2ACYA

Acyl-phosphatase (common type) from bovine testis
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
98
structure length
98
Chain Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE
publication title Crystal structure of common type acylphosphatase from bovine testis.
pubmed doi rcsb
molecule tags Acylphosphatase
total genus 23
structure length 98
sequence length 98
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 1996-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2acyA00
2QYCA 1GXUA 1R6YA 2ACYA 4FNIA 2JDJA 2K2PA 5F0WA 3CJKA 2CRLA 1SQEA 1CC7A 4U9RA 2AJ1A 3HHLB 1KQKA 1FEEA 1FVQA 1OQ3A 4A46A 4Y2KA 1TR0A 2W4CA 2GO8A 1TZ0A 2OKQA 2KYZA 2GFFA 1SB6A 1P8GA 4DN9A 1K0VA 3LGNA 5T7LB 3BN7A 4HI1A 1KVIA 1YJUA 2KT3A 2ROEA 4HH0A 1Y3JA 3BDEA 2FHMA 1TL5A 1X8DA 1Y9OA 2HFNA 2Q3PA 5KAKA 1VQYA 3UDCA 1JK9B 1OPZA 1SI9A 2IYGA 2OD4A 2XMWA 4ZOSA 3QMQA 5B0GA 1V3ZA 2HLUA 2AP6A 2OAUA 2XMKA 5B0EA 2K7KA 2PD1A 1YRXA 1WD6A 1XBWA 1X7VA 2FIUA 2AW0A 2K1RA 3KG1A 2QIFA 1N5SA 2FTRA 1KVJA 4FNHA 2L3MA 2RMLA 2EW9A 2GGPB 2XMTA 1Q53A 1Q8LA 4Q2MA 3WDOA 2N4CA 5B08A 4EFAC 1FE4A 4YEAA 3MCSA 3TOQA 2IFXA 5B0BA 1FESA 1TL4A 1RJJA 2OFHX 4OJ1A 1YJTA 1W2IA 3HF5A 2RU9A 3TNVA 4Y2MA 3BGUA 2AJ0A 4NPOA 2BUNA 1OQ6A 2ROPA 1P6TA 4HL9A 2OMOA 3HFKA 2PGCA 3BB5A 1X0PA 2LDIA 2K1RB 4QOTA 2RILA 3CJKB 2N4DA 1Q8BA 3HDSA 3KKFA 4Q2LA 1APSA 4OJGA 5B0FA 1CC8A 1YJVA 5B09A 2BBEA 2LQ9A 1Y0HA 4OIXA 4A4JA 4F67A 5B0CA 1IUJA 3DCAA 3LGMA 1URRA 3IWXA 2GCFA 5A6WA 3T9NA 2ASYA 1Q4RA 2IYIA 4HI2A 2ZDPA 3VTIA 1AW0A 1N5VA 1N5QA 3HHLD 3QGPA 1TUVA 2XMVA 3HX9A 2KT2A 3F44A 2HLTA 1AFJA 4OJHA 3MZIA 3KNGA 1YJRA 1MWYA 2FB0A 2XMUA 5B0DA 2W4PA 3BF4A 1QUPA 2BYCA 3FMBA 1FD8A 4A47A 3BR8A 1CPZA 1S6OA 2RSQA 2HFOA 2GV1A 2HQIA 1YG0A 2K7JA 2ROGA 3DXSX 4OJ3A 2XMJA 1OSDA 4Y2IA 3FGVA 2W4DA 3IWLA 2GA7A 1U7LA 2HIQA 3TRGA 1ULRA 2BJDA 2LQBA 5IXUA 2LXFA 1AFIA 3GZ7A 1JWWA 1GXTA 1LQ9A 1S6UA 2QLXA 2GGPA 2BJEA 3HHLC 1VQSA 3BM7A 2OD6A 3LO3A 3HHLA 1MWZA 2OFGX 4A48A 2KKHA 2QLWA 2ZDOA 4DL0C 2VV5A 3KG0A 1FVSA 4DPOA 5F0UA 4HH1A 1N5TA 2XMMA 5B0AA 3K7RA 2G9OA 4YDXA 5K9FA 2VH7A 5A6PA 2N7YA 5T7LA 2OP5A 3I9ZA 3FRYA 1FE0A 4NL5A 1Y3KA 3E8OA 4ZA1A
chains in the Genus database with same CATH superfamily
2IM3A 4NCGA 2GAHC 4E0DA 5CZVA 1RE1B 3CMQA 1H72C 1XEZA 3CEDA 2R8GA 2ASJA 1RHQB 1D9FA 4E8UA 3FCWA 4DUTA 2VUGA 4Y2AA 3OJUA 4DFMA 1NLKL 3VF0B 2J6SA 4EYIB 1RT1B 1HQEB 2CJXB 1NK7A 4ZCLA 4WTYA 3L09A 3M32B 3UD5A 3CCJS 2LDIA 4F4WA 3WIUA 3WBZA 2KXFA 5E3PA 1EQ0A 3QT5A 1MU2A 2V2QA 2P6TA 3QQCD 4F2SA 4D3HA 2FLOA 1TVRA 2ZC3A 2VG7A 3DGPA 1M90T 1MSWD 3NAHA 2LFVA 3OQ2A 2MKCA 4DL7A 3TJ9A 2IDEA 1HHQA 3KOAA 5I3UB 4NLXA 1ULRA 2BJDA 2CPJA 5IQ6A 2DCUB 4K5SA 2R2TA 2CG4A 1E6VB 2ZZNA 2ZD1B 4DQRA 3BO4A 2CVIA 2MSTA 3N6MA 4ZLNA 4U9RA 3SSSA 4LF7F 4F0HA 2PC6A 4DEZA 3FEZA 4M5LA 4NLOA 3RRKA 1Q1KA 2MLXA 2W9CA 3ZZZA 2QT7A 3U02A 5DM6Q 2XLIA 2Z30B 3QO9A 2AV5A 1TU0B 4DV7F 2QLJB 2WCXA 1RAEB 1RKIA 1NDPA 3IM8A 1VK8A 4QWBA 4ECXA 5A2QU 2LMIA 4ZVOB 1AW0A 4O4RA 1NUEA 4OYZA 2XQCA 1VQ8S 3N6NA 3TP2A 1T3OA 1YJWS 3A3PB 4F0MA 3J7ZT 1IBLF 2ZBIA 4JB8B 3DMJA 1AXQA 4ATNA 2ZJQQ 2HFSA 4DFPA 4NLGA 5GADI 2B43A 2KG0A 4DUYF 1S9EA 3OHAA 1CC7A 4GRSA 3I87A 2VICA 4WU2A 3UVJB 4ZPDA 1KKHA 1VQYA 3D66A 4XIUA 2IJNA 2WVFA 4NRTA 1U1OA 4CTAB 3K5MA 4LF5J 2XSJA 1P27B 4ENOA 1IKYB 2DNRA 1WI8A 2L9NA 5KFMA 4DX5A 2X1BA 3V4IA 3DLLQ 2V34A 5LXYA 3T6BA 4H4OA 5DZ6A 4CNYA 1UA0A 3SFGA 5AT1B 4FXWA 4URSA 4I67A 3RBDA 4YS2A 4EYHB 3MR2A 4B9MA 5GAGU 4IYQA 3K17A 2HMIB 3Q8VA 4YR0A 1I3OB 2DO4A 4USWA 2J9DE 1HNWJ 1SJ1A 1KNZA 2VH7A 2KXNB 2OP5A 2K06A 4FPIA 5CCLA 4RX6A 5ETKA 1SH2A 2CJQA 3CCES 2VFVA 3CJ2A 2MKIA 5F3TA 4DL4A 1K44A 5DQIA 4JBCA 4X4TA 5L1IA 4NCAA 3CO0P 2X3GA 5DM7Q 1X8DA 2Q3PA 1PBAA 5BJRA 1RLDA 3KLFA 3NGUA 3U1NA 3GJRB 2Q1LA 4J9VA 4V19X 3G82B 4B3TJ 4PYDA 4ES1A 1FRMA 4Y2CA 1YVFA 1VJWA 2XGQA 4IG3B 2PSZA 4UUWA 3DLKB 2ZHAA 4DV5F 3PKMA 4QU7A 2VG5A 3O1LA 3GTYX 5KFHA 1OIAA 2HHXA 2XMUA 4C3MA 1T02A 3VWSA 1S6OA 3SV3A 1D3WA 1SPBP 3RUBL 2GA7A 2LXFA 3K5PA 1FJGF 4WK3A 3KHHA 3NY0A 4OV1A 4IQXA 3VV2B 1B0TA 2IA0A 3OTDA 2R7QA 2E66A 2JDJA 4RL1A 5E3QA 3D54A 4U67Q 2WVEA 3TZXA 2PN6A 2HHHJ 4P10A 3K0JA 2RHQB 1O5JA 4OI6A 3VAKA 4ES2A 3H4BA 3P5TL 2QSWA 1DURA 2GQ2A 2ZBCA 4PABA 2BZ2A 2DGXA 3PJWA 3P4UB 2WK4A 3V6DB 3MECA 3W9IA 3OV7A 4YEAA 1X4CA 4JYAF 3FBCA 3KLIB 4ECWA 4LMZA 1VOMA 2GMJA 4A8OA 3O44A 1HBUB 3QIPB 2CIMA 4OX9F 3H2VE 5L1KA 1APSA 3UQSA 4LSLA 3AQOA 3OXGA 3CCSS 1KLNA 2GCFA 3H98A 4JV0A 2WVDA 3QNWB 4IOBA 3CSKA 4MKVA 2XLKA 4C7QA 2DD8S 1ZOTA 2FJWA 1S10A 4DF8A 4GKKJ 1KRPA 1YG0A 1BGXT 4HVZA 3ENWA 1NM2A 2QA4G 4PYAA 4CLYA 4DUZF 1Q79A 4YDXA 5MLCV 1V3SA 4QYZJ 4J9PA 4DCOB 2HNYA 4F50A 2ZH2A 3VQSA 3M8PB 2AEJA 3OL9A 3GJQB 4TKTA 3W62A 1X0FA 1KVKA 1OY6A 1ELOA 4F3MA 4DG1A 4OI4A 3KK2B 4CO3A 1GNKA 2P9GA 1HHTP 3I55S 3AB2B 1Q0NA 3DXBA 1KFSA 2HZAA 3MR3A 1U1RA 3D4JA 2W24A 4K4XA 3TAMB 1D9AA 1YI2S 2YWKA 5DLGA 4ED3A 5FDLB 1XWLA 1N5VA 3AH6A 4KY3A 3AA8A 1DFDA 3OHBA 3BQ0A 4Q0BA 4CO0A 2BYCA 4TLQA 3EXYA 2GIRA 5EDWA 3B6BA 3LP1A 4WFNQ 3LAMA 1IXKA 4GVLA 3PR5B 2BRKA 1LQ9A 3DOLA 3KLHA 3R2CJ 4M5GA 1IR0A 4DV6F 4BLGA 2BM1A 4QCLA 2FHKA 2G1HA 4TYBA 3C66A 2VC0A 4XPCA 2IPOB 3W61A 3Q8QB 2AJFE 4ZLLA 3PIOQ 3ELHA 4KR0B 2RF2B 2CQ1A 2ZFHA 4C11A 1NK6A 2DRDA 4X66F 3M6UA 5LJ3Y 4HR2A 5J1EB 2MQNA 4OQJA 3MFHA 5IV4A 3G8TA 1UVKA 3B8HA 4DPUA 2IBOA 5LMNF 2QLFB 2G0IA 4JI5F 3DM2B 2FPHX 4H54A 4ZHRA 5F3ZA 4C8KA 4X64J 2E5LF 2D9OA 2C3UA 5EX3A 4DX8H 4YHHF 3DLGA 4HACA 3BB5A 1IR1A 2YKMB 3MHYA 4ZCIA 5AE1A 1LWCB 2YKOA 2ZOFA 4WCEQ 1R8BA 5F9NA 5GAEI 3EMTA 3IG1A 3LGMA 4DSFA 3UCGA 4CT9A 2HPUA 5A0YB 3TZWA 2HFUA 2RKIA 2D74B 4J9UE 4OHVA 1YJRA 2FB0A 3MCOA 1MG7A 2BE2A 5DG9A 2M88A 3A3OB 3SBMA 2YNIB 3SSQA 4TLRA 1REVB 2YQ3A 2LQBA 2C3OA 2OIHA 2CKWA 4QYZK 1S12A 3IMQJ 1EP4A 3IBCB 2DGOA 3GJSB 3T1YJ 4FS1A 4USUA 2MLZA 2GO9A 4A46A 3IS9B 3TQ1A 4OYOA 3TUPA 4LF2A 1VQOS 1CULB 4QWEA 1JNRB 2GVDB 3HZGA 2J8SA 4QR0A 2LP4A 2NXJA 1HA1A 2BW2A 1F3VA 1S6QA 1WNEA 1F2GA 5CHCB 4I7FA 2VKRA 4F7VA 5KFKA 1D1UA 3OLAA 2QMXA 3CDWA 5JVHQ 4AFFA 3PACA 4C6AA 4ELUA 3J7AN 5K5MA 2V4QA 5E33A 5H9FJ 4YUDA 3VALA 1TUVA 1U47A 2F40A 3GIKA 4MFBB 5L39A 4YY3J 1VC5A 2C2OB 2D69A 1RWUA 4NLTA 3DOMA 3ZNJ1 2J76E 3NGDA 4ZJLA 3EDRB 5K8MA 5BXIA 1HYSA 4WIIA 2L9WA 4A48A 3QYYA 4ZK7M 3QATA 3OTCA 5HROB 1H98A 1WEYA 3LPYA 3CPWR 2Y8YA 5K8NA 2DEJA 2DNKA 1JNZB 3E51A 2HWIA 1QSSA 3MMBA 3ZTOA 1VDHA 3HULA 4X4SA 2CPZA 2ZBQA 1JLGA 3TR5A 3W8PA 3C15A 4JI6J 2RQMA 4YQWA 4HT5A 2FGCA 2AIRB 5F41A 4DR5F 2CYYA 5K8OA 3PW2A 3JSMA 2F5GA 2CQ4A 4NYOA 1LWFB 3BQ2A 3VCDA 2VDIA 4HLBA 1PCAA 2M9KA 2K1RB 2DPJA 1QAYA 2RIJA 4DR1F 8ATCB 1B70B 1XJWB 2AF6A 4A8YA 1W2BR 3CCWA 1IWGA 4UUXA 4ECZA 1EETB 2QL9B 3LA0A 2V68A 1UW4A 3TUZC 2FZGB 2KB2A 3GILA 3ZNUA 2JX2A 1SKSA 4I56A 3F56A 4UOGA 1NMEB 2YKQA 1C1CA 3M8RA 1QSLA 2IM2A 2ZH5A 2KZMA 2OTLS 3CIZA 4NL5A 1UFLA 4P2MA 3PX6A 3E01A 3CT9A 4KBIA 1FDBA 1Q7YT 3A8EA 4JI2F 2CPEA 3LANA 1YHQS 5HP1B 5BYRA 1RT1A 1Y9OA 2DBBA 1XNRJ 5ETQA 2HGNA 5F8MA 3CCUS 2CJYB 2EG1A 2WB1D 2Q43A 3CJ4A 1RU1A 5C25A 3RBEA 2YQ0A 3HVRA 1YJTA 2FLPA 1DQ8A 2MB0B 4WZQA 9ATCB 5H9FK 2FJDB 3BS9A 1Z2ZA 3CJKB 2OPRA 4CH1A 5IC6B 5A76A 9RUBA 1SVDA 1S9GB 1IUJA 3UNGC 1TKTB 8RUCA 3MAAB 4GKJJ 4FYXB 2R7OA 3JAMU 1BWVA 3L7UA 1E6VA 4A47A 1M0SA 2OI2A 5GAHI 2BJ7A 1AFIA 2BW7A 4OX6A 3PEJA 3P45B 4J37A 2G2ZA 4ZVGA 4DFKA 4PRFA 1LXJA 4XO0A 1F60B 1GXUA 1R6YA 4Z7CA 5IWAJ 4ZPCA 2IMOA 4DV2F 2XS2A 4WTOB 2YWWA 4PZVA 1XR5A 3ILOA 3AD8C 3RAMA 4M5KA 4C8OA 2RQKA 1TL1B 2HVZA 2JLEA 4ER8A 4MH8A 1J5EF 3IRXB 3C8YA 2UV8G 1N32J 2J0WA 1HNXF 2MQMA 1NHKL 4KC5A 2J9CA 4IG0A 4KPCA 4JI3J 1UWBB 1Q53A 2XZDB 3KTQA 5KFDA 1HBOB 5AJ3F 4RWXA 3CULA 2IBKA 3L9ZA 3B78A 1QLNA 4DR2F 5HQMA 3K5OA 5F8IA 1WOPA 3MUVP 1NO8A 1N56A 4LFCJ 2JEJA 3MOZA 2GS8A 2CZ9A 1PIEA 2PDAA 1WF2A 3SV4A 2D7SA 4TU7A 1N34J 5T14A 5AXMA 1LKZA 4FF3A 4DI6A 2AGQA 2MY7A 1GXTA 2YX1A 3KJFB 1Q8IA 4DZ6A 4NMXA 2WBRA 3GYGA 3RW6A 2OPQA 2G0CA 2H5JB 4IDKA 2B5JA 1RK8A 4M1KA 5J2NB 4MKYA 2I6WA 2ADBA 1WHYA 2XWXA 2AEMA 3H90A 4IQMA 2E1CA 1WOOA 1U48A 1IKXA 3MEEB 2V8GA 2UP1A 2YPZA 4O3QA 4WP8A 3W3SA 4DV1F 4HHJA 2MKHA 3OVAA 5D77A 2IDLA 1L3KA 3MM5B 3Q8PB 3KFWX 4I6AA 1WDTA 2PE8A 3TZYA 2QYGA 1KONA 1YJ7A 1NDCA 1WSVA 3WC0A 1IQTA 1RHUB 3LWMA 3NCPA 1FWLA 1TK5A 3C16A 4WFZA 2WHOA 4G1PA 1H2UX 2Z2LA 3RJMB 5E2QA 3D67A 5GADU 2HVIA 4NI2A 1GX5A 3EZUA 3KNAA 1ZAWA 2HFOA 2K7JA 2W4DA 1P9YA 3L95X 2DR6A 4TVAB 1PYOB 5AXKA 1R8AA 4LT6A 1XTZA 1N5TA 2VFTA 4C8YA 3QT8A 4LF7J 2QFIA 1RT2A 1KLMA 2BX6A 3CCTA 4U7CA 3B4MA 5KFPA 4H4KC 4WKYA 2M70A 4NLPA 5FLXY 3EVOA 1TL5A 2HFNA 5C7PA 3L3CA 2OD4A 2A2CA 2NYIA 5J1NA 4NASA 4ETXA 1IR2A 4UOCA 1SC1B 5HQLA 2V8HA 2B56A 5LOQA 1D8YA 1KTQA 3CVKA 4PAAA 2FJXA 1Y0HA 4UT4A 1YRUA 1SKUB 2N82B 2XZTB 1KSPA 4CRJA 1IBLJ 1URNA 1HHSA 3MMJA 1WG4A 2Y9HA 4DUYJ 2QLXA 4F4KA 2KM8C 4ES3A 4KGMA 1WHVA 4KHPF 3GP9A 1NH8A 2Z8QA 3C3LA 2ACYA 2DY9A 4RO0A 2VBXA 3MPWA 3R7NB 3MMCA 1U2RA 1YX2A 3V6DA 3US5A 1P8GA 1WKKA 4AL5A 4I4BA 3KLIA 2W2QP 2UZAA 1HBUA 4X4OA 4Q8FA 1Y7PA 3KMSA 1FESA 3AXMA 4DQPA 2YY3A 4ZVTB 4BWJA 4DOZA 3GG1A 2WW4A 3Q0AA 1G4CA 3S6EA 2NXEA 3CCQS 1J27A 3RBXA 1X9MA 3R5BA 4LRAA 4DFJA 1CQMA 2MQQA 5D4OA 3UR0A 1X4EA 1CJUA 3NGKA 2UUWA 2V0NA 3ETOA 2QO3A 2MJNA 1VQLS 1KOOA 4Q43A 2LU1A 5CQGA 3R97A 2X1AA 1EKRA 3Q83A 4NZ6A 1T9WA 2LQJA 4OZLA 3M8PA 4M95A 3R1HA 2J9EA 1DTTB 2BVZA 2XCPA 2J0XA 4NZ7A 2M3DA 2R9LA 4RR5A 2DNYA 4QR1A 2LXIA 4O4GB 3TA2A 1RAIB 3M2UA 3M6VA 3AOBA 2HFZA 4EBEA 1S4EA 3QRRA 4YB7A 5KG7A 1XMQF 3TAMA 2V67A 2AJ0A 2YNGA 4DV5J 3BSAA 1YITS 4FDFA 2B9EA 4OJGA 5B09A 5HMWA 3R1LA 3POTB 2RUGA 4F67A 2YNHB 3Q22A 3KK3B 5J2QB 1DZ5A 4ZPTR 4WK1A 2WW8A 4J7CA 3D6FB 1F9HA 3HHNB 2WVCA 1H7XA 2Y8WA 3U1MA 3IAS9 2XI2A 1FJGJ 5DO2A 4IH5A 4DDFA 1NSPA 2UU9F 3H0PA 1CG2A 1UVLA 1S1WA 1KBRA 1CQNA 4PPZA 2BXJA 1NJIT 1U6ZA 1YZ7A 2FLNA 2Y1RI 3CC7S 2BKOA 1Q7LB 3VHQA 4XDDA 4A8WA 5ITHA 1X5PA 2JEIA 2GIQA 3DN9A 3W7BA 3KYLA 5HVFA 1C1BA 3CNQP 1B99A 2H9ZA 1RAJA 4JYAJ 2XY6A 1DLOB 4X4NA 1WSRA 4PQAA 4AYBD 1LK7A 1LWCA 4P2FA 2XS5A 1H0HB 1TAQA 3QSIA 4OX9J 4P2XA 2BE7D 4HL9A 3EGVA 4UY8T 2N4DA 2MKYA 1GAOA 1T03A 1A7GE 2D9PA 4G1QB 1A6LA 3P6YC 4LUBA 4RNNA 4DS4A 4G3IA 2ILYA 4AL7A 4U96A 4ZP7A 3NNAA 3HK2A 2LA4A 3PG9A 4K4TA 3Q86A 2XMAA 1QDUB 4DUZJ 3HKZD 2RB7A 3A1YG 2ZH9A 4QQBA 2QLWA 2HW3A 1QJHA 2ZKTA 4O44B 3J80U 3G6ES 4M5HA 1S0VA 1IJEB 1RT6B 2GVDA 5HMZA 3ISZA 1EHWA 1SKWA 4NOHA 1AZSB 5E0OA 1SV5B 2ALZA 3C6TB 4ECTA 4AE5A 4PQUA 2DXDA 3LALA 3W5XA 3PYEA 4Q2MA 1PYSB 7FD1A 4B08A 3FNNA 5GAEU 2QZ8A 3PFOA 1VC0A 4IRCA 1U1KA 4K59A 4YMEA 2R7XA 2C28A 3T5KA 2ADCA 3DRYA 2LDYA 1EB0A 4OZ2A 2IAJA 4WP3A 3M7VA 2SXLA 1ZAXA 1FCAA 1HMVB 4B9UA 4F4ZA 3UCZP 2HHUA 2DIVA 1HW8A 3D28A 1HD0A 3BDPA 1S48A 2V5HG 2DR9A 1T95A 2LEBA 4DV6J 2LVWA 3BSNA 2PEBA 3LOUA 3KLGB 4FF1A 4JUZA 5C24B 3QZ7A 1QTMA 1KEKA 3DLHA 2VB6A 3SYZA 4X66J 3ADAC 1TL7B 6FD1A 2YNFA 1SQEA 1REGX 3M1VB 4G65A 3RR7A 1R8PA 3SQOP 4IH7A 2C2MB 3M2VB 3MPUB 2P6SA 3PXGa 5LMNJ 4L75A 4CDIA 4JI5J 5GVQA 2XMWA 3D1OA 2E5LJ 1WC5A 4YHHJ 2EWHA 2K1RA 2VZ9A 4RJVA 5K14A 2VD3A 2LYVA 4RPFA 4B9VA 3QGGA 4DPWA 2DGQA 4A8MP 1RBOB 2HRYA 5HN0A 2PMWA 5A2QY 2AYMA 1S7HA 4YR2A 3KHGA 3HX9A 3LTOA 2W2MP 3DLEB 2DNNA 2B6AA 1RP5A 3VZHA 3SFUA 5IFMA 4DSLA 1JLAB 2VQEF 3R5GA 2YX7A 1NBEB 4U7UD 1C4AA 2N7YA 5DDQC 5HP1A 2J6UA 1FE0A 3CC2S 4B9TA 1RSCA 1S76D 2QLBB 3R9LA 4NLQA 5E41A 3SEOA 2E44A 3BN7A 1YJUA 3PHTA 3K8VA 3CE8A 3RYLA 1T11A 4ANDA 2E9TA 2QJ3A 2HZVA 1FFWB 4X62F 3KLEA 3OLBA 3IFEA 4QJVA 3Q2TC 4LQ3A 2UVRA 1BUXA 1WTFA 2J7UA 1WUUA 5GMDA 3MEGA 4QPTA 1FA0A 4OLOA 3WX4A 2V2VA 3D6MB 2GQCA 4ZLPA 3FC9A 5KFUA 3FCVA 3IWXA 2IC3A 2CUYA 1VQKS 2CQPA 4KHMA 2HLTA 4PWUA 1S7IA 2BQUA 2EPIA 2YX4A 1Y5LB 5BYQA 1VI7A 4WE1A 3VGSA 2FC8A 4HTIA 2W01A 3PRDA 4B3MF 2JH3A 2HK2A 3V81B 1MWQA 4P7VA 4IH6A 3FSIA 3G4SS 3TUIC 4NYPA 3ZTQA 4GO7X 2H3EB 1X4AA 3I32A 3GLJA 1WTBA 2J6TA 3TEHB 3DI6A 3PIPQ 2H5IB 3AOAA 5CCMA 4KO0B 2WSFC 2ZBPA 4DR5J 1P1TA 1C0TB 3FMWA 1WC3A 2XMKA 3DOKB 4DBQA 4PXCA 5C2CA 2DTJA 4EFAC 1RTZA 2MTLA 4DR1J 2PIIA 4NE9C 3R6LB 1JLCB 4K4UA 4LF4F 1YKWA 2MQPA 1TKZB 4DZDA 2LQ9A 4EUVA 2XI3A 5GAHU 3HD1A 5L1LA 2ASDA 4EWTA 3CF5Q 2XY5A 4ZP8A 4EBDA 4IKAA 3SCIE 4DMZA 3TYTA 2GAGC 4ED2A 2F7VA 2KYXA 2IM0A 2F9DA 4OJ3A 5J1PA 3NP5A 3C14A 4KKOB 4OHWA 1RZMA 5I3QA 5J2NA 4RW6A 2DCLA 4KGVB 1OPIA 4ZLJA 4WWSA 3MEEA 1TMMA 2XLJA 4JI2J 2EBGA 2QYCA 1NZ8A 3NLCA 5CYMB 3DRPA 3MM5A 1M5HA 2W2NP 4LVOP 1KVIA 2ROEA 2FJAB 1Y3JA 2WONB 5A8KA 1GMUA 3C6UA 3HMJG 4J9QA 1QM9A 2BACA 1HPZB 1N5SA 1NB7A 2YWHA 5D78A 1IKVA 3EWGA 1QE1B 4IUFA 3N79A 4K5RA 1G1XA 4JI0F 2KVIA 5CD4H 3WC2A 2YH1A 5F8HA 2DNZA 4ZMMA 1TKXA 3E2EA 2IJFA 3QJLA 1IVZA 1L3SA 4J9LA 5ETTA 2W1BA 2OH2A 3RRGA 1S6PB 3SCKE 1X9SA 4L3NA 3KNGA 1K0TA 1S99A 3DFEA 1AROP 3GYNA 1K1SA 4CO5A 3PV8A 4V1Ak 4FF4A 3EZOA 2QEXS 4DV2J 1FKOA 2G2OA 1MMNA 2EK1A 2Z4PA 4W98A 5GMEA 3MPYA 2BANB 2QA2A 1J5EJ 4N76A 4DN9A 1NK8A 1HNXJ 3F0NA 4RW7A 3SZ2A 4X4VA 3G8SA 2GQQA 1ZH5A 2J0SD 2BEFA 4HHHA 1FDAA 2V69A 3I82A 5AJ3J 4MJKA 3TNVA 3TVKA 1D0EA 4DR2J 4R5PB 4N47A 2MQLA 1NPKA 3O8WA 1GT8A 4I2PA 3DLBA 4F8RA 2KVQE 4ID5B 2M2BA 5F8LA 3IR5B 1R0AB 4AXJA 2IIHA 5LSLA 1LFPA 5DDPC 3A8KA 1FD8A 3EICA 4B3OB 4N56A 4QIGA 1WEXA 1FF2A 2ZE2B 3NS6A 3GV7B 4ED8A 4ITSA 1S6UA 3LP0B 2OD6A 5IM0A 4C3LA 1L3UA 3OT9A 3PFEA 1RT7B 2B4VA 4KV8B 2W2OP 1S1VA 5L38A 2DNLA 3N5BA 1XK8A 2V94A 3I5CA 4QU6A 4DV1J 1EAYC 2CDRB 3U7JA 2Q66A 4P52A 3UFCX 3I4HX 1JJ4A 2WVBA 4DR3F 3VAJA 3MM6A 1KOHA 1FX2A 2CJAA 1X7VA 4RUCA 3FJ2A 4ANEA 2W7PA 1PKUA 2KFNA 1YLXA 3D0GE 3HXMA 3NGSA 3B82A 2I5JA 2UUAF 3IGVA 3IR6B 4OLPA 5JVGQ 1CJVA 4MTPA 1X5SA 3JTNA 2GMHA 4O0NA 2NPFA 1W7WA 2F4FA 3SCLE 4AD6A 1YBAA 1K9MT 1B3TA 3OD2A 4KT0C 4WPAA 4H4MA 1Q5VA 2R4FA 1BQNB 1M5OC 4F4XA 1ZS6A 5IV3A 1SH3A 4DSJA 4IOCQ 2VJVA 2ROGA 2HQIA 2M5YA 4LRDA 4CP5A 2CAJA 2A10A 1DTTA 5KT7A 2F9JA 2Z57B 4URQU 3D3BJ 3EJMA 3CW2C 2JJ4D 1F6TA 2BR0A 3KXDA 4PXBA 2RH3A 4MK9A 4CLKA 4RW8B 4ZDNA 2HGLA 5F9LA 3DKDA 5KFBA 3M8SA 4RNHA 2H5EA 1FKPB 3V6JA 1XBWA 1AT1B 4U7UK 2QIFA 3PVXA 2CQ3A 2W8LA 5CAAA 4EI2A 5J2PA 2EC2A 3POTA 1BQMB 4LJMA 1U25A 2UV8A 2AZ3A 2Y0SD 4ICLB 3A13A 2OLWA 5HBMB 2PEHA 4MMOA 2XO7A 1O51A 3O3LA 1QY7A 2DVIA 5L9NA 2CJKA 1QVGR 1YWXA 2UVWA 1VQMS 5HVGA 1FWKA 2ACMA 3FGVA 2KN4A 4PXDA 5ETLA 4KHPJ 3D7SB 2ZDOA 4F3OA 1AYEA 5A6PA 2L41A 4FXVA 2XGPA 2CXEA 3M8QA 3BR9A 2FVRA 2O1PA 1U1QA 2JZ5A 2V63A 1RGVA 1RAHB 5C42B 1VBZA 3DGVA 2WAQD 2NUUG 3MM7A 5KFIA 2FHMA 3NBPB 1HNIB 2OSRA 1XMBA 2CWXA 3FVYA 4Q8EA 2QSFA 1IBKF 3BGRB 1JXEA 3FBEA 5B0BA 4G1QA 1TL3B 3FRZA 1NKEA 2CQBA 2VFUA 2A0FB 1FRHA 5ETOA 1SH0A 3DYAA 1EKSA 3BH7B 2E7VA 4OV6A 3I56S 4M5DA 2WOMB 1VQ7S 4OZ5A 4PG4A 1RBAA 4M94A 2FVQA 1NNDA 1XC9A 4JV5F 4K50A 4F36A 2GV1A 4N7TA 1U2CA 2WTFA 4MYUA 4O44A 2WSEC 2MDAA 1FO1A 2R8HA 1RT6A 2IJRA 1MWZA 2OFGX 2AGOA 1LFWA 2W7OA 1BD6A 3EYZA 2M7SA 1SJ3P 2KXHA 1Y4ZB 1RQ0A 3VQTA 2VJUA 3KMQA 1WKJA 4KHRA 1NJWA 2F63A 5F0WA 1UJ6A 8AT1B 2KO1A 4XK8C 3C6TA 3HVTB 4M5NA 2DT9A 3RZAA 1RTJB 1SBRA 2DHGA 3KHRA 3G86A 5FJ4A 1XMQJ 3QMQA 1R31A 1RAOA 3ENAA 2FHJA 1R3NA 2CWKA 2P9CA 2GGPB 3AJDA 2DO0A 3CCLS 2ZOGA 4OJ1A 3GFXA 5FD1A 5KG6A 3OFHA 2H4YB 5IQQA 1RTHA 2OUGA 4LF9F 1MMLA 2CQ0A 2P2CB 2J8AA 2G4BA 2JHEA 2P9EA 5ADZA 5F8GA 1O8BA 2RD5C 3KLGA 2UU9J 3JAMY 5B0DA 3I0SA 5KFZA 2CDQA 2EG2A 5C24A 2VPXB 2EBEA 2YKAA 1WWHA 2YWEA 2XZWA 1HWUA 3BEGB 1H2TZ 2HFVA 2K3KA 3MM8B 4RBUA 2KI2A 2XNRA 5SUHA 4TNOA 3BV8A 4CQ1A 3NCRA 4KGXB 4L72B 4LSZB 2VG6A 4DCJB 4PG6A 4KFBB 1T7PA 3TAQA 3LGHA 3BSCA 1T05B 1D09B 4I64A 2NQPA 1UZHA 1K8AT 1YJ9S 4IR9A 3AODA 3ULHA 4DN0A 1VRUB 3M6WA 2DNPA 1U02A 3SQGB 2KZZA 3DRSB 3PW4A 2LECA 3MCMA 3K57A 3W2VB 3NCQA 4OX7A 1VBKA 4Q45A 3O2IA 2UXCF 2B9WA 1JXVA 4OZJA 2MPUA 3PJ9A 5A8WA 3RU0A 3WQPA 2X1FA 5IXUA 2HK3A 1R6VA 1J2VA 3FK4A 4I2QA 3UD4P 3BO2A 1QUVA 4DPOA 2V2ZA 3N01A 1CS4B 5IZHA 4FF2A 1S97A 2O66A 5ETNA 2OKQA 3ZTPA 4LIWA 2R7TA 3MTJA 4IRKA 2W9BA 2B3TB 3MEDB 4OYAA 4AQYF 4Y3CA 2WRMA 3V5RA 4N5SA 5D4LA 2RS8A 4WYWA 4Y00A 4DF4A 3PEHA 1UKUA 4NWBA 4F26A 3H5XA 4ECYA 1X0PA 1JKHA 1T0TV 3FQLA 3SCJE 2C3MA 4NLDA 2ZUAA 2JNJA 5KG1A 2FY1A 1LXNA 3OVSA 4DSEA 2QN6B 4A8FA 1UMJA 5HANA 2IVMA 2GIFA 3TWZA 2Z2YB 1S1TB 1UP1A 2A6MA 1SL1A 1Y5IB 4M5JA 2RNEA 1PJ5A 3HCXA 4M8LA 1HBMB 2KRRA 3R27A 2XS7A 3ITHB 4CLZA 4JV2A 4EO8A 4WBFA 1MROB 5HAOA 3MURP 3LWLA 4A8XA 2GNKA 2Y3YA 2JEFA 3PM9A 1U0HB 1CSJA 2MZJA 3GR1A 3HHDA 1T94A 2HBZB 3NMAA 3T9ZA 3LGNA 4W4MA 1VRTA 1E6YB 4K7QA 1HWIA 4J9OA 3NGRA 4J9MA 1JLCA 1QD1A 5I42A 4F4YA 1VMBA 1DQ9A 3Q24A 2NXNA 1RAGB 2NYHA 1ZPVA 3TANA 2DEIA 4LVNP 1UA1A 3BQ1A 4DV4F 5RUBA 3KJVA 1RHMB 2DIUA 4NCGB 2LLZA 3KKFA 3NS5A 1NK5A 1VJQA 1V5IB 5EN1A 5DS7A 3DCAA 4DXLA 1S0OA 3BGOP 1MNEA 2COLA 1IJFB 1H74A 3BYPA 5L9XA 2J7KA 1F5BA 5B7WA 2KT2A 4KGKA 4OJHA 2XCAA 1RT4B 2B9YA 3X1LB 1T9XA 3AQPA 2VQEJ 2OPPA 4LF1A 3OXFA 3ZTSA 3LAKA 2MQ8A 4P71A 5CYMA 4LIRA 1WHWA 3TA1A 2RVJA 4UZCA 4ZKAA 2CNKB 2DNHA 2WONA 2B7CB 4WYLA 3NS7B 1DAXA 1F9EB 1H6KX 2QRRA 4ZVRB 1KQKA 4KTQA 1SJRA 4PUOA 3O6QA 2G0JA 2KTQA 4RNMA 4BHQA 2KT3A 1AUSL 4ZVUB 3PW0A 4X62J 1IN0A 1MN7A 6FDRA 4ECVA 4PCQA 4DQQA 1C0UA 3RW7A 4NA2A 3NAIA 2VBZA 3R8YA 1RB0A 3GONA 5DRKA 2ZNYA 4WKRA 4GVBB 1IKWB 3ZXWA 1S6PA 5B0FA 4HDGA 4EU0A 2HRUA 2NZCA 1A9NB 4K4ZA 3T3FA 3G8QA 2ZDPA 4Z37A 2XSFA 5JMNA 3UW1A 5M2UA 1RXOB 1Y10A 2YKPA 4B3MJ 3AB4B 2RDDA 5KFEA 5LMUF 3BH6B 3KDOA 2JLFA 4QZVB 1EZZB 4FN5A 1KDNA 3DNCA 2XMMA 2BANA 2RJZA 2XM3A 3M2RB 4ZPBA 2HVEA 4L76A 3S01A 1FJ7A 5CABA 1XN9A 3MUMP 2C2RA 2MHEA 3QJPA 3CWJA 2HS0A 1RBLA 3T6JA 5AE2A 2NXCA 3BGFA 4TQSA 3CDUA 2AHOB 2EFGA 4ZP6A 3NL0A 2HHWA 1K73T 4CLTA 1NHUA 1LWEB 3IN5A 3K5LA 4OHYA 4LF4J 2DGVA 1VGYA 1CJKB 3AJ2A 2ZOMA 1S9EB 3OUYA 2ZJPQ 4ED5A 3FQKA 3MAQA 4ILRA 1UVMA 1V5VA 1GQEA 3G96A 4B3OA 4PWDB 2FC9A 2F8MA 3GR0A 4NLWA 2ZBRA 2OTJS 3QGPA 3F44A 3KUGA 3KJQB 1OY8A 4LF6F 1K1QA 5HJXA 2O3DA 2JFDA 3BBBA 3HJFA 2HIQA 3GCWP 4E2FB 4DHVA 1UEKA 2LU2A 2MKSA 1RDRA 4DL6A 2V4JA 5G0RA 3V4IB 3MI7X 3EGNA 4WU3A 1RWPB 1L3TA 2XNQA 3KK1A 4H4OB 3D2WA 3THTA 4A8KA 1SB6A 4FBTA 2CNLB 2MXYA 4F02A 1RWNB 2CJ9A 3JTOA 2W7AA 2B8QA 4JI0J 3MM9A 3MDFA 4WF9Q 2CPHA 1Q86T 1R43A 2MKJA 1JLBB 5EUHA 2POKA 3BGLA 2H4WB 5GMKa 3O5TB 2RAQA 2DR8A 3HO1A 4KRWA 1XR7A 1CLFA 3DU6A 1Y11A 3QLHA 1MMDA 2XB2D 2ASYA 2HHTA 3CCZA 3KLFB 4OHZA 5KFLA 3ISNC 4DU8A 3BZQA 3D68A 3D6TB 3K2YA 2BJ9A 2XHWA 3FZBA 4K2XA 1SC6A 3CJSA 5KFRA 2BM0A 1P9QC 1KFDA 4UF4A 1ZM3A 3IRWP 4RW8A 5CD4A 1KR4A 3I9ZA 3J80Y 3BPDA 3GIJA 3SXLA 3DC2A 2ZKUA 1UEUA 2YTCA 1PYTA 1N54B 2BJ3A 3MEKA 1BQMA 3HI9A 1Q81T 4O3OA 3JYTB 2R7RA 3CDEA 1SL2A 5CH7B 1ICEB 2ZC4A 1RT5A 1PSDA 3FCHA 1F2HA 4WZMA 2E5HA 2ZVSA 2HHPA 5KFFA 1NJXA 2V2KA 4B17A 3ICLA 2FDNA 2JFKA 3GFHA 1R0BG 4PXEA 1N6QA 3MECB 1RA7A 1I51B 1YQHA 4FP9A 2I38A 4CO1A 2UUBF 4DWIA 3HHLC 1X4GA 2EVZA 1SQFA 1OO0B 5C42A 2VV5A 3PY8A 3OR1A 4FYDA 1LNQA 1YRTA 4LSLB 3DRRB 4OX8A 1HBNA 5DDRC 1Q5YA 2DGWA 3MGJA 1HNIA 2I8EA 2DNQA 2VFSA 2HYIB 3KG4A 4OFZA 1D8ZA 3BGRA 4DR3J 3VAHA 2R7VA 1ZPWX 2RRAA 1RCOB 1OPZA 1TQLA 2Q79A 4RWWA 4ZOSA 2HG4A 4PG7A 2UUAJ 1UWAA 2Z0GA 2IRXA 3FEXB 2E1RA 1I94F 4KGZB 4RW9B 2XULA 5I4MA 2XEXA 2PT0A 2HVHA 2HNYB 4HKQA 2V4RA 4ZS6A 3VGVA 1S49A 1UAWA 5MAOA 4DV0F 1VQ9S 2V8VA 3PZPA 2DH9A 5M2PA 3RGIA 2O5DA 3W2WB 1GMWA 1CPZA 4LR8A 2DITA 3D3CJ 2BE9B 3AJ1A 3ZZTA 1HR0F 4R0JA 4ZN1A 4O3PA 3HVTA 4FKXA 2VQFF 4OYWA 1YJNS 3B54A 5B0AA 1FFSB 2EKYA 1NH7A 2DB1A 3RG6A 5EWGA 1SIWB 1TZ0A 4QR2A 2LQ8A 4C48A 2E5IA 3OFFA 3IBWA 3X3UA 4OI3A 4USMA 2KJWA 2CPXA 1NK4A 3M9MB 3DOLB 2YH0A 4NLRA 2VHGA 3MCSA 4KH0B 3VZIA 4QYRA 3G6XA 1GMVA 2HKEA 3AT1B 4IOAQ 1ITPA 4C11B 4NMLA 1S1UA 4AL6A 4ZPAA 2H48B 3FSYA 2GW8A 4QIFA 3MM8A 2KJVA 4ZHRB 1PJ7A 1NSQA 1RHKB 4ED6A 3AY0A 2HQFA 3CJ0A 1RTIA 3DLGB 5HI7A 2F8HA 4HACB 3FUYA 2JVRA 2NSCA 2OELA 1WF1A 2VA2A 3ILIA 2LKZA 1FRIA 2D1CA 3BN4A 5HATA 4P9SA 3PHEA 2EFNA 4CO4A 1SUQA 2QFJA 2E9ZA 4ZVHA 4S0MA 4LQ9A 1ZAVA 3NXZA 2FJEB 3I5AA 4UQTA 1IBKJ 4CLFA 1VRUA 3EPGA 2DGUA 1WORA 3SQGA 3CMAS 2HNZA 5ETMA 1NSKL 2VASA 2AGPA 4OL8A 4P75A 3UR3C 1X9WA 1VFJA 3TOQA 4OYXA 3W2VA 1MN9A 4Q2LA 4ILMA 2CVEA 1VQNS 4NRUA 2DRBA 2AU0A 4JV5J 4DX7A 4IFVB 3RB3A 4QIEA 1CVJA 2HWHA 1UJ5A 5KG5A 1N52B 1QUPA 4USJC 4HHUA 1TTHB 4C0HA 1S6QB 3D0IE 1TUWA 4I7FB 1XIQA 4DR4F 1VLOA 2Z2MA 3H40A 3HVWA 2NLWA 1UCNA 1ZM2A 1HQEA 2D41A 1G7CB 2C1EB 4Y28C 2O67A 1DRZA 4NXNF 3K7RA 2G9OA 4Y6IA 3M32A 1VLYA 3QRPA 2AEFA 1AA1B 5KT6A 3MEDA 4KYZA 3H59A 1FVQA 1YBUA 1WKLA 3DDNA 2HHSA 3A4TA 3R5DA 4RUBA 1ZZNA 4XDCA 2MMYA 2HRTA 1RTDB 5JUMA 1HYSB 4BCAA 1B7YB 5I3UA 4XTTA 2HAFA 1X4DA 4LF9J 1RI7A 5HMYA 5DG7A 2ZD1A 2HNDB 2BJ8A 3MMBB 2FZCB 1S1TA 2NUHA 1URRA 5KT2A 2QA1A 1UVIA 2DPIA 3C15B 4L3KA 1HBMA 1RCXB 1WJ9A 4C8MA 2DHAA 4KQZA 1SL0A 4IO1A 1FDDA 2DXEA 1U0HA 2RE1A 1YDLA 1T8EA 1EIYB 2HHQA 2M0GB 3N9UC 1I1GA 1F3FA 1ZTTA 1E6YA 5ETPA 2C3PA 4LRCA 2BDPA 4TU8A 2ZZMA 1V6HA 4GC7A 3WHIA 1O0PA 5KFAA 3CTRA 3DLJA 4ED1A 1DTQB 2L3MA 2C42A 3IAM9 2N4CA 1C1CB 1X5TA 1JLQB 1EJ7L 1VHIA 3HFKA 3E01B 3GSDA 5IT9U 4RBTA 3EUNA 2UXCJ 1RT4A 3HLUA 2WB4A 1HKAA 1KHWA 3LPEA 3OL8A 1PO6A 5D0RA 3H5UA 1PC4A 2BKPA 4N77A 1MWYA 4NEZA 2W4PA 2AX1A 3H20A 1RWOB 3UVJA 3FSXA 2RSQA 1VHFA 2YQ1A 2Q6BA 5C25B 2QL7B 2ZUGA 4NLVA 3IP0A 4CTAA 4L6V3 3A3NB 5DDOC 3D9BA 3IO1A 2OPRB 5KT5A 3T41A 1IKYA 3BJYA 2AZ1A 4TY9A 3M30B 4CH0S 5KFVA 2PMHA 4C8NA 1NU4A 4DJBA 4AQYJ 3ZC4A 4DL3A 4ECUA 1EX8A 1KS2A 3LP2B 2QMUB 1FRJA 2AYBA 2ZH3A 5B0EA 4GVBA 1IKWA 4FYWB 4M63A 3QFWA 1VK3A 1XR6A 4W90B 4ZJQA 4DQIA 4DPTA 2IFXA 4NA3A 3HT0A 2HMIA 4NEYA 3GWCA 2VU5A 1N33F 4FYVB 2UUCF 2YPYA 4TYAA 3S8SA 3TJ8A 3FEYB 5KT4A 3JSRA 4USKA 3PYFA 1IBCB 4YB5A 1TKDA 4ZVPB 4LSNB 3J7YI 3UCUP 3BPSP 2X1GA 2DR5A 3MZIA 4L74A 1YIJS 4IG0B 1SJ4P 3M2RA 2V9WA 3CGIA 3BM7A 2HZCA 1XNQF 2F4VF 4U8YA 3UNYA 4P72A 3G82A 3KUEA 1XERA 4IG3A 2C2ZB 2DKOB 2VOOA 1ZYQA 3DLKA 3C2PA 1F9FA 3UN3A 1M5KC 1LWEA 4HI1A 5U47A 1CJKA 2G1DA 1LWXA 3R7BB 3KWMA 3ZZPA 3OL6A 1KN6A 4DV4J 1KTVA 2BQ3A 1RA6A 1OJ4A 2OPQB 4PWDA 4IDKB 2B5JB 2AWZA 3W5ZA 3GMGA 4I1TA 3PX0A 4PG8A 1U09A 5KFSA 1M5VC 3Q89A 1F5AA 1IKXB 3NKYA 3HFZB 2IYIA 4CO2A 3QWPA 4O3SA 4MAKA 4C9DA 5BYSA 3HT3A 3H25A 4BC7A 5CYJA 2Y0BB 5KFJA 4WJBA 3MXHP 3WX8A 3HP6A 3Q8RB 1QVFR 1RUSA 1B4SA 2MHNA 1IQZA 1R89A 5E3RA 1R0CB 2FVPA 3P8BB 4RUAA 3C16B 3PX4A 3N6LA 3QIPA 1F5CA 1NCLA 3TO8A 4CLLA 2U2FA 3UE2A 2ZH6A 2L9DA 3W9HA 4NI2B 4HH0A 2G13A 1JLBA 3GIIA 2ATLA 2MGZB 4P7TA 2FIUA 2Y1LB 5KOXA 1RWXB 2GHPA 4X65F 3CD7A 3P5BP 2PGCA 4CM0A 1RT2B 1KLMB 4WXWA 3QIDA 3NG8A 1X31C 3MTKA 5CXTA 1PBUA 1RISA 2VFRA 4R0EA 5A6WA 2I0XA 3NWRA 2DY1A 2UVUA 1AFJA 1NPRA 2FJBB 1LEOA 3T5HA 6AT1B 5LMUJ 1HWJA 3CMES 3R5CA 2OEJA 1U7LA 3KK2A 3ONQA 4J5OA 4FS2A 2BJEA 4HDHA 3NGTA 5F0UA 3NEKA 3TJAA 4OZNA 3LUYA 3EGWB 4N41A 3G6VA 3E8OA 1BHNA 3MMAB 4H4KA 1FRXA 3JYTA 3ZTRA 3UN5A 4PR6A 5HL7Q 5FDLA 4WFYA 2AQ4A 3UDLA 1FERA 4YB6A 2E5GA 3UPFA 5D8HB 5C5JA 3TX0A 1JJCB 2U1AA 1LW2B 2X7IA 1KQSR 1VQ4S 4IR1A 4CIOA 2XYPB 2VOPA 1QSYA 2VPZB 2H65B 4FZVA 3LF0A 3EVMA 4G1IA 2HWTA 2GVZB 2FY8A 3MMCB 1YGYA 5M2RA 3T5JA 3EVWA 3CJQA 5L8RC 4QWAA 1K47A 4LF6J 4Z7YA 4LBHA 5DZ7A 4URGA 2RF2A 3FDSA 2CZ4A 1WOSA 3TX8A 5J1EA 3M8WA 3BF4A 2N3LA 4DPXA 2HBYB 1IWAA 3R2DJ 4BC9A 3DRRA 2E1AA 2B0GA 3DM2A 2F3JA 3EM1A 1WDDA 1HWKA 4DL0C 1U6BA 3MD3A 3SDEB 3TUJC 3H8YA 3OTOF 2YKMA 2CNNB 1VQ6S 5KFWA 4Y2KA 2AJQA 1X4BA 2QTWA 3SMZA 2E1MC 3MUTP 3CCRS 2ZH8A 5A0YA 2XC9A 1CJUB 4RW9A 4WFBQ 1FDNA 5E5NA 3MWBA 3H5SA 1U8SA 2HHVA 2YNIA 2RU3A 4UOFA 3GG0A 4U8VA 1REVA 3UD3P 1FRKA 2ZZTA 1FK9B 4PEOA 2D3ZA 1QTNB 2L48A 2A3JA 3W2WA 3PYGA 2BV3A 2PI4A 2VIHA 1N8RT 2XHCA 3EZ5A 1N4LA 1NXIA 3JQMA 1Y5NB 3M2UB 2MKKA 4EBCA 3IS9A 3TW0A 1NB2A 1CULA 2NPIA 2CG8A 3FMBA 5HSPA 5LSOA 1U26A 3AAWB 1ZZFA 2YNGB 3CD0A 1V3RA 4P6QA 3KG0A 1FNMA 5AXLA 2QMWA 1NK9A 1NSAA 4XPEA 1FFGB 3DHXA 2CRLA 3T1AA 5LXRA 2DHSA 4B3RF 4ZIVA 2N7CA 2GFFA 2AT1B 2IMWP 3THVA 1XMOF 4FXDA 1AB8A 3BDEA 3UDCA 3IR7B 3RB4A 4MFBA 4G6VB 3A8IA 5DG8A 1S1WB 4FNHA 2RMLA 2WBMA 4ZJOA 1NPPA 2PA3A 3KHLA 4Y34A 1TL4A 1JQGA 2RU9A 3BGUA 3TA0A 2YKNB 1NJYA 1FXDA 5JJBA 1QAXA 5HROA 3I0RB 4Q7AA 2LCWA 2ZH7A 1HQUB 1SKRA 2FVSA 4JI8F 2VPWB 2UUBJ 1C1BB 2D3OR 4DR6F 5IOLA 1OY9A 2DR7A 3TAPA 1VIOA 3K59A 1TFYA 1Q78A 2MZSA 2JL9A 1YTYA 4CLUA 1KWMA 4YDDB 1FVSA 4CYUB 1LWFA 1T03B 4UY85 1VQPS 4EK2A 3M9OB 1OQ3A 1Q82T 4LFAF 1RWVB 3GSIA 1JMTA 5FIIA 4CT8A 4LFBF 2XY7A 1SI9A 1EETA 2HVDA 1I94J 4K0KF 3OW2R 4DR7F 3QGIA 5B08A 3HSDA 1HL6A 1FWPA 1NKCA 3L7OA 2OFHX 1FX4A 4TXSA 1YK9A 3UDEA 4IFVA 3QSYB 2M8DB 3V2UC 2UXBF 1PC5A 3PRBA 2K3IA 2IY5B 4DCPB 4DV0J 5E3CA 3PW7A 3QRQA 1S5ZA 2IM1A 3FFIB 2EFPA 4RU2A 4PQUB 3IM9A 1JIHA 3D1QA 4ED7A 1HR0J 2OSQA 2VQFJ 4F0KA 2BQRA 2GJIA 4OYPA 3I31A 1DY3A 2KKHA 1V9OA 2HS3A 3NRBA 2IAJB 1Z1ZA 2PI5A 3FRYA 1WF0A 2ZJRQ 2V9KA 2M52A 3K89A 3CJKA 1W25A 4NX9A 1RTDA 1DJ0A 3RAQA 1N0UA 1S9GA 4I68A 3CJ8A 1TKTA 5T7LB 2CPYA 3MAAA 4YN3B 4WFAQ 4C3KA 2YXLA 3QPIA 1FD2A 2OAUA 1WD6A 2FD2A 4OI0A 2AW0A 4RLEA 4L73A 1KHVA 2HNDA 3FBFA 1OMSA 1RWMB 3G6YA 3CXCR 5J2MB 2LEPA 3V6KA 2YNFB 4KPYA 3DDIA 3ISND 5E7OB 5CA5A 1GH8A 2ZNZA 3TARA 5IT0A 4C2MA 2KU7A 1M1KT 2VA3A 2E7XA 4JI7F 2R8IA 5KFXA 4LRBA 3F41A 1XQIA 3CDAA 3QAEA 1TL1A 1DBDA 5DETA 4I6WA 5K20B 2A2DA 2AJ2A 3IRXA 4ZIWA 1JWWA 2X3DA 5K14B 2M8HA 4FKYA 3ET6B 1R7IA 1UWBA 1C4CA 5LM7E 2P5VA 1TK0A 1RABB 2CPDA 3J81U 1HBOA 4ED4A 2R2UA 1N48A 1B64A 2B4UA 1DTQA 5THWA 1SQGA 3N28A 1JLQA 2B6AB 4Y65A 5EHHA 3HVAA 3D5MA 3OL7A 4QW8A 1FE4A 3PNIA 3B4DA 1UETA 1Q8BA 5L46A 2OMLA 1A0OB 2KG1A 4AUKA 4USIA 1M1HA 3W66A 1TK8A 1N88A 2R3VA 4GMKA 3HHLD 2VONA 2NR0A 4ELVA 3M8ZA 2EFVA 2WZ1A 4DR4J 3KLEB 4N8NA 4MK8A 1U45A 1HQ2A 2I1RA 1NDKA 4NXNJ 3IXQA 3MFIA 3M30A 1TELA 2YBVA 3MEGB 1S79A 3MAHA 4GO5X 4B3SF 4ZITA 2IC3B 3LP2A 4OYIA 4F2RA 2KYZA 3CJ5A 3NNHA 1K0VA 2OPSB 4JI4F 4RUHA 4OHXA 2ALYB 2H54B 4WE1B 2ATCB 2B51A 2QE5A 3KLVA 2HLUA 2NXUA 2FHJD 5ETRA 3QWUA 1HNZF 3OXLA 3OJSA 2D3O1 3RR8A 2OJ3A 2ZH4A 3HD2A 2CQHA 2E29A 1W2IA 4LSNA 4QOTA 4DLGA 3K8WA 3DI6B 1RACB 4NLSA 4RNFA 4U95A 4DLEA 3OFGA 4MT1A 2CZVC 4NLUA 1PAUB 1SCJB 3WZ0A 4R8UB 4P74A 3CC4S 1L5UA 1TMJA 3Q8UA 3IA0A 2I2YA 1JX4A 1S1XB 5LL6d 4E98A 2EXUA 4FPRA 4HEA9 5KG0A 5KFNA 2HQGA 2VBWA 4X2BA 4EO6A 3K58A 2JVOA 4EEYA 3W1YC 2A18A 2XBPA 2O01C 4QIVA 1GXLA 4BBYA 5KAKA 1CJTB 2FGOA 3C14B 2PD1A 1KC8T 3S7RA 4TN2A 4RW6B 4BDPA 4RW4B 1IBMF 4UW2A 3J7YU 2QV6A 5L1JA 2MZTA 2J0QD 4DV3F 3FBBA 1BE4A 3DRPB 5H1SV 2DH7A 5DQGA 4NXMF 3I5BA 4ALZA 1KP6A 4OIXA 1JLEB 1VC6A 5A8KB 1TAUA 3C6UB 1F1BB 4J9SA 1HD1A 2DYAA 1IKVB 4ZVEA 1OSDA 3IWLA 5LT5A 2MJUA 1HW9A 3HSGA 4K4WA 3LO3A 3ZZUA 3CCMS 2ABYA 3W8GA 1TKXB 2NSBA 2KDOA 1U49A 2VODA 2XYGB 1Y3KA 4LF8F 1GEHA 1YZ6A 4OYMA 2MGZA 1TR0A 4YP3A 2GO8A 3GFYA 1UVJA 2I9SA 3M6XA 5D3GB 3BKTA 4MIAA 1WC0A 4DSIA 5KT3A 1TP7A 1SC4B 2RT3A 3WDOA 1N33J 2UUCJ 2HQDA 3KUHA 1FKOB 5D0HA 1LOUA 5DGAA 2MQOA 2JC1A 1UPMB 2EFQA 1WEZA 2MSSA 2PMZD 2Z58B 3MD1A 4DV7J 1JJ2R 5KTQA 5HVHA 3JTPA 1VR6A 2RUSA 1RHRB 1U8WA 5BR8F 4RW7B 5AXNA 1RAFB 4O4GA 3S1TA 1WC4A 2V50A 1HFEL 4QBUA 1XNQJ 3OTBA 2F4VJ 2CQDA 3GZ7A 3GU0A 3TQEA 3AD9C 5HK4A 3MMAA 2VPYB 2JWNA 4I2PB 3H2UB 2ZH1A 5CYQB 1FXRA 2R7SA 3D0HE 3R5AA 1KD1T 3GFZA 1NEEA 2YNHA 1KQFB 1LW2A 3KK3A 5F8NA 5J2QA 5H9EJ 3UWTA 2AJ4A 4NZ0A 5KFCA 4BS2A 1X4HA 4MK7A 1U1MA 1YRXA 5F8JA 1KVJA 2GVZA 4HTJA 1LW0B 5KFGA 2E9RX 5IM0B 3EXCX 4X4PA 4JOUA 2B4PA 1UZDA 1N36F 1S1VB 4X84A 3D6HB 4J90A 5DQHA 3VVUA 4EZ9A 1CEZA 5EWFA 2FZKB 1U6FA 3OR2B 4DPYA 5B0CA 4JI1F 3N4WA 2HURA 4USTA 1DHMA 1ROFA 2NREA 4WFXA 3MM6B 4CI0B 1M5PC 1BMQB 4WIQA 1SIZA 1GTEA 3SDEA 2CPFA 2I5JB 5KFQA 1DLOA 3L7PA 2J7WA 1Z4UA 5K8PA 1CJVB 1U1LA 2IHR1 3GIRA 3G87A 2PA8D 3RRHA 1TV6B 4X4UA 5KFTA 1RLCL 4H4MB 1EARA 4RZRA 4X4QA 3VAGA 3R5JB 2HIYA 1HI0P 3BBFA 3EGZA 2C2EA 1FK9A 1JXLA 1UEVA 2KRBA 2W9AA 1UPPA 4YFUA 4X65J 2R8JA 3OFEA 1S0MA 3QFHA 3LW5C 5IC4B 4USHA 2BUNA 1S77D 4ECSA 3HPOA 3JQJA 3EX7B 1HNVB 4ZCKA 2UVVA 3QT7A 3IC1A 3TVZA 2AMCB 1FEHA 1HWLA 3CD5A 3MF5A 1WELA 2MZRA 3TI0A 2BABA 2UXDF 2QC3A 4K8RA 1AZSA 2XTJP 2R8KA 4J9NA 3R3TA 1SV5A 3NMRA 5J2PB 4C0BA 4D3GA 3TRGA 3W5YA 3RB6A 1RADB 2ZHBA 1S4FA 3GYXB 4QWDA 3EPIA 2GJFA 3GCXP 4OZ1A 1N5YB 2J5AA 2K2PA 2QG9B 5H9EK 2DK2A 1AUDA 3M8YA 2FVCA 1HMVA 1RU2A 5IS2A 2Y1JA 3W63A 1V3ZA 2LEAA 4X4RA 1ZTWA 2IRYA 2BKNA 2QA4S 2YKNA 2EW9A 3I0RA 2V8PA 5KFYA 1VCTA 2ZM6F 4KB7A 3RTVA 1HQUA 3GPAA 2H51B 3M8QB 2BRLA 2NZ4A 3JQKA 3PO5A 3T1HF 5LJ5Y 2BOAA 1TL7A 3MM7B 3M1VA 3M2VA 4AT1B 3R6GB 4CYUA 2KFZA 4ECRA 1OSCA 1NAQA 2HQCA 3QAUA 1R8HA 5EWEA 3L4BC 4EMDA 4M5IA 2DNOA 3THPA 3OTOJ 1DQAA 3DYAB 4HH1A 3OSNA 4WXOA 2A1BA 4LREA 2YWFA 4TY8B 1U0SA 3BYRA 1FJCA 2G2YA 4M5DB 3JSBA 3H4DA 3HHLB 3M9NB 2NS1B 4NYZA 3DDKA 2HSEB 3JS9A 1FJEB 2R7UA 3AD7C 3RBZA 4YB1P 4GC6A 1HI8A 3UDVA 3Q23A 5KG4A 4FVCA 5D6GA 4ECQA 4C8ZA 4QPXA 3CJ3A 3DLEA 1RT3B 5D4PA 4FBUA 1QAIA 4IFYB 4UQGA 1PAEX 2HAIA 4F04B 1JLAA 3FFIA 5IT9Y 3W64A 5ETVA 5I3PA 4IRDA 1LV5A 2BA9A 2R2RA 3ZZYA 3NNCA 2DHXA 2HBRB 3MOJB 1HIYA 4KJIA 2E1PA 4F25A 1RWKB 1FRLA 2FLLA 4ZCMA 1OYEA 3LH2S 4ILLA 1HARA 1PJ6A 1IM6A 3D1HA 3ZZOA 2GZOA 1RTHB 5T7LA 4B3RJ 4LBPA 1NRKA 2H1YA 1T9YA 1NK0A 1XMOJ 4BWMA 2GHVC 1SJFA 1SC3B 1VYAA 2EI5A 3I0SB 1J5OB 4F4AA 2CADA 3CO9A 4KIAA 3EDQB 3CCVS 5J2MA 4HT7A 4NLYA 4I69A 4Z2XA 2FJVA 3NOGA 1B0VA 3GE9A 4QWCA 1OYDA 4QIWD 2ZHOA 1YSJA 3AA9A 2VG6B 2J9DA 4NPOA 3GJTB 4CLSA 2HEKA 2QX0A 3V81A 3MR6A 1KQGB 3ZFVA 4CZCA 4JI8J 2XO6A 4A4JA 3QBCA 1I6JA 1Q16B 3W9JA 3DRXA 1UVNA 4DR6J 3R7SB 3ILLA 3ET6A 3W65A 4KO0A 1C0TA 4K4VA 3DXSX 2F1FA 1DARA 3HHKA 1VQ5S 3DOKA 1JJHA 2RS2A 2GX8A 1C2PA 3ZZRA 2CNOB 1ZA2B 5D15A 4C0OC 5A8RB 1ZBTA 1S9FA 2YWGA 1IM4A 4ZVFA 2JOQA 3J81j 2IVFB 4LFAJ 1TKZA 1VRQC 4LFBJ 1NZAA 2ERRA 5HLFB 1JLFB 1TUGB 1FXLA 2B8PA 1UJ4A 1G6BA 4K0KJ 1SJQA 5A8WB 1ZM4A 4DR7J 2HGMA 4DL2A 2K7KA 2XMTA 1MW7A 1Q8LA 4I2QB 2C3YA 4A8QA 2ZWOA 2ASLA 2UXBJ 3OPKA 4KKOA 3FZ2A 2EFOA 4LF5F 2JRSA 3VVTA 2BOPA 2FUG9 4DQSA 4I6YA 4OI2A 3I9V9 3HJVA 1FTRA 4KAIA 2C2NA 2W9BB 4MKBA 4AXIA 3HZEA 3BKFA 3G71S 1MU2B 3T5LA 2XYHB 1GMWD 1WHXA 1TVRB 4FVMA 2VG7B 3DGPB 4LR7A 1HPZA 1BLUA 1T9VA 1H2VZ 4LRFA 1QE1A 3BREA 1JKHB 2GMLA 1GFWB 2BJ1A 3CDBA 1L3VA 1NJZA 2OPSA 1U24A 4ZA1A 1HNWF 4O3NA 5AE3A 3QZ8A 1WI6A 2ZVIA 2R2SA 2PFDA 4I0WA 4KH1B 2FTRA 4IO9Q 3U27A 2DGTA 1T3NA 1Q95G 3WIVA 2Q6CA 2DISA 3HF5A 2W9CB 2IVYA 4B3TF 2EKNA 3PRVA 4JI7J 3QO9B 4R8UA 5IT4A 1UW9A 5D0GA 3FKBA 4CH7A 3SSRA 1VRTB 3DU5A 1S1XA 3MPVA 1RAAB 5KFOA 2APOA 5I42B 1EQMA 3MPDA 4W92B 2QL5B 4JV1A 3GB0A 1GK8A 3KJVB 3HSZA 2W2PP 3SIPB 3Q8YA 5LSRA 3DMJB 4R25A 1CJTA 4FNIA 4R5PA 4ZVSB 5GAGI 2D3UA 3N5FA 3J7Z5 4MKAA 3PW5A 3BBCA 4ID5A 5KOWA 2L08A 1R0AA 2R42A 4RW4A 2HHHF 1VIXA 3P96A 2OPPB 2DGSA 3JSYA 2KL8A 4MIBA 2VC1A 1X5OA 3C19A 3GV8B 3MR7A 3BKUA 3VGUA 2KHDA 2ZE2A 3I4PA 3H7HB 4OZ0A 4WP9A 1H38A 1JLEA 3LP0A 2AKWB 2V6AA 3IBFB 2ZITA 2RILA 1RT7A 4KV8A 1RKJA 2KHCA 1MLAA 5G4DA 5ETSA 2XSJB 4OZ3A 2EK6A 4PUOB 2FYXA 3GIMA 2RDIA 4HI2A 3H2LA 4B9NA 1NKBA 2NCKL 2DHHA 3N0VA 2M4MA 1P1LA 1C0UB 2BMBA 2DXFA 1JB0C 1F0XA 4Y2IA 2XWYA 2JEGA 2OO4A 4LR9A 1BXNA 2C2KB 4GKKF 1U2FA 1U1PA 2CQGA 1N0VC 1UFKA 3GQCA 4Q44A 4B3SJ 5DLFA 5D3GA 1B0PA 2YVSA 2GJ2A 2PFFB 3BO3A 1PG5B 4JI4J 3PDNA 3Q2SC 2W4CA 2DNGA 1B7FA 2Z2ZA 1O6XA 1HNZJ 2DH8A 1GTHA 3VGTA 1BQNA 4TU9A 2AX0A 3H5YA 3TZZA 4MYTA 1M5SA 4PG5A 5JXSA 1S72S 4U6PA 2OMOA 2W8KA 2CA9A 3PJXA 4FYYB 3AOCA 3LQVA 4RU9A 3RAXA 1CC8A 1FKAF 4DU7A 4JP8A 3P49B 4F3QA 3VTIA 2F8EX 4K4YA 4EGLA 3A8JA 2VBYA 3PTWA 3AXKA 4C4WA 4P73A 3HFVA 2VG5B 5HO4A 4ANCA 1FKPA 1BWEA 5SZTA 5CYQA 3OUYB 3ZZ0A 3CJTA 2JLGA 2VF3A 4OI1A 3OSPA 4ELTA 4B02A 3OVBA 5EGYA 4ZN3A 2ZWPA 2AJ1A 1S59A 4ICLA 5HBMA 1LW0A 3QT6A 3AFGA 4EZ6A 1SXLA 1IBMJ 1M1GA 4NA1A 1W26A 3KG1A 3SI8A 2DNMA 4UOHA 4RBVA 3QJJA 4DV3J 3JXOA 3OR2A 2V4JB 5G0RB 2KH9A 2ROPA 4CCHA 2FQQB 3KJNB 3HKWA 4NXMJ 4X64F 4USVA 5HQ8A 2OEMA 3UN2A 3VAMA 2E7WA 3DHWC 3KK1B 4CM2A 1RYSA 1HLWA 2X51A 1Q4RA 1N5QA 2XG8A 3MR5A 4J91A 2Y1IA 2HQ3A 2B9XA 2EC0A 3HM9A 3MM9B 2IA6A 2CQCA 2JSXA 3NBPA 3ENVA 1TV6A 2KM8B 4UZBA 4K2JA 4RNOA 3V6HA 3ETMA 1RYRA 3G9CA 2EEYA 1Z2LA 4LF8J 1TL3A 2CJBA 5K9FA 2RQCA 2HBQB 4A8SA 3J7A1 3QLHB 3VR1A 1VBYA 1FTCA 3EE3A 3T1YF 3ZO7A 4ZP9A 2VL1A 2WOMA 1ZM9A 5FLXU 3T19A 1NDLA 4C8LA 5B0GA 2QGFB 1FNOA 7FDRA 3PR4A 4NCBA 4O0IA 1BC6A 2OEKA 4ZPWR 1HNVA 1FNXH 4Y2MA 2GC8A 4C97A 4DG1B 2LA6A 5KG2A 4K4SA 1R8CA 2OHDA 2IRUA 2LXUA 1Y00A 1HI1A 2N3OA 1LK5A 2DJWA 3PCOB 1QAJA 2JC0A 1U4BA 5BR8J 4O3RA 4TQRA 3PYDA 2MY8A 3T9NA 1RTJA 1G3OA 2MEWA 2RDJA 4YY3F 1R27B 2RRBA 1N5YA 5D0EA 1RT5B 3IWNC 2ZEJA 2GGPA 4Q0BB 1G2EA 4CNZA 3LP1B 2WSCC 1S57A 2RRNA 7AT1B 1UTAA 5T41A 4Y0FA 4DX6A 3V4MA 3KLHB 3MCNA 4Q5VA 5HJYA 1FEEA 4XAKA 2V8DA 4CWBA 1WG1A 1ZA1B 1H73A 3NWGA 3GV5B 5DJBA 1BY9A 2W25A 2P8IA 1N6QB 3TVYA 1VBXA 2IYGA 3CB4A 2KFYA 2B4OA 3BSOA 3CJRA 4UTGA 1N36J 3U1LA 4JI6F 1H3DA 1FHTA 2Z56B 3OR1B 2AD9A 4ETZA 1OQ6A 1HBNB 4JI1J 5C2GA 1FT8A 1CBKA 2HS4A 4KSEB 5CZXA 4PKDB 2R7WA 3E3XA 3I96A 1VS3A 2E5JA 1X4FA 3JB9k 4KFBA 3UO0A 1T05A 2B7BB 3BR8A 3IG1B 2CQ2A 5E3AA 4TY8A 2RKIB 4YOEA 1WG5A 3CD6S 3VAIA 4HYKA 4ZPVR 1VQSA 3HHLA 1OWXA 2BE2B 5KG3A 1UFWA 3M05A 1S0NA 3HHEA 3F73A 2MYFA 1I5OB 3J81Y 3DRSA 4OMFG 1YBTA 4M5MA 1EP4B 1NHVA 2A6OA 1RT3A 4P2SA 2RHSB 4IFYA 2C22A 1JK9B 5DGBA 4PPDA 1PILA 1XNRF 4ED0A 1T9UA 4B9SA 1ACMB 3AHPA 4OYBA 3I6PA 1P6TA 1H7WA 4J9KA 3W60A 4MIWA 1YJVA 1TFWA 1RWWB 1CS4A 2BBEA 1VISA 3K5NA 2UXDJ 4DSKA 2MZQA 3CIMA 2OGUA 2ILZA 4GKJF 3CUNA 1OS5A 2CFXA 3A12A 2XMJA 3OBIA 1WC6A 3C46A 2F65A 4C98A 2DRAA 2UUTA 3IGNA 5EX0A 3DOMB 2LQ5A 1GX6A 1J5OA 4YR3A 2GHWA 4DL5A 1FI4A 2CPIA 3QGHA 1S1UB 2AYEA 1BQXA 3PO4A 5IWAF 3M4XA 4QW9A 1RHJB 4O23A 1X60A 4CLPA 2AP6A 1RTIB 1PGZA 2VKZG 3HSJA 2ZM6J 3ILJA 3PKYA 2C2DA 1JLGB 2MZ1A 1N32F 3OTEA 1RJJA 1Q8KA 1WACA 4JI3F 5D4NA 3TEGA 2PO4A 4J9RA 3T1HJ 3G2XA 3ITHA 1SUQB 1ZETA 4B9LA 3HDSA 3JSMB 4V19J 1MROA 2AYGA 3Q8SB 2VDHA 4ERDA 2KT5A 3KDNA 4N8OA 2FHOB 4PWWA 2XMVA 3P3DA 1U1NA 2MLYA 2K8GA 1D9DA 4LFCF 2HNZB 5A8RA 1UL3A 4RKUC 4LBIA 5HMXA 3H42A 3VAFA 4CLWA 1N34F 4KE5A 2RQ4A 1T9TA 3ENQA 1WC1A 4ZVQB 3NOCA 3RB0A 3UI3A 5HLFA 2CQIA 1JLFA 4ID8A 4DS5A
chains in the Genus database with same CATH topology
5KFNA 1S0VA 1IJEB 2IM3A 1RT6B 2VBWA 4X2BA 3GIJA 4NCGA 4EO6A 3K58A 5HMZA 2JVOA 3ISZA 3SXLA 1SKWA 4E0DA 5CZVA 3DC2A 2ZKUA 4EEYA 1UEUA 2A18A 2XBPA 4NOHA 1XEZA 2O01C 2YTCA 3CEDA 4QIVA 2ASJA 2R8GA 1GXLA 1D9FA 1N54B 4BBYA 4E8UA 5KAKA 5E0OA 2VUGA 1SV5B 4Y2AA 2ALZA 3MEKA 1BQMA 3OJUA 2FGOA 4DFMA 3C6TB 2PD1A 3HI9A 4ECTA 1KC8T 4AE5A 1Q81T 4PQUA 4O3OA 3LALA 3S7RA 4TN2A 3VF0B 3JYTB 4Q2MA 4RW6B 3CDEA 2R7RA 1SL2A 5CH7B 2J6SA 4EYIB 4RW4B 7FD1A 1IBMF 4BDPA 1RT1B 4UW2A 1HQEB 3FNNA 4B08A 1NK7A 5GAEU 2ZC4A 3J7YU 2QZ8A 3PFOA 1RT5A 4WTYA 4ZCLA 1VC0A 4IRCA 3L09A 1U1KA 3M32B 4K59A 4YMEA 2QV6A 2R7XA 2C28A 3T5KA 2ADCA 3DRYA 5L1JA 3CCJS 2LDIA 2LDYA 4F4WA 1PSDA 2MZTA 2J0QD 4DV3F 2IAJA 3WBZA 2KXFA 3FCHA 5E3PA 3DRPB 5H1SV 1MU2A 2SXLA 4WZMA 2DH7A 5DQGA 4NXMF 2P6TA 3I5BA 1ZAXA 4ALZA 4OIXA 1FCAA 4F2SA 2E5HA 1JLEB 4D3HA 1HMVB 2FLOA 1TVRA 2ZVSA 1VC6A 4B9UA 2HHPA 2ZC3A 2VG7A 3DGPA 5KFFA 4F4ZA 1NJXA 3UCZP 1M90T 2HHUA 1MSWD 2DIVA 5A8KB 1HW8A 3NAHA 3D28A 1TAUA 3C6UB 3OQ2A 2V2KA 1HD0A 4B17A 3BDPA 2MKCA 1S48A 3ICLA 4DL7A 2V5HG 4J9SA 2DR9A 1HD1A 2FDNA 2JFKA 3GFHA 4PXEA 1T95A 1N6QA 3MECB 1RA7A 1YQHA 2LEBA 1IKVB 4FP9A 2I38A 4CO1A 2UUBF 4ZVEA 1OSDA 3KOAA 2LVWA 5I3UB 3IWLA 5LT5A 4NLXA 4DWIA 1ULRA 2BJDA 2CPJA 5IQ6A 2MJUA 1HW9A 3BSNA 2DCUB 3LOUA 4K5SA 3HHLC 1X4GA 3KLGB 4K4WA 3LO3A 2R2TA 3ZZUA 2CG4A 1E6VB 2EVZA 3CCMS 2ABYA 4FF1A 4JUZA 1OO0B 2ZZNA 5C42A 2VV5A 3PY8A 5C24B 3QZ7A 1QTMA 1TKXB 2NSBA 2ZD1B 1KEKA 4DQRA 2KDOA 1U49A 2VODA 3DLHA 3BO4A 3OR1A 4FYDA 1YRTA 2CVIA 4LSLB 1Y3KA 3DRRB 2MSTA 1HBNA 3N6MA 4OX8A 2VB6A 5DDRC 1VQNS 3SYZA 2DGWA 4LF8F 3MGJA 6FD1A 2YNFA 1HNIA 1SQEA 2I8EA 4U9RA 2DNQA 2VFSA 3M1VB 3SSSA 2MGZA 3RR7A 1R8PA 2HYIB 1TR0A 4YP3A 4LF7F 2GO8A 3GFYA 3KG4A 2PC6A 4IH7A 1D8ZA 4OFZA 4DEZA 1UVJA 2I9SA 3BGRA 3FEZA 3M2VB 3M6XA 2P6SA 3PXGa 5D3GB 3VAHA 4NLOA 2R7VA 1ZPWX 4MIAA 5GVQA 2RRAA 1OPZA 1TQLA 2Q79A 2XMWA 1Q1KA 4RWWA 4ZOSA 3RRKA 4DSIA 3D1OA 2W9CA 2HG4A 4PG7A 2EWHA 2K1RA 5KT3A 3ZZZA 2QT7A 1TP7A 2RT3A 3WDOA 3U02A 5DM6Q 2XLIA 2Z0GA 3QO9A 2IRXA 3FEXB 2E1RA 2VZ9A 5K14A 1I94F 2AV5A 2VD3A 4DV7F 4RW9B 1FKOB 2WCXA 2XULA 2LYVA 5I4MA 1RKIA 1LOUA 5DGAA 2MQOA 2XEXA 2JC1A 2PT0A 3QGGA 4B9VA 2HVHA 2HNYB 2EFQA 1VK8A 1WEZA 2DGQA 4A8MP 2HRYA 4HKQA 5HN0A 4QWBA 2V4RA 4ZS6A 2MSSA 2PMZD 3MD1A 4ECXA 1S49A 1JJ2R 5A2QY 1UAWA 2AYMA 5KTQA 1S7HA 3JTPA 2LMIA 5MAOA 4DV0F 1AW0A 4YR2A 1VQ9S 2V8VA 3PZPA 3KHGA 4O4RA 3HX9A 2DH9A 5BR8F 5M2PA 2O5DA 3W2WB 4RW7B 1VQ8S 5AXNA 3N6NA 4O4GA 3S1TA 3DLEB 2DNNA 1CPZA 3TP2A 2B6AA 1RP5A 1HFEL 2DITA 1T3OA 1YJWS 3VZHA 4QBUA 3J7ZT 3OTBA 3SFUA 1IBLF 2ZBIA 3DMJA 2CQDA 3GZ7A 5IFMA 1AXQA 3AJ1A 3ZZTA 4ATNA 2ZJQQ 1HR0F 3MMAA 4R0JA 4DSLA 4DFPA 1JLAB 2VQEF 4O3PA 3HVTA 4NLGA 5GADI 2VQFF 2YX7A 1YJNS 2B43A 2KG0A 2VPYB 5B0AA 2JWNA 4I2PB 4DUYF 1C4AA 3H2UB 1S9EA 2N7YA 5DDQC 5HP1A 2J6UA 1FE0A 2EKYA 3CC2S 1NH7A 4B9TA 2DB1A 3OHAA 5CYQB 2ZH1A 1FXRA 5EWGA 1S76D 2R7SA 1CC7A 1SIWB 3D0HE 3R5AA 1TZ0A 4NLQA 4QR2A 5E41A 1KD1T 3GFZA 3SEOA 1NEEA 2YNHA 1KQFB 2E44A 1LW2A 3KK3A 2E5IA 3BN7A 3OFFA 3I87A 5F8NA 5J2QA 1YJUA 4WU2A 3K8VA 5H9EJ 3IBWA 4ZPDA 3UWTA 2AJ4A 3CE8A 4NZ0A 3RYLA 1VQYA 5KFCA 4BS2A 1X4HA 3X3UA 4OI3A 2E9TA 2KJWA 4MK7A 1U1MA 2CPXA 1YRXA 4XIUA 2IJNA 4NRTA 1NK4A 5F8JA 1KVJA 3M9MB 4HTJA 1U1OA 3DOLB 4CTAB 4X62F 1LW0B 3KLEA 5KFGA 3K5MA 2YH0A 5IM0B 4NLRA 2E9RX 3OLBA 3EXCX 4X4PA 3IFEA 4QJVA 3Q2TC 3MCSA 4JOUA 4LQ3A 2B4PA 2XSJA 3VZIA 4QYRA 2UVRA 1P27B 3G6XA 1WTFA 1IKYB 2DNRA 1WI8A 2L9NA 1N36F 1S1VB 5KFMA 4X84A 2J7UA 5DQHA 4EZ9A 3MEGA 4QPTA 1FA0A 1CEZA 2X1BA 4OLOA 3V4IA 3WX4A 3DLLQ 5EWFA 4IOAQ 2GQCA 4ZLPA 1U6FA 4C11B 3OR2B 5KFUA 5B0CA 4JI1F 3N4WA 4NMLA 3IWXA 1S1UA 2IC3A 5LXYA 4AL6A 1VQKS 3T6BA 1DHMA 1ROFA 2CQPA 4ZPAA 2NREA 4H4OA 4WFXA 4KHMA 2HLTA 3FSYA 4CNYA 2GW8A 1UA0A 3MM6B 4QIFA 4CI0B 3MM8A 4PWUA 3SFGA 4FXWA 2EPIA 2YX4A 4URSA 2BQUA 1M5PC 4I67A 2KJVA 3RBDA 1Y5LB 5BYQA 4ZHRB 1VI7A 4EYHB 4WE1A 4ED6A 1SIZA 1GTEA 3AY0A 2FC8A 3MR2A 4HTIA 4B9MA 5GAGU 3SDEA 3CJ0A 2CPFA 1RTIA 2I5JB 5KFQA 3PRDA 3DLGB 1DLOA 5HI7A 4IYQA 3L7PA 2J7WA 1Z4UA 5K8PA 2HMIB 2F8HA 4B3MF 2JH3A 1U1LA 2JVRA 2NSCA 4YR0A 1WF1A 2DO4A 4P7VA 4IH6A 3V81B 2VA2A 2J9DE 1SJ1A 2IHR1 1KNZA 2VH7A 2LKZA 1FRIA 2KXNB 3FSIA 3G4SS 2D1CA 2OP5A 3TUIC 3BN4A 2PA8D 3RRHA 1TV6B 4NYPA 5CCLA 4RX6A 4X4UA 3PHEA 2EFNA 4CO4A 1SUQA 2QFJA 4GO7X 1SH2A 1X4AA 2CJQA 2VFVA 3I32A 3CCES 5KFTA 4H4MB 3CJ2A 2E9ZA 4RZRA 1WTBA 4ZVHA 5F3TA 4X4QA 2MKIA 3VAGA 4LQ9A 4DL4A 2J6TA 5DQIA 1ZAVA 3DI6A 4JBCA 4X4TA 5L1IA 3PIPQ 1HI0P 2FJEB 3I5AA 4NCAA 5CCMA 4KO0B 4UQTA 3EGZA 2X3GA 2WSFC 5DM7Q 1X8DA 2Q3PA 1P1TA 1C0TB 2C2EA 1FK9A 1VRUA 5BJRA 1JXLA 1UEVA 3FMWA 3KLFA 2KRBA 3EPGA 2DGUA 2W9AA 2XMKA 3DOKB 3U1NA 3SQGA 3CMAS 2HNZA 4YFUA 4DBQA 4PXCA 2R8JA 2VASA 3OFEA 2AGPA 4OL8A 2DTJA 3UR3C 4EFAC 2Q1LA 1X9WA 1S0MA 1VFJA 3TOQA 4V19X 2PIIA 3LW5C 3W2VA 4ES1A 1FRMA 4USHA 2BUNA 4Y2CA 1S77D 4ECSA 1JLCB 4K4UA 1YVFA 1VJWA 4LF4F 2XGQA 4IG3B 2MQPA 3HPOA 2PSZA 3EX7B 4Q2LA 1TKZB 4UUWA 3DLKB 4ILMA 2ZHAA 2LQ9A 1HNVB 4DV5F 3PKMA 4ZCKA 4EUVA 2UVVA 3IC1A 2CVEA 2XI3A 3TVZA 5GAHU 4NRUA 5L1LA 2AU0A 2ASDA 4EWTA 2DRBA 1FEHA 3CF5Q 4QU7A 2VG5A 2XY5A 4IFVB 1HWLA 3O1LA 3RB3A 3CD5A 3MF5A 4QIEA 1CVJA 4ZP8A 1WELA 2HWHA 5KFHA 4EBDA 2MZRA 4IKAA 1OIAA 1UJ5A 3SCIE 5KG5A 4DMZA 3TI0A 2HHXA 2XMUA 3TYTA 1N52B 4C3MA 1T02A 2BABA 4ED2A 2UXDF 1QUPA 2F7VA 2KYXA 4USJC 3VWSA 2IM0A 2R8KA 2F9DA 1S6OA 4C0HA 3R3TA 1SV5A 4J9NA 3NMRA 3SV3A 1D3WA 4OJ3A 5J2PB 5J1PA 4C0BA 1S6QB 3D0IE 3NP5A 4D3GA 2GA7A 3TRGA 4I7FB 2LXFA 3K5PA 4KKOB 4OHWA 4DR4F 3RB6A 1FJGF 5I3QA 5J2NA 2Z2MA 3H40A 4RW6A 4WK3A 3HVWA 2DCLA 2NLWA 2ZHBA 1HQEA 1ZM2A 1S4FA 3KHHA 1G7CB 2D41A 1OPIA 4OV1A 3GYXB 4Y28C 4QWDA 2O67A 3EPIA 1DRZA 4IQXA 4NXNF 3K7RA 2G9OA 4Y6IA 1B0TA 2IA0A 3M32A 1VLYA 3MEEA 3OTDA 4OZ1A 1N5YB 2XLJA 2R7QA 2J5AA 5KT6A 2EBGA 2QYCA 2E66A 2JDJA 2K2PA 3MEDA 3NLCA 5CYMB 3H59A 2DK2A 5E3QA 1FVQA 3D54A 4U67Q 3DRPA 1AUDA 2PN6A 3MM5A 3DDNA 2HHSA 1M5HA 4LVOP 3K0JA 1O5JA 4OI6A 3VAKA 4ES2A 3H4BA 2FVCA 1KVIA 1HMVA 3R5DA 3P5TL 2QSWA 2ROEA 1ZZNA 2FJAB 1Y3JA 2WONB 5IS2A 1DURA 2GQ2A 4XDCA 5A8KA 2ZBCA 2Y1JA 2MMYA 1V3ZA 2LEAA 3C6UA 3HMJG 2BZ2A 2DGXA 3PJWA 4X4RA 1ZTWA 4J9QA 1QM9A 1RTDB 2BACA 2IRYA 2WK4A 3V6DB 1HPZB 1N5SA 1NB7A 2QA4S 2YKNA 2YWHA 2EW9A 5D78A 3MECA 5JUMA 1HYSB 4BCAA 1IKVA 1QE1B 3OV7A 4IUFA 3N79A 3I0RA 4YEAA 1X4CA 4K5RA 5KFYA 4JI0F 5I3UA 4JYAF 1G1XA 2KVIA 5CD4H 3WC2A 2ZM6F 3KLIB 4KB7A 3RTVA 1HQUA 2YH1A 1X4DA 4ECWA 5F8HA 1RI7A 4LMZA 3M8QB 2DNZA 5HMYA 4ZMMA 1VOMA 2GMJA 4A8OA 2BRLA 5DG7A 3O44A 1TKXA 2NZ4A 2ZD1A 1HBUB 2IJFA 2CIMA 2HNDB 3QIPB 4OX9F 3H2VE 3G6ES 5L1KA 1APSA 3PO5A 3QJLA 3MMBB 1L3SA 3UQSA 3T1HF 5LJ5Y 4LSLA 4J9LA 1S1TA 3AQOA 3OXGA 2NUHA 3CCSS 1URRA 1KLNA 2GCFA 3H98A 3MM7B 5KT2A 2OH2A 2QA1A 1UVIA 4JV0A 2DPIA 3M1VA 3RRGA 1S6PB 3SCKE 1X9SA 4L3NA 4IOBA 3CSKA 2XLKA 1HBMA 3KNGA 4C7QA 2DD8S 1ZOTA 3M2VA 4C8MA 2FJWA 2DHAA 1S10A 4KQZA 4DF8A 1SL0A 4IO1A 1FDDA 1KRPA 1K0TA 1YG0A 1S99A 1BGXT 2KFZA 4ECRA 4HVZA 3ENWA 1OSCA 1NAQA 3DFEA 3QAUA 1AROP 1R8HA 5EWEA 3GYNA 2DNOA 3THPA 2QA4G 2RE1A 1T8EA 2HHQA 1K1SA 1DQAA 4CO5A 1Q79A 3DYAB 4HH1