA 3MT1A 3VDHA 3WJXA 3VNLA 3WFLA 3APTA 1JZ8A 1C29A 1UZDA 2G3FA 2GJPA 1WV2A 5LKYA 2ZVRA 4HVXA 2P8CA 3A9IA 4DHGA 4CCZA 1L9WA 2NX9A 5AHEA 2QIWA 4FIQA 2HVNA 1IWAA 1RLDA 1GW9A 1OK4A 4DO4A 1JZ6A 3OZYA 2INEA 3IGSA 4ATLA 4TQTA 4Z2GA 4GUGA 4ZO8A 3BOXA 2J9XA 3LEPA 2PZ0A 3H26A 2PTXA 5IDZA 4AD0A 3EB4A 5FEPA 3G2GA 5D2WA 2JFEX 5T91A 4NT0A 5BXTA 3W01A 3LLXA 4QG8A 4F2TA 1JCNA 3WDIA 3G3DA 1Z32X 3QMRA 4WDTA 4YWIA 1JDAA 3Q45A 2C91A 3CPUA 3M0XA 2YYUA 4F8XA 4O17A 3T0BA 5B80A 3EZ4A 4HK6A 5TAOA 1YRRA 2EJ1A 3NQAA 3ORWA 2ZX6A 3UCCA 1BKSA 1O68A 1S5NA 5LIYX 3CAWA 2Y0FA 3LCWA 2DSUA 3SGUA 4W85A 4TV6A 1NARA 3UZ5A 1GORA 1PE1A 1TJPA 4BQ5A 3L4YA 4L61A 2QT3A 3C8FA 3W1RA 3WLIA 4E0CA 3P60A 4UNLA 1XKJA 4JL2A 1ME7A 4HP5A 4R7JA 3WH6A 1UWAA 4LH8A 2V5LA 3EMQA 3PK7A 4HPHA 2Z28A 3VKDA 3VNZA 3NCOA 3MZNA 1G69A 2WO5A 2HQAA 1IZJA 3ITCA 2O56A 2VXNA 4JHOA 3NOEA 4AVOA 5LIWX 1A53A 4UTTA 5DEZA 1GWJA 1W6TA 3DCPA 4PRRA 1WYIA 5E9XA 4XKYB 1UG6A 3U57A 4MFEA 3RPMA 1PSCA 4QROA 2VDIA 4QJ5B 3ZO9A 3MUY1 4CEUC 2DH2A 4JIPA 3KS5A 3B9AA 2Z1VA 3VZXA 5C2CA 4ZQPA 3Q65A 5IFPA 5DMLA 5E0KA 3OO2A 4M51A 1C7TA 2ZOXA 2F2HA 2ESCA 4X0VA 3LRMA 3DECA 3TJIA 1SMDA 3NPXA 4IX2A 1QI5A 4C90A 3D3FA 2L5HA 3LK6A 4GIAA 1UBPC 4FP1A 4WY0A 4AAJA 1ODUA 2NQZA 1JIBA 3CS2A 3Q4DA 2XWEA 2O7SA 3AI0A 3R13A 3HPSA 3KOWA 3CUXA 1JUBA 4FX6M 3MMDA 3DG7A 3CB3A 2EQDA 3GTFA 2EG8A 4FOUA 2WJZA 2CFFA 3NM1A 5IDIA 2WKLA 1E71M 1ZRQA 4M24A 5AVNA 3G24A 1TTJA 5FEWA 1LWIA 3VD3A 2NZLA 3PUOA 1TPB1 3QM3A 3CK5A 1E6QM 2Z1SA 2VC7A 3B05A 3MSDA 3BH4A 3E0WA 1KCXA 1NTHA 3LNMA 3LENA 4XIAA 2W3ZA 3BGJA 1BXBA 3SW6A 3GC2A 2WOQA 1I6NA 4ACZA 1EC8A 1QBBA 2NQLA 3QGVA 2NUYA 1ITQA 1AZ1A 1SO5A 3L4WA 4PH6A 1E4MM 4A21A 4UTWA 2YDAA 2NSOA 4L56A 2VJXA 1WAUA 1DJXA 4XZNX 2PTZA 5JIWA 5E5CA 5HWMA 4ERIA 1WCGA 1BXCA 1OD0A 2WKJA 3C2OA 1LORA 1R3QA 3PZNA 2X16A 2YBUA 3CHCA 3KRBA 1VBGA 2W27A 4JTCA 2HZGA 4OBTA 3PUGA 4FMVA 4MZ1A 3A5VA 1FWFC 4GKTA 1ZFJA 3GU1A 2J25A 5CAKA 1JXKA 1HKWA 3PZMA 3ABOA 4FNUA 3UFYA 3JZEA 1QRQA 2V3EA 4CVUA 3UJSA 1JCXA 4GE8A 4UTWC 3NPWA 4CQBA 4EACA 5D02A 4C5ZA 3KCLA 1UD6A 1OIFA 2HEJA 2QIIA 4E4UA 1XWYA 1U5VA 4GYJA 4UNIA 3CMJA 4OT7A 2X40A 4X60A 1F4AA 2D2HA 4HNLA 4H9ZA 3RAOA 3SY1A 1LM1A 4GY7A 2OMAA 3DFPA 3KRSA 4ZMGA 1MEHA 4ERAA 5I06A 5I79A 1TRDA 5DY3A 4ZE5A 5CGMA 3S3GA 1FDJA 2PUZA 4M3PA 2Z25A 2DEPA 2NUWA 1QNRA 1QFEA 3WQFA 1DJHA 3PULA 3AS3A 1VFUA 4C6PA 3RM8A 2JALA 4HHPA 4R7WA 4IJRA 4QEEA 5GNZA 4MWAE 1QW8A 2AQVA 3WF0A 4UFIA 2KZHA 1FY6A 2OX4A 1D9EA 4C6QA 5M2FX 2OLHA 4W88A 1CENA 3OBAA 1S2UA 3VMOA 4JN7A 1WDWA 1Q3NA 1UD2A 3VIIA 2I56A 3T1GA 5T26A 3L0NA 5TD4A 2QKFA 3MHUA 5A6SA 1PVNA 4QM1A 3CUGA 3OLEA 1S38A 2QUUA 1JCYA 1U1UA 1MVYA 4M8UA 3ARTA 4D6DA 4A8LA 2ABBA 4XTDA 4IP5A 2C0AA 1E72M 3WO8A 3P6LA 3TW7A 1UMLA 4O57A 4HU8A 4D6EA 2ATMA 3A22A 3QZ6A 2JQXA 4J4KA 2BSLA 1V02E 1XINA 3BPWA 3KL5A 5D37A 1GZJA 1Y5WA 4J3VA 2HCVA 3GZAA 1ISYA 4CD8A 5DANA 1YDYA 3NM3A 2NX1A 3MJYA 2WKGA 3SQSA 2D2OA 2X0HA 4UFJA 2IPWA 4MG4A 2YL5A 1VBRA 3QW4B 4K39A 5A6AA 1Z6KA 3HPXA 2AGKA 1I75A 1GOXA 2E0PA 4CLMA 4XD5A 3ITLA 1EIBA 2HXUA 4GQBA 3W7JA 1P7TA 1BSLA 5CJ5A 4CQCA 4BEQA 2D2GA 1ADDA 2J88A 2ZICA 5FAGA 1AW5A 2QF7A 3QQWA 4IXXA 3DERA 3PB2A 3LHWA 3H2EA 4F66A 2DQXA 2O9PA 4YJ5A 3VZYA 2OKOA 4PCPA 1DPMA 3PBGA 2EBNA 2QVNA 1A5BA 4W4QA 4KF1A 1HJQA 4A3YA 4MFDA 1MDLA 1VS1A 3H53A 2X05A 4XBJA 2CXGA 4JQ2A 1V03A 3NQBA 2OXNA 4Y9PA 1W9BM 3OG2A 1J0KA 1E4IA 3GIYA 1IHIA 4ZBCA 3C0JA 2G96A 3W9ZA 1P0NA 3IV8A 3O8AA 4EXBA 1M5WA 4ZTYA 5LA2A 4RDYA 4AD1A 2I5GA 1OX5A 2UY5A 1XPGA 3TZFA 3F1QA 1C93A 1L6FA 2J9YA 4IPLA 3BUVA 3O6CA 1KGWA 3OB8A 2PDMA 4AIOA 1RAKA 1XICA 4CU6A 2HE5A 4PSPA 4DNMA 1Y7VA 2WHKA 4OV4A 2ISFA 4IICA 1OYBA 4H1ZA 1W91A 1XJBA 3VVGA 4FNTA 1HL8A 2GVYA 3CYJA 4MWAC 4Q8UA 2J7DA 5D2TA 3OVPA 3N1AA 3H2NA 3DIPA 3GHSA 1TPFA 3PUDA 1NP0A 3H7VA 1V7YA 2FPVA 3GXMA 2DVXA 4FLSA 3M5VA 4JFUA 1QWKA 5CC5A 4NZ4A 5A95A 4OKDA 5LSMA 5DMYA 3TAOA 4CNSA 1WKDA 1XH1A 2C79A 3NQ2A 3F5KA 5AOUA 3PAOA 3HIJA 2QUVA 3S6DA 1J4EA 1X6LA 4J5NA 3WLOA 1RCQA 4M1RA 2CLKA 3KP1A 4C1LA 4MVAA 3GH5A 2YCLA 3LY0A 5FACA 1H49A 1TX2A 2YA1A 1LP6A 1WP6A 2PDKA 4DBEA 2XVLA 2PF0A 4W8AA 4WLCA 2J62A 4D9PA 4DXVA 3TEVA 3U0HA 2RJHA 3EB2A 3T0CA 4G1NA 1CYGA 5A8GA 3EWUA 4TX9A 4LF1A 4ZXLA 2BHZA 2NLYA 4KT2A 3CQIA 1E4LA 3TSMA 2V2DA 3TC7A 2CERA 2O4MA 2XH2A 4ZO9A 2W66A 5MKGB 4CNNA 2DJXA 3EX6A 2B81A 3GU9A 5HNUA 3WQGA 2PDGA 1ISZA 4RPQA 3BL3A 2VVSA 3CT2A 1FCVA 3K4WA 1JAEA 4NF7A 3OIXA 1DJQA 1EIXA 1XLHA 3VD5A 5CSUA 1M1BA 3RJXA 2VFIA 2KX9A 4JY9A 3NDYA 1L2QA 5J8LA 1A80A 5EMMA 3FIGA 3LGDA 2VEMA 2YDSA 1EP1A 2E28A 3WZ0E 1IV8A 5C0QA 4UMCA 2XN2A 1HO4A 3IUHA 4G5DA 4YHGA 2BP1A 3LCXA 4H9VA 2E6DA 5D9MA 2OZ3A 1JDFA 4ZQMA 3GY1A 3SAZA 1YBQB 5BOEA 1ZNNA 3QTGA 1MQPA 3L5AA 3QGKC 3R79A 2XH7A 4JX5A 4HCLA 2GGEA 1BWKA 3ARXA 4XZIA 2JK2A 3MYPA 2DZUA 4MB1A 3O6YX 4GYPC 2CXEA 2FH8A 3IGUA 2Q6ZA 2HNHA 2ANUA 1QI2A 1JNDA 1KNWA 4LCRA 3PZTA 1KXQA 1NF0A 2WBKA 2D23A 5G4EA 3N9SA 5JBEA 4DXKA 1SJBA 3LN3A 4XD6A 4AY7A 4Q6XA 5AYZA 5I0DA 2QJMA 3EOEA 3VFCA 1EO5A 3E02A 1MW3A 4XUGA 5GNYA 4C6IA 3WBAA 2OJPA 4NNAA 1KTCA 2YOCA 3B3DA 2ADAA 4XBSA 5FAJA 1CGYA 1V7AA 4O18A 3TNOA 2EGZA 5CBJA 1KM2A 3ABRA 4V27A 1YADA 1LLOA 1A5NC 1K7XA 1K77A 5DT7A 4XB3A 1UPPA 2ISVA 3VGFA 1KRAC 4NNBA 2BMBA 3ZVHB 4XG1A 1E9ZB 1WXYA 1EX5A 2ZRVA 1YTKA 2YXOA 3W76A 1VFMA 3T2PA 2ZQ0A 4CN4A 4DWSB 3RLHA 3BW3A 4JXCA 5IM51 3TXVA 3AU2A 2ZZ2A 4NJJA 5EMJA 4PUNA 2GVJA 2FYMA 4S3JA 2TMDA 1MDRA 4MYAA 1ONWA 4LS0A 2BVDA 3AU6A 3CZLA 1AK5A 4PR4A 3VTRA 3DC0A 4IISA 3IUIA 1TV5A 4XZBA 1HIZA 1GVSA 2YLAA 4GIYA 3EKGA 3BVJA 1G01A 1HQTA 3WENA 4QAIA 3N13A 2VCCA 4MMWA 3N73A 4LU0A 1SO4A 4PL1A 1E3XA 1XGZA 4C7FA 2X1UA 2A3BA 4LAMA 4PEKA 5H1WA 4B16A 2HPIA 1YLVA 3OIHA 2W67A 3SM0A 3C0LA 4AD2A 1HG3A 1CXEA 3CUJA 4JZ5A 2CKSA 2WWDA 1XR2A 2PDQA 1NY1A 4UTTC 1LOSA 4AHQA 4K8GA 3WH7A 1W56A 2CLIA 2DUAA 2WVSA 4GXWA 1PZ0A 1WKEA 4HSHA 2Y8UA 3AJXA 3MHGA 3PPGA 3O6DA 4JCLA 2YKKA 3GDMA 4DQWA 5FSEC 2DUZA 2VC9A 3VZZA 3WLQA 3E2SA 3VGEA 4MM1A 3AYTA 3TA9A 1W9VA 1ELSA 5AVHA 1E5JA 2CPUA 5M03A 1ZALA 4MJZA 4S3DA 1EDQA 1FH8A 4YXGA 3TTOA 4QE4A 1XYLA 1H0IA 3W7OA 3A4XA 3DUGA 1GCYA 3CAQA 1XYBA 1J8VA 4WR3A 3W7NA 3BMWA 4AVNA 1JPDX 1XC6A 5BXRA 3M07A 3P14A 3G1YA 3GDKA 5C2GA 4BF5A 3W4RA 5KZMA 3DFOA 2QCDA 1TPUA 4XAPA 1J9YA 1V08A 4FXSA 3GUGA 4LW7A 1UKPA 3CQ0A 1V6XA 1YIXA 1U1JA 3F5JA 1KFKA 1PIGA 1U30A 3B9EA 4GI6A 4Q4PA 3H2CA 2PDIA 3TTEA 1B3VA 3GSMA 5CCZA 4HN8A 3UESA 4OUIA 3G6MA 1EOKA 4H2HA 3A24A 3ZIZA 4G9PA 1XDMA 5CPOA 3QKEA 1KQYA 3AHTA 4ZE4A 4CGTA 3ES8A 2BASA 3DAQA 1EA0A 2OEMA 3WLLA 1VPYA 4S1FA 5EKYA 1BGGA 3SJ3A 3RX2A 1W0MA 3Q94A 1JDCA 4WY0B 3WLTA 1BYDA 3JVAA 4O53A 4WIWA 2C1GA 1J0IA 1JQXA 2A85A 1XKYA 2PA6A 4WDWA 3WF2A 2GVLA 1P7TB 1XPYA 2OQYA 3IAPA 2YZRA 3QC3A 4LUIA 1RVGA 3U2OA 3B04A 1PCWA 1VEOA 3WQDA 3KWSA 4ZB2A 2YXGA 6XIMA 2AKMA 3WQCA 4IMFA 1ZPTA 2YW4A 3SN4A 1E0WA 3UXKA 1W1B1 2PDJA 5EY5A 4JTAA 4J3WA 1AD4A 3RX3A 5C9WA 3WLRA 4ORIA 4IP7A 3M0ZA 3LERA 3FEMA 1VC4A 3L4TA 2YXXA 1R3YA 1PIFA 4S3KA 1D8CA 4IM4A 4PB5A 3QZAA 1PYFA 4PUDA 4MPQA 1K8CA 3S83A 3QBUA 1V3LA 1Z8AA 4H19A 3WD2A 3QPEA 1TG7A 2FLIA 4DN1A 5HR7A 2OSXA 2Q8LA 1UZ4A 1OM0A 1DE5A 4L65A 4QNEA 3MI2A 3THAA 1NM9A 2YFOA 2GZXA 4KWWA 5DCBA 3F4WA 4ZVJA 4E3TA 4UCGA 4DIAA 3ABQA 3QMTA 3ZJ6A 1ZJHA 3GBEA 1QNOA 4IIEA 4LJ3A 1Z89A 2EF9A 3SCUA 3VCNA 3PBWA 3G0XA 2QJHA 3KCOA 3BAWA 4Q3MA 1XH0A 4UUIA 4HA0A 4LS1A 3WNPA 2XFRA 4RXGA 3S9YA 4LBRA 2E1WA 3TU9A 4E2DA 4EPKA 2PBGA 3R58A 4F2UA 3QPZA 4ROPA 5FF4A 4WKAA 4ZENA 3RLUA 1X6NA 1SFSA 2Q8XA 4UTUA 3BTNA 5CJNA 4EPDC 2ALDA 4FK9A 4P8XA 4QDWA 3W83A 4Q7BA 3W1NA 1UJQA 3PWGA 2EAWA 3MP4A 1MUWA 2PDCA 2WVUA 1GOMA 5I78A 3VABA 3LGGA 1R3SA 2GL5A 3KUMA 1XLKA 1O94A 2PGWA 1X7FA 1ZTVA 2ZA1A 3L4VA 4DO7A 1RQBA 5AB3A 3O63A 5D9OA 2RAGA 4Y8EA 3A5FA 4MY9A 1H50A 3TW6A 3FEQA 3AALA 3UWYA 4M80A 1TPC1 4HU4A 1EZ2A 2GJLA 4J3XA 5GVJA 2NV2A 2Q3OA 3LPFA 2WMFA 2MUCA 1AQHA 3TH6A 1VAHA 3D47A 4HU0A 3NPUA 4LUSB 3TCSA 1UC4A 2GGIA 5HPCA 3G1RA 4GZEA 3CQKA 3AICA 2AOSA 1H63A 4L80A 2FIQA 4N02A 2Q01A 1KWGA 1E4NA 3OP2A 4KCTA 4L6OA 1HJVA 4XAZA 3HTWA 4JTFA 3WLSA 1F8IA 1PZ1A 4ZQOA 3N14A 2GK1B 1PX3A 1P0KA 2J6XA 2D0HA 3LV6A 1V77A 1E56A 2V6AA 3WK2A 1FHDA 1CB7B 1KGUA 4B91A 3WBYA 4OZOA 4YTSA 1ECEA 2VR4A 1J2WA 2D22A 4JEJA 4C6EA 1ZAIA 3T9PA 4F0LA 1JL8A 1ADSA 4LTSA 4F2BA 4JX6A 4QISA 3CHEA 1KXVA 1FH7A 2XH0A 3NEVA 1KRMA 3GQYA 5IBXC 3DGRA 3NQ7A 4OHQA 1WBHA 1EC7A 3AIQA 2VD9A 2CHRA 3NSMA 1FQ0A 4FOJA 1Z7AA 5M17A 7ENLA 1IXPA 4QG9A 2GJXB 3F4DA 1H60A 4D2JA 3MU7A 4M6PA 1JXJA 3QHOA 2PWGA 2DZXA 3P62A 1CZ1A 1W3JA 1KV5A 4PEEA 5FEZA 2VT0A 1XUUA 3M44A 2PDWA 4UB9A 2E6FA 2IKJA 4ZFCA 1MFUA 4QDPA 1JYVA 2WZHA 3TQ0A 3UERA 1R9ZA 2ZUMA 3GU2A 4AISA 3EYPA 3BWWA 4JOMA 3N29A 5D03A 1M65A 3GE7A 3GVWA 4LCSA 1HL2A 4B90A 1UD5A 5I5RA 1X39A 2XHYA 4J1OA 3UYCA 3O3RA 3P0XA 1REQA 3PBUA 3R12A 4J2MA 1HL9A 2F6UA 3IUDA 2XZ7A 1P6BA 4H04A 4O54A 4C6FA 2YLLA 3FKKA 4DY1A 1A5LC 4GIEA 4AC1X 2XIJA 1A5OC 3FSTA 3VDGA 3NQCA 5A94A 1R2SA 2PMQA 1K4HA 3MI6A 3PBYA 3MCNA 1JGMA 3RJYA 1TA3A 4DF1A 1CT5A 4C6DA 3IJ8A 1D3GA 5G5IA 2ACQA 3UVAA 2J13A 1AJ0A 3CLWA 3ZVIA 2FTPA 4TTGA 5I3JA 1A0CA 3ENLA 3UU0A 3ARUA 3ZT5A 2X2YA 1DE6A 1XQLA 3UGVA 4YCPA 4N0RA 4JAWA 1OFPA 2P53A 4WXZA 5G2HA 1UH4A 4LRSA 2H8XA 2UV8G 1MUMA 1S2CA 3TYZA 1K9TA 2GPTA 3W2JA 3R0DA 1KFJA 2VOTA 2ZC8A 1TMHA 5LIXX 1XYFA 4KEMA 1UHVA 2OU4A 4PTVA 2C16A 2VDHA 3P8JA 2QF8A 1SW0A 5HNNA 1Q8JA 4DUWA 4JTLA 1G4EA 2XIIA 4HHLA 3UY7A 2AGTA 3FVMA 5BWFA 2X1TA 1W1YA 3OZPA 2DSKA 2X42A 3A47A 1BSIA 4G7EB 4F0MA 4AHPA 3KVKA 2DT1A 4E2BA 3ZLHA 1VKFA 3WF1A 1C3FA 3USZA 1XLCA 3U6WA 3H7RA 5G4WA 1RPXA 1EOMA 5KETA 1CW2A 1YDVA 1QPKA 1B90A 4PMOA 4YVVA 4IMEA 5DCEA 1WO2A 3KE0A 1IXQA 1OY0A 4HNNA 3GLCA 3R4IA 4O15A 5C8BB 1J5TA 1KTNA 3ISIX 4PUEA 4QE5A 2ZZ6A 5FA5A 1UOZA 2R24A 3VOFA 1DIOA 2ZUVA 1UCWA 2Z7KA 4N6EA 4JIHA 3E6EA 2CW6A 1AH0A 1Z41A 4JIQA 4DJEC 1JD7A 3GC4A 2I16A 1DWJM 5DO8A 2IMRA 4A2RA 1QU4A 3NDZA 3WK3A 3HF3A 1F3WA 4JTDA 3DG6A 1F61A 4GCAA 4B3ZA 3HPZA 4DZAA 1RJQA 3KOFA 4UTJA 4A35A 3R25A 4TOQA 3OA5A 1QW9A 2QXWA 4C6BA 4DJFD 4GH1A 3GNRA 3PPCA 2HBVA 3EPNA 3UWWA 1TV7A 4L4MA 3GHUA 4NASA 2VD8A 4PBGA 3GUWA 2CIPA 3NQFA 5EMKA 2RFGA 1FRBA 1X98A 1J79A 4CNOA 4Z2KA 3AFBA 6XIAA 1GKRA 1K6WA 3BQ5A 5HAOA 2FZBA 2FVLA 3VDAA 2FFIA 1GQIA 1XQKA 4H8UA 3WQWA 4MNLA 2Y70A 1GT8A 1RZMA 4O28A 4O52A 3OOQA 4HNUA 3TJXA 4HTBA 1GJPA 5A6TC 1LT8A 1YX1A 3PFMA 2E6YA 1XC4A 2VX7A 3WJSA 4CQAA 2VEGA 1XBXA 3RITA 4QFUA 1UA3A 2B7PA 4Q7NA 4YVPA 3S8HA 2FPYA 4W7WA 1BD0A 1EXPA 3L7RA 4NILA 4OTKA 3G6LA 4Z08A 4FEZA 3IV3A 2AMXA 5KITA 4I9JA 1XF0A 1NH6A 4CNPA 3LCFA 3W0KA 3PTDA 3CV7A 1M68A 1XH2A 4DAFA 3W7DA 1J2BA 1YYAA 1DQWA 4TR9A 3FK4A 1WZKA 1J18A 4HZ8A 3GTHA 1EJ7L 3N4AA 3TSBA 1NU5A 3MA8A 1QI4A 1TZ9A 1VEMA 2YYTA 4GCXA 1VLWA 4C6LA 1W31A 4HZ7A 1KBJA 2INZA 2P10A 1B30A 1V0KA 2V5BA 2WHLA 3VKBA 5D38A 1HJWA 5AHIA 3TV8A 1U5JA 2VHLA 1XV8A 2EPMX 2OOFA 2QDDA 2NW0A 5IRPA 5KMYA 4HK7A 1UWTA 3HGRA 1U22A 3WLHA 4JHZA 2NV9A 1O5QA 1K8YA 4R7OA 3SGGA 5HPOA 3ME3A 3VFLA 4GQQA 4ZEPA 4HZ6A 1KWKA 4E8GA 2DIJA 3VO0A 1YE4A 3TN5A 1F3XA 2PDLA 1ML1A 4AHOA 3NQ6A 3WD0A 4L1WA 4PB4A 2E8YA 3VI2A 5T8GA 2R1LA 2VFEA 3E0FA 3EDEA 2VRJA 2WCAA 4DF2A 3GVVA 2JF7A 4IX0A 3W7CA 3V7PA 3O7UA 3VGGA 2BXZA 4N7QA 3N2XA 1RVKA 1TWSA 3GS6A 1V93A 1CCWB 3VAVA 3D6NA 4JNZA 7A3HA 1N8WA 5F7UA 2Y24A 1AG1O 3FXYA 1PXGA 3GNDA 3WMBA 3UJRA 3IANA 1XLJA 1UWQA 4AG0A 2C13A 4UC5A 1M7PA 5CZJA 2YFNA 3LS9A 1XLMA 4MOZA 2EPOA 1S5TA 2Y5JA 2NXHA 1DIEA 3I3EA 2I5IA 3FGCA 1C92A 4GVFA 4QTGA 3IRSA 1RV8A 1SFJA 5ABHA 2XIBA 4GFSA 3W72A 3G1FA 3TTYA 1LZOA 1Q2SA 1G7UA 4X22A 4ROQA 2EPLX 4Y90A 5DRCA 2E67A 2ONEA 3EDJA 3VX0A 2R9RA 1W2VA 8XIMA 4NYYA 1ZB5A 7PTDA 4JTGA 4GJ1A 4H2CA 1I0BA 4FHAA 3UR7A 2V30A 4Q4OA 1J0ZA 2WC7A 1FWAC 1EUNA 4U3AA 3I65A 5G2WA 5D32A 4J9JA 4IZGA 1NQ6A 5F2LA 3KVMA 3W2MA 2OKTA 1NDVA 2CLPA 2WPBA 3EDKA 2VKZG 1XRFA 3NFUA 3UPMA 1YDNA 4Q8TA 4GZJA 2C71A 1ZQ5A 1W32A 1MWOA 2WVVA 1ZAJA 2QPSA 2CLLA 3IIVA 1IYXA 3NQ8A 3N34A 1RP8A 2WAGA 1BQGA 3AHYA 4AWUA 5HOSA 2YCKX 3GAKA 1XSIA 3NWRA 3MC5A 4B5NA 4WHBA 4J3ZA 3RPDA 3ARZA 3LI0A 1SYTA 5CQ1A 1PZ3A 3W26A 5A69A 1E43A 4K68A 4F0HA 2VNCA 4MAZA 3HN3A 4ZOEA 3HBLA 3WIJA 1QBAA 3M0MA 5C5YA 2A3CA 3CHVA 1H1ZA 4DWSD 1EJRC 3GXIA 4Q8MA 2DVUA 2HDJA 5CLWA 3AHVA 3C0SA 3LHUA 4B5TA 1IT0A 4ZOAA 4H3DA 1Q63A 4G6CA 1XD1A 4RUBA 3KBSA 2ZUNA 2V81A 1QHPA 2XTKA 4D8LA 4Z2LA 4HPNA 2H6RA 3F4NA 3W87A 3ZS4A 1MYRA 5A8MA 4QJ3B 3ZQ9A 3AO0A 3WJZA 5HQLA 4DZ5A 1G6CA 1KBBA 5BMXA 1Q6GA 3LMYA 3GR4A 3UG5A 3W7MA 2Z00A 3VMPA 3DI1A 1GK8A 2ACUA 4M1BA 1A5KC 4WX2A 5I00A 3F2CA 3DBPA 2F9RA 2J7HA 3G1DA 2CZDA 1EEPA 3QN3A 1KW1A 3FAXA 4O0ZA 2OQHA 3W1TA 5EBUA 4IL2A 4O11A 3SO7A 4MSSA 4C6CA 1O6IA 4O8AA 3EBVA 1SFLA 1CLVA 3W1QA 4HPGA 2Y62A 3PUEA 1VFLA 1V6WA 4BS0A 1A5SA 5E93A 4DELA 5CZKA 2X8RA 4GX9A 4H9YA 1VFOA 4HU3A 4IOTA 3F7JA 5I2UA 3W1XA 3TC3A 5TBOA 3JZUA 4H9XA 4NZ3A 3CZEA 1YXYA 2QUTA 3KZPA 4HMCA 4DYEA 5JMUA 4M6QA 5EL1A 1AW1A 4JKMA 1OFOA 5CLTA 3KW3A 3R89A 2DW7A 4GGHA 3ABXA 3NEHA 4GY1A 5B7ZA 2J24A 4LUTB 3WLJA 2Y7GA 1VJIA 4HMEA 4J40A 2INFA 3ZWTA 2W61A 2PDNA 2CBIA 2P3EA 1F74A 1U2YA 5FIPA 3CUZA 1XIIA 3NZRA 1J01A 1KBLA 3D3AA 3QTPA 3ABSA 3HPFA 1XLAA 3R8GA 4GNJA 2PGRA 4JBRA 2FDSA 3UQNA 1IXNA 5H8MA 4P7OA 3HV8A 1O66A 5DMNA 2HE8A 1J5SA 4HB7A 1EGZA 4J3TA 2HTMA 3ERPA 3WMSA 4OVXA 1B0IA 2F38A 1N7KA 1H5VA 2BHYA 2ZRUA 3FCPA 3NAVA 3T0DA 4QG6A 2HJPA 1RY8A 3P7YA 2YCIX 1KM4A 4RE4A 3DI0A 1XXXA 3AZRA 1H09A 2UY4A 1IT8A 4WQ6A 1PHQA 1OEPA 3LU2A 1J93A 4IH3A 3H22A 1KA9F 2VQTA 3JR2A 3POCA 4MJMA 1BPLB 2OWXA 3B03A 4POCA 1MUCA 3H12A 3BC9A 4P8UA 3CB8A 1HW6A 1Q6CA 1OX6A 1H41A 4XAGA 4B9YA 1C90A 3OLGA 3UCDA 3ITXA 2CBUA 3T44A 3TE9A 2YZ5A 3F4VA 3NQVA 1LLZA 2ACSA 4HNOA 3STGA 2V5JA 1K9FA 1V0MA 1I45A 4PULA 1R87A 2E9LA 3V75A 3U48A 1BLIA 1VBJA 3OA3A 3T40A 1ZCOA 2DZBA 3BURA 3TK7A 3GVRA 2D20A 3KHDA 3OVGA 2IXUA 4HYRA 4IIHA 2CLOA 1CGXA 1Q4NX 1PDYA 1LROA 2WVTA 2IQDA 1I9CB 1W5NA 4WJXA 1ZBVA 3Q58A 1G67A 5I02A 4IQDA 4PUJA 3IEBA 3O05A 4RKAA 4E2OA 1QOPA 3GH7A 2PZNA 1XYMA 4MUZA 1S2AA 3MVIA 1GOIA 3U7VA 2ZTKA 4O10A 4E38A 3ALFA 4YNGA 1UWIA 1XISA 5HK4A 2G3NA 2OQLA 4LB3A 4Q4RA 5DCDA 4GQ0A 4O19A 2QDGA 2V5DA 4B2DA 4H8HA 4ZR8A 1EJVC 3VKKA 3VIKA 3ZVHA 4WF7A 1LLWA 4LYRA 2OVLA 1TV4A 4HZMA 4ERGA 1Z69A 3GW3A 2WM1A 1FCBA 2VX5A 3M6YA 1NEYA 3UNTA 5AHMA 1VGAA 3H6OA 2XU2A 3OZMA 1SJAA 2A1YA 5GPRA 1BYCA 2ZRXA 1VR6A 4V15A 3EA3A 3W82A 4LAOA 1XSKA 4XD4A 5FL0A 1Y5VA 1CLXA 3MANA 4V1XA 5CBIA 3HFYA 4MWAA 4DPQA 4GYPA 3ITTA 5I07A 4FNRA 3IVUA 3FN9A 3MUZ1 1OQFA 3R6IA 3SI9A 3L23A 4W5ZA 4CD5A 3ATZA 3HQOA 1L6WA 2C3ZA 3IVTA 1W8GA 3P80A 3GFXA 2D2JA 3PANA 1SUXA 2E6AA 1LQAA 3VOIA 3GDRA 2X41A 4BA0A 5HWJA 3AQUA 3EX1A 1J10A 3WFZA 4TVDA 1CPUA 1UD4A 3DFYA 4O1EA 4GQGA 4M7TA 4JYEA 3EXTA 1MQRA 1V3IA 2QMJA 1W3NA 2SFPA 3SUTA 2XJ7A 1MNSA 1QOQA 3M4HA 5LXEA 3H4XA 2XH4A 3EWCA 2PDFA 3SFKA 3W86A 2OYKA 5GJMA 1R2TA 3EX3A 3T7VA 4BJHA 2WCGA 2PLMA 4DLMA 4DI8A 4GYKA 5ENLA 3U4AA 3LA4A 3AMGA 1JUKA 3WUFA 3TQKA 2XVKA 5CKSA 3SIMA 1NDZA 4OE7A 5I03A 4CEXC 1GVFA 1LJYA 5FF7A 3ZSTA 2NX3A 1K7FA 2WXDM 4DUXA 1JPIA 4KCUA 2FZ9A 3CH9A 3N9KA 3WEOA 2ZZ5A 3W88A 1EC9A 4WSHA 5CPTA 1MRQA 4X63A 1HKVA 1X1ZA 3AIWA 3B4YA 3HPAA 6ALDA 5D8ZA 3MCOA 3LTSA 4PMZA 3RU8X 2IKGA 2Q09A 4DAIA 1OYAA 5D2YA 4AWEA 3N6HA 3JRKA 3S2LA 1QK0A 4XX6A 2VX6A 3GHTA 1KFEA 1ZP4A 3TONA 3A12A 4DZIA 5DLCA 2Y7FA 1QO5A 1QTWA 1ZLPA 3KDNA 2ZRYA 5GQBA 2B7QA 4Q4SA 3N25A 5DF0A 1CEOA 2Y85A 5DELA 3NGJA 5A6BA 2OR2A 4N4QA 3E96A 1MNZA 3C3UA 3M64A 2E77A 3TKFA 2W62A 3E3HA 3N2BA 1TB3A 4NNCA 1IXOA 3IJ9A 1Q6FA 1LL6A 4PE8A 3EGJA 2CWNA 4Y9OA 4C7GA 3ARQA 1H61A 4J35A 3WQ6A 3OJGA 1TV3A 1XP3A 3RNDA 3WH5A 2XGZA 3W2KA 3OTRA 3IJ6A 3A23A 3WMCA 3TJLA 1NFPA 1KTBA 3KOXA 3IK4A 3T07A 3UJEA 1WKFA 4HK5A 2NLIA 3AIEA 1E3ZA 4JX4A 2CNCA 1L0PA 1CNVA 2YSWA 4OOUA 3S5OA 1EGVA 3N19B 2Y88A 4BF9A 1GZ1A 4KFNA 1UZ1A 4US5A 1OF6A 3OW1A 2OSYA 3TW9A 3AMDA 3CXOA 2YL9A 5TF0A 4W8LA 2ZTJA 2PDHA 5JXQA 3W73A 3STFA 3G77A 2Y7EA 1VZWA 1CXIA 4L4PA 3T6CA 3OPSA 1XLIA 4PMUA 3GNXA 5XINA 1XDJA 4AD4A 4Y8FA 3N4EA 3RXZA 3C3NA 4GI8A 4B3LA 2PDUA 1CXKA 2X1RA 5A8QA 1LG1A 1KB3A 5I7GA 3WN6A 2VI0A 1LCOA 3RM9A 4ATWA 1RJPA 4JFVA 2WZIA 2BTMA 4YL2A 4G1KA 4IFRA 2PU1A 3UG4A 1ODZA 1VBUA 1A3HA 3IIZA 4DJFA 4NL1A 4ILSA 2JKPA 3CAVA 3PAJA 4OGZA 2Y7DA 1E6NA 4LPCA 3WY1A 3KL0A 5I3HA 1AA1B 3ZJ8A 1FH9A 3GD6A 4UZUA 3E2RA 3W22A 4U2ZA 2CZEA 1ZU8A 1KRCC 1HO1A 3ITOA 1V6YA 1DJYA 5HMSA 4E3VA 3ALGA 1FA2A 3NXLA 1HNYA 3EXSA 1GYNA 1PTDA 3AXHA 2GWGA 2WVVB 3HOJA 3UT0A 1MSSA 5F1VA 4BCEA 3GR8A 3N9RA 2J47A 5CC6A 1TJ2A 1J0JA 5A6LA 4INFA 4L9ZA 1R86A 2QULA 1UROA 3LB0A 1TQJA 4X0NA 3D46A 3V1PA 5A1AA 3DYMA 4AYGA 3WK1A 4W8BA 3G1VA 3WBXA 1FOBA 1KCLA 3KTXA 2VO5A 5BRQA 1HN1A 4IPNB 2PWUA 3V1HA 2CHNA 4AZCB 3RX4A 3BOLA 1QI0A 3GDTA 3O16A 4TVCA 2PTWA 1DKWA 3TMQA 2PPGA 1EJUC 3SCWA 3GYCA 1VJSA 1VJZA 4QRNA 3AMLA 4TU1A 3RU6A 2Z2BA 3QVQA 1EPXA 1F6KA 3NQEA 4A4AA 2FVMA 3UETA 4NI3A 3GTNA 4WCJA 1E6PA 3LHVA 2V8ZA 2UZ9A 2I1OA 3FHAA 2WMGA 3NL5A 4DNHA 3FDKA 2PB1A 3QR0A 4UQAA 2PWDA 5BWAA 1IIGA 4HOZA 3M6DA 3AXMA 2F84A 1YBQA 4C6KA 3DFNA 4DLFA 3PF3A 4IF2A 3BARA 4H7VA 1OG0A 2V82A 1AUSL 1B54A 2XVNA 3FJLA 1AQFA 1D8WA 4IMDA 1KR0A 2E1DA 3BCJA 3CMGA 4PN2A 1YKWA 1TIWA 2HXTA 3CAKA 2QV4A 1UQZA 3ZT7A 3CV1A 4Z1CA 3OU8A 1VCFA 1FX6A 3VKJA 5HMDA 4DWDA 4ZOCA 2XGIA 1S39A 3AWOA 1W37A 3L66A 5H91A 5IBXA 2BVYA 1EH9A 4JDBA 5A8OA 4JYDA 1UMYA 3K2GA 1LL4A 4PCNA 2WNZA 1RUSA 1SGJA 1UD8A 1HX0A 3CHDA 4DYJA 2GQAA 2XINA 5IHSA 1KFCA 3S2CA 2QS8A 3AHZA 1KQZA 3QOMA 3MQTA 3I7SA 3SUWA 1R38A 2FZNA 3O0KA 2OO0A 4MKVA 4H6KA 1EJXC 4H6QA 4LRTA 1VHNA 2ZCGA 4CN1A 1QO2A 2BY0A 1JPKA 1OYCA 3GXFA 1TWIA 2PP1A 4ADUA 1W5OA 2ZX8A 2UY2A 1WDQA 1HJSA 4AXNA 3WLMA 4XD3A 4XVDA 1C9DA 4EK7A 2JGYA 1Q2RA 3V0UA 2DV0A 4PRTA 3WUBA 3CWNA 2BVTA 2O9OA 5K2ZA 4X61A 2DZAA 3B8UA 3PZIA 4NRRA 3KBMA 1SSGA 1GG1A 4RNIA 1RK5A 3C4UA 1FCQA 2FZDA 3W2UA 1SVDA 1DWFM 1XG3A 4HT3A 3W29A 4JHMA 1XL9A 3GVGA 3TN4A 4JIEA 1CDGA 3N4FA 3DEQA 3LCHA 4DBWA 3UPWA 1HFBA 3UWEA 3QH2A 3V36A 3HURA 2GDUA 3VXGA 1W3IA 1R0MA 3M0JA 3RGTA 3SBFA 4MIMA 3TA6A 3W1UA 4EWJA 3BE7A 4GJJA 1OFAA 1W5QA 2JEQA 4TVUA 2PODA 4B4FA 5HNRA 3UEQA 5C55A 1MW2A 2OGYA 3VIOA 5G1MA 3EDDA 1UKOA 3PS7A 4L6DA 1RCOB 4AY1A 2IQ0A 3B97A 3SUUA 1QHOA 4I6VA 6CGTA 1B2YA 3WNMA 1LYXA 4D6IA 4IIDA 3MWAA 3LXCA 1GPFA 1NWTA 3GX9A 3APGA 1F4HA 1DWHM 3LD5A 4WVXA 5FCZA 4S2BA 2WWCA 1R7OA 1Q65A 1TX0A 3W7EA 6A3HA 3W1LA 3OG3A 1FXPA 3W2LA 2FPTA 3CIXA 1UR3M 3WUEA 3C2YA 1W54A 2WLZA 3FAWA 4GUJA 3N2MA 4AIEA 1HZYA 3E1F1 4QSFA 4DJDA 5C9ZA 2PBOA 4BKNA 3U2EA 4A2SA 4EE9A 1YTDA 2PRHA 2A3EA 3IIXA 3WF4A 3ID7A 4JTRA 2Z2UA 3QC0A 5M5DA 5K4ZA 4HNCA 2RDWA 1AL7A 4ZA0A 5DMMA 3W23A 2BGNE 2TODA 3QJAA 3BGGA 1WAWA 1VFHA 3WLNA 5JVLA 4MYXA 4O14A 4K7VA 3INPA 3ZR4A 3OBKA 4U33A 1E6XM 3ZZ1A 5CSRA 5M3WA 1CXHA 4MTVA 3ITVA 5AC8A 5AZ1A 1OGGA 1B3ZA 3QMSA 3V3WA 2UBPC 4EIVA 5EMYA 1Z9AA 5DN1A 3MYOA 3BSMA 5FSDC 3F03K 3KVJA 4Z1AA 1E9IA 3NR0A 2R8WA 2HWGA 2QJGA 5KZDA 4JD4A 1TUXA 3URQA 4AEFA 5E1QA 2PU0A 3O2LA 4O13A 2OEJA 4M7SA 3EEGA 3L67A 3FA4A 2FMOA 1JZ3A 3A4WA 4NJHA 1VCVA 1BQCA 3M0IA 3K13A 1QHZA 2DUXA 4KRZA 2OWCA 4AUBA 1R2RA 2WJFA 5CC7A 3MS8A 4C7DA 1FWHC 2Z26A 3HGOA 2BY3A 1B57A 3GM8A 2BG5A 1GUVA 1KLYA 3HO8A 5BCAA 1JGIA 1NAL1 4Z2JA 5CPMA 3O1NA 3REQB 3GK0A 4MGGA 1DWGM 2BX7A 1WE5A 2G4FA 4GA8A 4B5SA 2FKPA 4GINA 3EEZA 3FJ6A 2J8TA 3W81A 5AZ0A 1OCQA 5HANA 4KMQA 5CH9A 1ISXA 3VD4A 4FLQA 3ECQA 1E15A 3G0UA 1LRQA 5HQMA 2ZADA 4TXEA 1QAPA 4PMQA 3S1UA 3KX6A 3MP5A 1HVQA 1O1HA 4AZ5A 4MZYA 3STPA 3PWIA 3W37A 4NIRA 1DYSA 3CEUA 3GXNA 1GVIA 3HQ1A 3ARWA 4A3HA 3TN6A 2CBJA 3KEHA 3UXIA 3EX2A 1FWRA 2VGIA 4G8TA 3OVRA 3I7RA 1OX4B 2PS2A 1S46A 2Q71A 4GD0A 1JF5A 1PZ2A 4X2RA 3H2FA 3BG9A 2Z1BA 3PTKA 3VNDA 4GIRA 4MWAD 3OYZA 2VRQA 4O50A 2X1SA 1S1PA 3B8WA 3NYZA 3CHFA 1G1YA 4RZ6A 5LYRA 5J5RA 1QK2A 5CSYA 2ZX5A 3ZR5A 1BF6A 1PS9A 1S5WA 2OG9A 1W3TA 3LQGA 4JICA 4JTJA 1P0BA 2WQDA 1T8QA 4R53A 4M29A 1Z48A 3WL1A 4GO9A 4F0RA 3CM4A 5CZ0A 4Y2WA 5A6MA 1XYCA 3SCVA 5IHRA 4W7VA 2PD9A 2E7FA 1W1IE 3LHTA 4LX4A 4OJYA 2JEPA 4DO5A 1JFHA 4RZBA 1AZ2A 3UZJA 2POZA 2DY3A 2RDXA 4N6FA 1MZHA 3I4KA 3GHRA 2OZ0A 1PDZA 2HK1A 9XIMA 4A6GA 2W5FA 4NAFB 2OZTA 3FOKA 4ICNA 3TMLA 3RFAA 4ZCWA 5DBTA 3QSTA 1OFQA 1XBYA 3LZ3A 4N9CA 1W9UA 4K2SA 1M04A 2NQJA 3RRAA 3DFTA 3EPMA 4F0SA 5L6UA 4D6CA 1HKMA 3V5FA 1UR9A 1IT7A 4PUWA 3L2MA 1WBJA 5HJXA 4O12A 4XSMA 5K3VA 4O16A 4IFOA 4GHRA 2MANA 3TNBA 4S3AA 1NWRA 4V1YA 4F79A 3SSZA 4H9TA 3L0GA 1R5YA 1UUMA 4N2YA 3ABZA 3BZJA 1V0NA 3BAYA 4JIRA 4J27A 3ZM8A 4WDXA 1UR0A 4E4PA 3RN6A 4YYCA 4R33A 5KZ6A 2X7VA 1TKKA 3EDFA 1D3CA 3VDCA 1KM1A 6REQB 3CNYA 3L4UA 2XFFA 2BODX 1H2JA 4LT9A 1JCMP 5BNKA 2XN1A 3ANUA 2XGBA 4UXDA 1W1VA 3V4BA 3FS2A 1GOKA 4PMXA 4GK8A 1H11A 2DDXA 4OFCA 3L2IA 2QR6A 1IEXA 4HIBA 5HJYA 4PUKA 1WPCA 5BW6A 1VENA 3S4TA 3ZR6A 3MUXA 1P0EA 4PMJA 3UBPC 1S2WA 4GRSA 2PC4A 2YBVA 3W27A 3R1ZA 3JS3A 4QS5A 1EP3A 2PF8A 2QGYA 1WKYA 1HGWA 3TQPA 5KZEA 3BGAA 3KHJA 3CQHA 3VPLA 2IKHA 2RGMA 4KW2A 1F05A 2DIKA 4PMDA 2YCJA 2ZDSA 4QHRA 3L12A 4LSBA 5CXPA 4GI4A 2VELA 9CGTA 3WJYA 1MMFA 3W70A 3WD1A 1NDWA 4F48A 1UR4A 3DKJA 3H8AA 1TJ1A 1F8MA 3MWCA 3SEPA 2J7BA 4YN5A 3MW7A 1OINA 4N4PA 2ZA2A 1DBTA 2AQOA 2CLHA 4G7FA 2QV5A 4DJDC 4DM1A 5H6HA 1FWNA 1KBKA 4C1NA 3W53A 3MKCA 5CSSA 5LIKX 1DJIA 4B5VA 3BMVA 1B3WA 3DOPA 4JL1A 1LQ0A 4UOZA 1UUOA 4BHYA 3AYVA 3R43A 1MQQA 3TR2A 3S5SA 1LRNA 4D6FA 1XBZA 5FJRA 4LUYA 4XO7A 5D2VA 3VOJA 2EG6A 3M0HA 1XYAA 1SQ7A 2ZWYA 3W74A 4QJ1A 1RK6A 1NOFA 2GVEA 2VR5A 1JPHA 2GQ8A 3T4CA 4EPBC 1XFBA 4RNJA 2O9TA 5DBUA 5EGRA 1W5PA 1FUYA 5TQLA 1JZ2A 3DZ1A 4PTWA 4W93A 4JY8A 4ZXOA 1YPIA 4ZTXA 5E6ZA 4V28A 4C65A 3DKLA 1FKWA 1HVXA 2XIOA 4TUFA 1K03A 1YNQA 3W38A 4BY3A 4EF8A 1IWBA 2QPXA 3TIMA 3PZUA 4KGLA 1OABA 4MNMA 1H0GA 3EWZA 1A0EA 5XIMA 8XIAA 3QFWA 3RMEA 1ZJIA 3TC6A 5DFAA 1ZAHA 2H9AA 3I3BA 2UY3A 4LWWA 5CPNA 1IIHA 1OC5A 4QP0A 3F2BA 2GWNA 4AW7A 3TWAA 3W7QA 4XSLA 1M7JA 1VCGA 4QDMA 1GVOA 2DU2A 4FALA 3W6MA 4ML9A 4IPIA 2XIMA 4F9DA 2ZWZA 5MHBA 4LEQA 3T09A 3HFTA 1JYNA 4U3CA 3JU2A 4RW5A 2REQB 1GEQA 1DP0A 3SN1A 1UIOA 2GJNA 3NVTA 2CZVA 3UPBA 2CYGA 4DZHA 3PJWA 1EO7A 4YCOA 4DWSA 4DF0A 1L6SA 1TRIA 2NUXA 5E09A 2Y8KA 1XI3A 3FNDA 4GXMA 1G5AA 3KM8A 3MUAA 3KTSA 3NPVA 3IJLA 5MKGA 4H6EA 2R94A 3I68A 1HTIA 3UR8A 1XCFA 1ICSA 3GXTA 3TTQA 1QWGA 4C60A 2DSVA 1FHVA 4F9JA 4U5KA 3AXKA 2FH6A 3S2NA 1TVNA 3H23A 4KIEA 4AH7A 3IK2A 2VRKA 5CPQA 2WCSA 3M46A 5CJMA 3VC6A 2J79A 1F3EA 1UQYA 1DL3A 1F5ZA 1CGUA 4R88A 4QBXA 2VCBA 2G3MA 4AZBA 2YA0A 2W9MA 1VYPX 1PYMA 4DM2A 3SCNA 1M01A 3WQ5A 2OLSA 3NNTA 3FA5A 1NIUA 2GJRA 3PPHA 1UWUA 3GTXA 3M1ZA 3L9CA 5CPLA 1ZJAA 4UTFA 2H3BA 3T8LA 4RDWA 5T9CE 3AWNA 3XIMA 3DENA 3VCCA 4PL2A 4MDOA 3B8TA 4JTUA 2JKEA 3BLKA 4OQVA 3P0WA 1TTIA 4L9XA 1TV8A 3RCYA 3OHIA 4IGNA 5K4XA 2O55A 5DXXA 1GNXA 1M6JA 2CU0A 3GNPA 4ECLA 1EYEA 3IGHX 1Q6QA 3K8LA 4UR7A 1TSIA 3H2OA 2VP8A 3UZXA 2GLKA 3PBVA 2Z24A 4GABA 1SFTA 3RCMA 1N8IA 2V3FA 1BXNA 5A2AA 4YTQA 1TWWA 3W7PA 2DGAA 5CC3A 1T5AA 3F2DA 2IUZA 1O60A 4B92A 4UBPC 4HMDA 1XS2A 1KBIA 1KO0A 3PZQA 1Q5MA 2RUSA 4BEUA 5I3IA 1RLCL 3MMTA 4YIWA 2VQUA 2DORA 3REQA 1SZEA 2VZSA 3AS1A 2PTYA 4HNTA 4XIMA 4AZGA 3DHPA 1G4SA 1PTAA 2QMKA 2TRSA 1QNQA 3KBNA 1TMQA 2IKIA 1EF2A 2OCZA 3AUOA 1QT1A 2A21A 3TYBA 4GH3A 3U9IA 3SUVA 1E0XA 3FX4A 2HS8A 3M16A 1RA0A 2DZVA 1JAKA 1S1RA 4O1DA 4FA3A 4Z0JA 3LRLA 4IQJA 1NWSA 4R9OA 4D1JA 1UKTA 3VNJA 2ACRA 1WDSA 1XG4A 1XX1A 1E6ZA 3QXBA 1IWPA 1XDLA 3HGJA 2WZMA 1Q7ZA 4GY0A 4XZMX 1I2OA 1XYZA 2D3LA 3WD3A 4L4OA 3PB0A 3GNNA 3NOYA 3O6AA 1Y0EA 3BW4A 4OBSA 2QCGA 2FHBA 1RQHA 5G4HC 1W1TA 1EJWC 1T40A 3PBMA 4YYFA 2IPJA 3ARVA 3BSGA 3RIKA 1V3KA 3W00A 3QLDA 2WMIB 4EWND 1KCKA 2YGYA 2GYIA 3RYSA 3AYSA 4I5RA 2POTA 3N3MA 4GPNA 2PWFA 1TR1A 3VK5A 3WDRA 3GXDA 5AYXA 2YPIA 4TIMA 2Y1HA 2R1PA 2J75A 3OGRA 3I6RA 1NDYA 4GC4A 5KINA 4LUSA 3DX5A 4QQUA 7TIMA 3BXWA 2TSYA 1GGOA 3Q37A 5E6YA 4JCMA 3IARA 5FL1A 4GLEA 1OX4A 3BV4A 3V16A 5K9XA 3MZ2A 5AHFA 1EP2A 1AW2A 2VM8A 3TUUA 4QLKA 2PCQA 3LYEA 3OZOA 3I6TA 4WOQA 1OCNA 3VKAA 2NT0A 3NL3A 4FLRA 3SN0A 3QW3A 5DX7A 4X9YA 5M1TA 5HULA 4UQCA 4TMBA 3B0XA 2F2KA 3BLDA 2J74A 3J7HA 1K3UA 3UG3A 1DWIM 1TELA 1LOQA 3E12A 3SY8A 1Q6RA 4X2PA 2FZ8A 1BTCA 3A13A 3CV6A 4LC8A 2I7GA 1IE7C 2ZZ3A 5LNVA 4LB4A 3IPWA 2OLAA 2EG7A 2PWEA 2I9EA 5B7YA 1Z42A 1XSJA 1U33A 1F6PA 1E0UA 1ICPA 3M0KA 4QEHA 2EXOA 1P6WA 4ES4A 5JBFA 3PM6A 1B31A 4GACA 1NVMA 4RZ5A 4GJIA 1DIKA 3C61A 2A7PA 2RDUA 5CGQA 5AHNA 4JIIX 4NI8A 1HJUA 3DYOA 4YTRA 3UR2A 2G41A 2X1IA 5FOOA 3LXBA 3TVAA 2XWDA 4P7NA 1VFTA 3APYA 4IFKB 3P93A 4G7EA 1TPVA 1Y65A 1W2PA 4E2VA 5EFDA 3E5BA 1IGWA 2J9ZA 3KTCA 4ATDA 2JIWA 3BMXA 3LUTA 2ZE3A 4WKFA 4ASTA 3QR3A 1J0YA 1X1NA 5FF3A 2DJLA 4JGDA 4LF2A 3N18A 4J2PA 3WD4A 3WEMA 2PEVA 4AYSA 1CLKA 2QCLA 4LY8A 2F61A 5JU6A 3CTTA 2DH3A 1QPRA 4LOCA 4RV8A 3W71A 1FHUA 1AJZA 2VR2A 5D4YA 1AQMA 1PL9A 1VFFA 3QV9A 3ITGA 1QATA 3XISA 3CUIA 3GG8A 1IQ8A 3WL0A 2QDHA 4HGXA 4M82A 1Q6OA 3T0TA 1F9CA 3UXLA 5FJUA 4ZSUA 4XAYA 4ZB5A 4BFAA 2BGQA 5HUPA 3KBJA 4H8NA 1JRCA 1QOXA 2H3DA 4IQLA 4FAMA 4YHEA 5J04A 4GWEA 3T05A 1UOKA 4S23A 3QQ0A 3SECA 2YL6A 4DUOA 3S9IA 2J7CA 1Q6DA 3B9DA 1QDSA 3LM3A 1W3LA 1UKSA 4LQ1A 1LWHA 1GG0A 2B0MA 3BLEA 3N3TA 1TFVA 3GXPA 3S9ZA 3VGDA 2J4GA 2FGLA 1ECQA 7ODCA 1QI3A 1LBLA 2BFGA 2WSPA 4FX8A 1V02A 2OGJA 2XFYA 4O0QA 4MJ2A 1E70M 1R6WA 2J27A 4E4FA 1Q6EA 2RJGA 1EWEA 5ABEA 2WHMA 1F76A 4B2DD 3NUKA 3GVQA 3CPGA 1AH3A 1E6SM 5ABTA 4NZ1A 1OB0A 5MF5A 4GOAA 3L68A 4I7WA 3PPFA 1SZNA 2GSEA 3NSXA 3MBFA 4L7ZA 1E1CB 1GVYA 3CL7A 4IIBA 2WNQA 2BY2A 3AISA 1OGSA 1XIMA 2AKZA 2QPUA 4IGSA 4P8VA 3PZOA 4AY8A 3WYZA 2OFJA 3R10A 1PKYA 3C2EA 2WJEA 4H9MA 4NP7A 1T7LA 4PCFA 1KLZA 2Y5SA 4CCEA 2NT1A 4DXXA 1FWIC 1QVBA 3UNDA 4JS3A 4H83A 2VC6A 2FQIA 5J5DA 4Q8PA 1VRDA 1WB0A 4XQ6A 4FR1A 3G1XA 3GB6A 1FWDC 3DGBA 1H7PA 2GUYA 2PRLA 3R8HA 5LNRA 4QLLA 3HQPA 3W7KA 3ZWSA 5IFTA 3GW0A 1S3HA 1Z44A 2VTFA 3PFRA 4BI6A 1YPXA 1QPNA 4DBDA 4ZZ9A 3NO1A 3O0FA 4FPSA 4LALA 2WM0A 1SO6A 3FXGA 3GRIA 2FJKA 3C86A 3HA1A 1NWUA 4DYKA 4QJ4B 1VIZA 4HJFA 3W24A 2ZXQA 1YW1A 2ZXAA 2DSWA 2VMFA 1P0DA 3K1GA 5FJJA 1B3XA 3CQJA 4FX7A 4BZYA 1X38A 1EHAA 3FGCB 2ZRWA 2OYMA 2ZDRA 2BOFX 1IF2A 3A9BA 5I3KA 4PGLA 3SCTA 6TAAA 4KWUA 3DHFA 4LBUA 3RCNA 4JTIA 3NQMA 3HG5A 3CWOX 2HSAA 1V4YA 4FOKA 4GFIA 3UJFA 1ZCCA 4U2YA 4IUOA 3VDBA 3SIZA 2PP0A 1VH7A 5BOOA 1EQPA 1GKPA 4LVDA 1F7BA 3IWPA 2WZTA 1L8NA 4EAMA 3HV9A 5C9RA 3R11A 1W3HA 2OSWA 1VPQA 3TWBA 4Q33A 1NFGA 4CD6A 3TZNA 1WUFA 3WDQA 4Q7IA 3OQEA 4DB7A 3T2QA 3URBA 1HUVA 3DH7A 4GMEA 4NAFA 1QPQA 4WGXA 2GQ9A 3MI3A 5E0CA 4R27A 1PKMA 4Y96A 1EEXA 4ORMA 2X7WA 1Q7MA 2G5WA 4TMCA 3CL6A 5D30A 5F2MA 4YWSA 5AC4A 2PE4A 4H00A 1BEUA 4X3ZA 5I24A 3L21A 4LAUA 3GKFA 1W1ZA 1P4CA 3EA1A 3VKCA 3N6JA 1G9HA 5EB8A 3THDA 3NZGA 4CN6A 5FEXA 1LT7A 3KDOA 2OZ8A 5JH1A 5F4WA 3QGAC 3QV8A 1NP2A 3UZWA 3WCZA 3G5EA 4WSKA 3IIOA 3H4GA 1ALDA 2XSBA 4IHCA 3R0KA 2WYSA 7REQB 3A21A 4JQ4A 4OECA 2XVGA 1FWWA 1S2VA 3WDHA 1FWJC 2VWTA 2Y63A 4NZJA 4ACZB 3C6CA 4XZWA 3W85A 4ML4A 3ZYZA 2G97A 3XINA 2V3GA 3W6LA 3SJNA 1PO9A 3LRKA 3T42A 1FDYA 3FHQA 4ZGYA 1OG6A 2CC0A 5AC7A 4DI9A 2BHUA 1AD1A 2VX4A 4YTTA 1UJPA 3TLLA 5AYIA 4KEUA 3G18A 3VIJA 3I6EA 5BMWA 1P6CA 2W4XA 2NV1A 3GH4A 2YBTA 1GOWA 1I4NA 2P3ZA 4M56A 3MPGA 2JIEA 1WUEA 3EWBX 2Z6IA 2J7EA 3QR1A 3TX9A 1PKNA 1GHSA 3ZMRA 4K8EA 5JUVA 1TV2A 1WQ5A 3VNMA 2QDEA 3DC8A 3DXIA 4A8NA 2W0UA 5A6BD 1EB3A 1CXLA 2P5NA 1PCKA 1R46A 1TJRA 1XRVA 3NQDA 1OWQA 3Q67A 5JH2A 1K1DA 3W7RA 3UGRA 2V5KA 1GTEA 1H62A 2VZUA 2VFFA 3S46A 3P84A 3C2FA 2VC5A 1L8PA 4KCVA 4X9SA 4RNHA 4GKLA 4HHMA 3BLFA 7REQA 5I3DA 3LG3A 1F2JA 1SO3A 3M0LA 2C14A 4QAWA 5IXEA 1KM0A 2Y89A 4AX7A 4B5XA 4H7CA 3CGTA 4L1XA 4Q22A 4KIRA 5BXSA 5U4NA 1M7OA 2H8ZA 3WX7A 4Z42C 1DEDA 3KS6A 3ZJ7A 2CETA 3HG2A 4QR6A 4DJEA 1PAMA 2YW3A 1W5MA 2HVMA 2FMNA 3RILA 3LCIA 4PCSA 1I8JA 3CZJA 3QQ1A 1D3HA 1FFQA 3T8QA 3VX1A 1RA5A 4O4VA 2VZOA 1JR1A 4P7LA 4PB3A 1REQB 4KEZA 3UYIA 3GC5A 1MRAA 3MV11 3B8VA 2Z1WA 3TYEA 5EBAA 5LHEA 2WSRA 1L2UA 4YMZA 4LV9A 4B4HA 1UP2A 3DN5A 4ICCX 4Z1BA 1JVNA 1OCBA 1AL8A 1I2PA 1IR1A 3NO3A 1O95A 2OX1A 1K02A 2R82A 4IG2A 4RDZA 3I7QA 1J0HA 1WOAA 3WF3A 1GJWA 3MHFA 3LM7A 1ADOA 4R5EA 3BAKA 4ONVA 1BVNP 3K46A 3PJUA 2VFHA 2XSXA 1XIDA 5D9PA 1LUCA 1MEIA 4NX0A 1TPWA 1JCLA 4NQ1A 1TPH1 4OU1A 2J77A 3P81A 1UWSA 1GHRA 4MY1A 5C54A 4DWSC 3CWHA 4RX0A 4AZHA 3ICJA 2JF6A 4RL3A 2VOMA 1B4EA 1G4PA 4GQRA 1PX8A 1ME9A 4JTQA 3S5YA 1XLDA 1YPFA 3CYVA 2QCMA 4IP4A 5F2GA 1YE6A 1XCXA 3R0UA 3PTMA 5I3FA 1DHPA 4FNQA 2FVKA 2E5CA 3VGBA 2QEZA 1TCMA 3KBWA 3V5CA 3CZKA 4IUGA 4IIFA 2NVAA 2PWHA 3CU2A 3KRZA 3E9AA 1RPKA 5E70A 4I9AA 4R3UA 3S6TA 4NSBA 1DVJA 4M6UA 2WB5A 1N8FA 4LYQA 3MY9A 4RR4A 1XIBA 2C1IA 4W84A 2ZXBA 2E3ZA 4M19A 3NZPA 2IPFA 2OPJA 1AFSA 3TDFA 4WJ8A 2QJIA 5G1TA 5CG7A 3E0IA 3MV01 3BG5A 1UYQA 3ANVA 4PCTA 3SADA 2X09A 4LFYA 1AODA 3K5XA 3W28A 2DT0A 4URIA 5D8WA 1UBSA 2CBVA 3LBMA 3WQ4A 1PEZA 2E40A 4WDUA 4Q4KA 5REQA 4FNPA 1RP9A 1MI3A 4C1NB 4LANA 2DP3A 4QCFA 2ASHA 3IJDA 2BB0A 3LXAA 3LPGA 3BAJA 4NAEA 2QGHA 3M0YA 3BJTA 4UMAA 1VYSX 2AL1A 2EJAA 1ZHAA 2VEKA 1RY0A 3EWXA 1R3TA 4PRWA 2IS7A 1X8FA 3W2NA 5HQEA 1A0DA 2VZVA 3RUBL 2H90A 3PNZA 5LZLA 2R6OA 1W3KA 3AMCA 2HMCA 1VQTA 1BVZA 4B9ZA 2F8QA 1Y8BA 3IJQA 4DEFA 3COTA 2QVHA 5JBDA 1VYRA 1FWTA 3GBDA 1RQEA 1MEWA 5LNWA 5HMFA 2Y4SA 4NRSA 2J66A 4S3BA 1EXBA 1XLFA 2Z0IA 4LV4A 5BRPA 1PB0A 1E1CA 3B0YA 1V3HA 3RMJA 4GBDA 3G8RA 3G1AA 4S3EA 3B8IA 3WUGA 3TYDA 2XPKA 3EWWA 4ZFMA 3MSRA 4OV9A 4PZVA 2JGQA 2QUNA 4AZCA 3FJNA 1F3TA 2OELA 2FGZA 3I3DA 3FV9A 3BCFA 3SRDA 1RJRA 1M3UA 2WMKA 3OVQA 4E5TA 2QAPA 4WRHA 2BS9A 1C8XA 1A5MC 1C8YA 4LVBA 2PI6A 4LEFA 3S6OA 5D9NA 3HU7A 1QJWA 4M5PA 4NVTA 2PLJA 1ZENA 3NA8A 3QSRA 1RHCA 3K8MA 2ZUTA 3CIVA 4OOZA 1JD9A 1M41A 4GNVA 3W1AA 2A7NA 8TIMA 4KS0A 3THQA 3T4WA 5CG0A 3DFQA 5H2ZA 2BLEA 4A3UA 4AWTA 3QYSA 2ZX9A 2WJDA 4MNKA 1OBAA 1SSDA 3G8EA 4K8HA 2PP3A 2Y61A 5CBBA 3W84A 2HROA 4C6NA 2QJNA 4D1IA 5D09A 1IZCA 3K4DA 1OF8A 3P3BA 4EF9A 2Q02A 2E9MA 9XIAA 1ZP3A 1W1PA 4AZ7A 4P7RA 1GVQA 4MWAB 2PD5A 2WMJA 5HNTA 1B9BA 1WZAA 1C8VA 1TR9A 2A6LA 3GYEA 4AD3A 1D2KA 1QPOA 5EPDA 4LC6A 2ALRA 3U5YA 3BAXA 1VD6A 4KRTA 3DHDA 1DJNA 1OD8A 1OSEA 3NZQA 1OIMA 5E9AA 4B5WA 4RDVA 3B0PA 1KGXA 5HWNA 4WKHA 1H3GA 3M7WA 3NQGA 3TFCA 2VZTA 4TV5A 2VCAA 5F2IA 4Z1DA 4XISA 5JQ9A 3EKLA 4FS9A 4FXJA 1ME8A 4DJED 1DJWA 2WMHA 1XIJA 2DFAA 1TQXA 2XISA 7XIMA 5C9UA 4L64A 3BV7A 1W9PA 1YTEA 3S1GA 1V8EA 1SZGA 3LSBA 1E0VA 2W63A 1HKJA 1TUFA 3NSNA 4HPXA 3W7GA 5FD0A 5HINA 4Q32A 2DVTA 3S42A 1OHLA 3LHZA 1R85A 4OWGA 5HUOA 3KOZA 3FLUA 1OADA 4TO8A 1QNVA 1ONRA 1K6AA 4DPPA 4KPLA 3QY7A 3WNNA 3LPPA 1US3A 3GG7A 1E6RA 3A3XA 4L4LA 1MZRA 4F4RA 1WDRA 4C6JA 2QCHA 3C56A 3ITYA 1KKOA 1X6UA 4Z2IA 4BR1A 1FXQA 3FFSA 1RBOB 3A4JA 3QY6A 3RHGA 1EGMA 3U8GA 2OEKA 4UZSA 3S2JA 4Q8QA 4Q8WA 1OZMA 4WUIA 1A49A 1V79A 1W8SA 5I3GA 2QYGA 3KL3A 4A05A 4N9EA 1H7RA 5FKYA 2V2HA 2BVWA 5A6JA 2WK2A 2OB3A 4I3GA 4KWSA 5FF0A 2PAJA 2R1NA 1VLIA 1FDZA 2J7GA 4JQAA 2NQHA 2QUMA 3LZ5A 3TCEA 4DRSA 2D0GA 2O7QA 4A29A 1DJZA 3W1PA 5BROA 4CD7A 2FTYA 1WZMA 2NQ5A 3R5EA 4PBFA 2PDPA 5A8PA 3NGFA 3VMNA 2WSKA 1XRTA 2CZFA 1J96A 3SQLA 3LHYA 3L4XA 3CC1A 1JFXA 1WDPA 4TX6A 1E55A 1KXTA 4AU0A 5K9DA 4AXKA 5C70A 4WSJA 1XLEA 4HTYA 1H7NA 3SGZA 1YXCA 3FYOA 1A3WA 4FB7A 1UPMB 3RO6A 2VVNA 4HN4A 3GWQA 3ELFA 2OWWA 4JNYA 1FCUA 2BXVA 3IJIA 4MADA 3CT7A 2WC4A 1OCJA 4REQB 4U10A 4JFWA 1XLLA 3GFZA 1YQ2A 2W6RA 1UC5A 3UA3A 1O4UA 1JI1A 3VC5A 3VOCA 2CCRA 3BCDA 4GX8A 3N12A 1MXGA 4V2XA 5BXPA 2XSAA 5FJTA 4EKJA 2V2CA 1JCJA 4IIGA 4BI5A 2P0IA 1J12A 1MFVA 2FJUB 3E49A 4AIUA 4XTIA 4BWLC 4IQEA 5ABFB 4RZ4A 1V3JA 1JYXA 4YU1A 3IRDA 4A8IA 4H01A 2JBMA 1G0CA 3KAOA 5A8NA 2CLFA 4FF7A 4L5ZA 2QZRA 3GKAA 5AYYA 1UP3A 4S39A 4H4IA 1ITCA 4RNFA 1NJJA 2VWSA 1FP8A