2ACZB

Complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/electron transport
total genus 58
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2aczB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aczB01
3AE9B 2BS3B 3W5VB 1VLBA 1SB3C 1PDXA 2WS3B 5C3JB 4YT0B 1AYFA 1CZPA 1TJEA 1IUEA 2PKOA 1JRPA 5AUIA 1E10A 4IDIA 1NYRA 1RFKA 2MH7A 1H7XA 1WXQA 1QOAA 3AMZA 3AE3B 3AN1A 3AE6B 3BIID 4YSZB 2W3RA 1XO3A 3NVYA 4N58A 4USAA 3W9CB 4YTPB 1DGJA 1KRHA 1TKYA 4P6VF 1FMAD 3AECB 1QOFA 3WCQA 1DOYA 3ETRA 4KX6B 3B2FA 2Y5CA 2LEKA 1UWMA 2MJDA 2K5PA 2CJOA 1KF6B 1NEKB 1XLPA 3FC4A 1XLOA 1A70A 3P1MA 3DWMA 2PIAA 1DOIA 5EE1A 1J7AA 3HUIA 3AE4B 5EE3A 1ZUD2 3B9JA 3NRZA 3P63A 3AEAB 1FRDA 1YJIA 3VR9B 4US9A 3P4RB 1FFUA 1RYJA 1L6UA 3NVVA 5EE0A 3SR6A 3ABVB 1FM0D 1OFFA 2M56B 2WDVB 2Q5WD 2B76B 3AEEB 1QOGA 4YSYB 2W55A 4JX1C 1QLBB 1R7SA 2K9XA 1XLNA 4N6EB 3ZYYX 2JQRB 4LTUA 3HRDD 2DWQA 4C80A 1T3QA 5C2TB 2G1EA 5G5HA 2ACZB 1NVID 1QF6A 2DBYA 1YJJA 1E0ZA 1RM6C 1OQRA 2EKIA 1QOBA 3FAHA 1E7PB 1GTEA 3VRBB 1N60A 4YSXB 3P4QB 1N5WA 5EE9A 1FO4A 1JROA 1KFYB 2H89B 1NI3A 2N0SB 2PVGC 1FIQA 3LXFA 2WU2B 3CWIA 5G5GA 3AE1B 1JW9D 1L0VB 2FBWB 1E9MA 2OHFA 2WLBA 2PVOD 5GXGB 1V97A 2WDRB 3VR8B 2E3TA 1J7CA 3AE2B 1FFVA 1N61A 1WGKA 1WYGA 2H88B 3P4SB 3DWGC 3HVZA 3VRAB 1RWSA 2CJNA 2WU5B 3RPFC 4JWUC 1ZP0B 1YQ3B 2WQYB 3SFDB 1N63A 1V8CA 1VJKA 5H8YE 3B2GA 4HROA 5H92C 2JX5A 3NVWA 3CIRB 4US8A 4ITKA 3AEBB 4C7ZA 1L6VA 1JQ4A 1B9RA 1ZOYB 3AE5B 3AB5A 1N62A 4HRSA 4YTNB 3AE8B 1QT9A 1GAQB 3AH7A 3NVZA 1JALA 1FRRA 2W54A 1F0ZA 3P4PB 1SF0A 3AEFB 1PFDA 1TKGA 1OQQA 1WWTA 1PUTA 1ZXIA 1FXIA 4FXCA 1YQ4B 2WDQB 3NS1A 4JWSC 1CJEA 2HTME 1DOXA 3SFEB 1WRIA 2BT6A 2MJ3A 1VDVA 4ZHOA 1L5PA 1GT8A 2CU3A 2KAJA 1NENB 1I7HA 1AWDA 3EUB2 4WQMA 4ZHPA 2BS4B 1TYGB 1J7BA 1ROEA 3W5UB 4A9AA 5MPOA 2W3SA 2BS2B 4N59A 2MJEA 1NYQA 3AEDB 2L52A 1GTHA 1JWAD 1XLQA 4WWMA 5AUKA 4YTMB 1EWYC 2QJLA 3AEGB 1SIJA 3L4PA 1H7WA 1TKEA 1N5XA 2WP9B 2M19A 3AV8A 3AM9A 3CF4A 4C7YA 2K22A 2AX5A 1E6EB 1FXAA 3AE7B 3PO0A 1GPXA 1JWBD 4ZOHC 2L83A 3KWLA 2QIEB 3LB8C 4YXDB 2KMMA
chains in the Genus database with same CATH superfamily
5AZHA 3C0RB 3N3KB 3SEBA 2WXGA 1JWMD 4RGTA 3I9V1 1WXAA 2ZNVC 4FA6A 1V1OA 2XN9C 4ZDVA 5LLIA 4K3CA 1TY0A 2CU1A 4XE0A 2PIAA 4RNAA 4LNNA 5IP4D 3Q3FA 1SE4A 1WJ6A 2Z59B 4ZRQA 2PMVA 3NVVA 3H8HA 4ZRJA 2WGSA 3ZXVA 2INNE 2N9KA 3T8MA 2BWES 1TS5A 1WMHB 2AL3A 1V5TA 4FLHA 2PW9A 1FIQA 2KVZA 4B6WA 3DQVA 3MP9A 2CJNA 4I6LB 3RPFC 2KDMA 2OOBB 2MSED 1VJKA 4N9F4 5H8YE 2WXJA 3JSVA 5IO9A 1YX6B 2KZRA 1TZ1A 3A1QA 2KVRA 2EMSA 2RD0A 4HKQA 2MJ3A 4FULA 2LWPA 4ZHOA 1XT9B 2J0JA 4EE2A 2ICIA 2L0FA 4HCNB 2Z0EB 1ROEA 2D3CA 3BWUD 4XWTA 1RLFA 1JWAD 1EWYC 4ZYNA 1TTNA 2WP9B 1WI0A 3TEXA 3AE7B 2O2VB 1YN5A 5IN7A 4G50A 3RN9C 3DBLB 1UBQA 1AYFA 1I4GA 3LYYA 1K51A 4TSSA 1T6BX 1J19A 4ZRKA 3RFZB 2D5GA 1A5RA 5BYSA 4HJKA 4USAA 1C3TA 4ANVA 4GDKB 4XC2A 1SE2A 1SEBD 2I1JA 4UDUC 2WX0A 2LGDA 3EFUA 1EO6A 2WXKA 3WIMA 2KKCA 4A8XC 1FFUA 1RYJA 1RFAA 1FNUA 2B76B 4HDQA 4HLEA 4YSYB 2MA9B 2DWQA 2ACZB 3Q3OC 3IT4B 4II3B 2WXIA 1QOBA 4TMAB 3D32A 1N5WA 2LVPA 3A1QB 1NI3A 5HG2A 1XCTL 4WJOA 2WXQA 4R3DA 3EA6A 1VD2A 1VZ7A 3PRPB 4BAXA 3T3NA 1C1YB 3DBHB 3PZ8A 3NVWA 5D3IB 1ZDVA 3QWZB 2LZ6A 1B9RA 4WWOA 5JHAA 3RMKC 2W54A 5FR6A 4P6VF 2NPTA 3UQBA 4XGAB 4K7UA 1FPYA 1R4NI 3APCA 5FR3A 5MPOA 3ZTDA 4ARCA 3WAOA 1R4MI 1WRDB 3L4PA 2GMIC 1EF1A 2ZZPB 4KIKA 2I38A 3K9PB 3NG0A 4Q2JA 2KK8A 3KQ4A 2BS3B 2MP2A 1PDXA 1WYWB 2LGXA 3MHSD 3SU8X 1DOYA 2JYTA 1FD6A 5JZEB 1RFKA 2LJ5A 1WGDA 4YSZB 2W3RA 1XD3B 4M8MA 2J53A 1FMAD 3KW5B 3LDZE 3IVFA 2D07B 1IBXA 1XLPA 2KLGA 3L10B 3Q3MC 1UD7A 3DVNU 3HUIA 1WXSA 2PJHA 3J9CA 3ZQ4A 1WH3A 4IWQA 1L6UA 3Q8CA 3H7PA 3M63B 3RNAC 3HK0A 3TCAA 2SEBD 4N6EB 3HRDD 3QJZA 4KDIC 3QX1A 1TS3A 2V4LA 3L0WB 4WH4A 2IYDB 4B0MA 1XQQA 2BWFA 1HTQA 4LDTB 1TY2A 5TSSA 2KHWB 1FNWA 2NPTB 2PVOD 4GMVA 3IT6B 2V3SA 2N7DA 1YQBA 2OEDA 2JXXA 2K3UA 1SJHD 5HI1A 3BVZA 3DHIC 3I5JC 3B08A 3A33B 1CMXB 2CHZA 1GJZA 3TEZA 2JY6A 1N62A 2L3ZA 2NBVB 1WWTA 4KIKB 2A5UA 2MCNB 3UIPB 2DNFA 1P9DU 3SFEB 3KUCB 4RM8A 4A6QA 4JQWC 1I4RA 1AWDA 2R2OA 1MHXA 3UF8A 4N59A 2L52A 1NBFC 1GTHA 4JIOU 3KUZA 3SHQA 2KFKA 1K53A 1E6EB 2L76A 1KLGD 4L23A 4FBJB 3I63C 3PZ7A 4ZOHC 2M17A 4KZ0A 4KKIA 3PREA 3VTVA 5EDSA 3A4SC 4O1NA 1XO3A 4LCDE 2KDIA 4TQ1A 3ZDTA 2VH2A 3QCAA 2JT4B 4DQOC 2Y5PA 4IKGA 4RCOA 4MACA 3ML8A 2K5PA 4KV2A 3M3JA 3P1MA 4RH6A 2KT7A 2BYEA 3N30A 1YJIA 3VAWA 1FEHA 1V81A 3R7QA 2C7HA 2M56B 2UU7A 3PTFC 4ZRIA 3N9YC 4AS1A 4MSMB 1LFDA 3BY4B 2KDEB 3FAHA 2N7EA 2WYQA 3R7RA 2D3BA 1LXDA 2LRWA 2MRPA 5L83A 2WXPA 3HVZA 3VUXA 3PHXB 4BOSC 2LI5A 2KJ6A 4BBNF 1ESFA 2KANA 4XX5A 3B1LX 2V4IB 4YTNB 4K1RB 2N9EB 2HTHA 4TKNA 2EMTA 2NR2A 2Z0DB 3KYCD 3HVDA 2AWTA 2GBJA 4FHKA 1NENB 2PEAA 2I2YA 2NMQA 2QSDA 4GXBA 4S0RA 4B95A 5AUKA 2LGYA 2M4NA 3AU5A 1P3QU 2PTLA 1BXTA 4B9KA 1PQSA 1FXAA 1E7VA 2UWQA 1HA5A 1R4MB 5CTRC 1B1ZA 1WZ3A 4BKSD 2MWSB 5D6JB 4DXFA 1TZOA 2WNMA 4NJ7A 3VUYA 2NVUI 5E6NA 2WXOA 1QZEA 2JWZA 1OTRB 2CJOA 4GOCA 1KF6B 2XK5A 2ZNVB 2QMTA 1TS2A 4HDOA 3P63A 3AEAB 3VR9B 4M00A 5EE0A 2IY1B 1C76A 3TBLD 1T5XD 2REXA 5TR5A 2JQRB 2OJWA 2LJIA 1G6JA 5D7GA 1SIFA 1D5ZC 1WGRA 1YJJA 2ZW0A 5C23A 4MH0E 2GBNA 3TSSA 2KN5A 4LLGM 4M02A 2VZKD 2DYMA 1MHHE 5E6JA 1C79A 1T0QC 4LNKA 1RWSA 2JYEA 2M1MA 4P1BC 1L4ZB 3VXWA 1GNUA 2WWZA 5FK9C 1GAQB 3AH7A 3ZDMC 1FRRA 4HK2A 3AEFB 2L00B 2WXNA 1WX7A 3VDZA 2FIDA 2RR9A 3PVLA 1VDVA 2BYFA 4HCPB 3R8BA 2YLMA 3GOEA 4AQ7A 2ZCBA 2ZW1A 3APDA 4W9HA 1H7WA 1TKEA 3T9LA 1WMHA 5E6PA 4WQOB 1GPXA 3URYA 1VLBA 1C9FA 3AULA 3AXCA 4J6IA 4TUUA 1FXTB 3NY5A 5T8IA 2V3NA 4HJGE 1K8RB 4EKUA 1P1AA 4YTPB 2K39A 2N9LA 1V2YA 4ARIA 2K8BA 3SD5A 1HZ5A 3BK2A 2BF8B 1ZUD2 2N9XA 3VH4B 2VH1A 3N32A 3ZXRA 2MBEA 3IBEA 2KWCA 2BPSA 4FJYA 5IOIA 4II2B 1E7PB 4YSXB 1FO4A 2O2VA 2PVGC 1E8YA 3TMPB 4C56C 1WYGA 3QAQA 1XEEA 4JWUC 2BYVE 1YNTE 3SFDB 2FIFA 4GDKA 1T0SC 2C7MB 5CX3A 4A20A 4MELA 2LHDA 1C78A 2ZPYA 2YVCA 3ZNGC 5HHDG 1ZXIA 3ZW3A 2HTME 2PPHA 2SAKA 1M4VA 1MJDA 3NZ3A 4BKSA 2MBHA 1SSNA 1LO5D 4OVUA 2J0MA 2FE8A 3NS8A 3DPDA 2KQ4X 3W2DA 4WWPA 1I4HA 2KXJA 1KJTA 4WWMA 1WR1A 2WXFA 4W9EA 3ZJUA 3R3MA 2HJ1A 3MC0B 3KVFB 2EKEC 2KYWA 3KWLA 3NJTA 3PRZA 1MG8A 2N1WA 4K81A 1C77A 1MVKA 2MBBB 1PGXA 3AN1A 3ZNID 2J4XA 1QILA 3NVYA 4N58A 2DYBA 2AYOB 1L7YA 2GBMA 2O6VD 1J0GA 2BB6A 2GBKA 1NEKB 1D3ZA 1XLOA 4G3XB 1LQBA 2WHIA 4EOYA 1F1HA 2L05A 2GB1A 4E3CA 4NJ6A 4WJPA 4EFOA 1FRDA 2BVCA 1WIAA 1PGAA 4OZAA 5IKCM 3OJ4B 1FCLA 1ZDXA 2V9HA 1OGWA 3M95A 2KNBA 2Y3AA 2DBYA 4DHZB 5DCNA 3V62A 4MDKE 4IM2A 4HEA1 1JROA 2LUMA 2HDEA 4IM0A 2GOWA 3Q3JA 2WLBA 2D2QA 3A9KB 3N1XC 4L2YA 2E3TA 4W9CA 3AE2B 2X8XX 1EF5A 2GI9A 1UH6A 5H92C 4MM3B 3NHEB 1Q10A 2V3PA 3L16A 3PPAA 1ZOYB 4DDGD 2K8HA 2KMAA 2IO3B 1KOTA 3DVGY 1ACCA 3IFWB 3IHPC 4KGSA 2AEHA 2YEPF 2JZ3B 4JGHB 2DX5B 3EC8A 1Z2MA 1SIJA 1S3SG 2JXTA 4K7WA 2JF5A 1JWSD 4PYUA 3PT2B 2INCC 3U7DA 3ZIMA 1XF5L 3ZJTA 1F2RI 2MLBA 2W9NA 2VZKB 3M62B 4YT0B 2PKOA 3ZUNA 5JH5C 1JRPA 2KX3A 4FJVB 1UZXB 3DBRI 1YD8U 4CYEA 2LVQA 3T3OA 3V60A 1EM7A 1UWMA 1F9JA 4MGZE 3RI7C 2ZPNA 3MJWA 3NZUA 1JCKB 4M01A 3NRZA 3VFKA 1OQYA 3WANA 2M8SA 4HVBA 2Q5WD 2K9XA 3SDLC 2LD9A 4W9LA 4WJQA 1UGMA 5G5HA 3B0AA 4BZAA 4BBNC 4IUMB 4RF1A 2IO1B 1RM6C 2MHJA 4ICVA 4TQ0A 2FCNA 1IYFA 1EU4A 2D10A 3LJ3A 3ZO5B 2WX1A 1FFVA 2IJ0A 4DK5A 1KLVA 2NTSA 1C4AA 1ZP0B 2QHOA 3IAS1 4YWGG 2JX5A 3L17A 3UQAA 3DVNV 3AE5B 1YOVB 1UNSA 4JE3B 5DPWA 2IPKD 2RDHA 3NVZA 1JALA 3RNCC 1IGCA 1YQ4B 3NS1A 2NTTA 3VUWA 4ASWC 3Q2AC 2AQ1B 3RNEC 1I7HA 4TV3A 3N1ZC 2Z8LA 4IOIE 3IXSA 5HFYA 2BS2B 1V5OA 3UGBB 1XLQA 4ANXA 2M0XA 2QJLA 5CHFA 2O6VA 4DHJD 5BMHA 2INDC 1WR6E 2R61A 2KC2A 5J18A 1WXVA 2L1AA 1STEA 3RCZA 2KX0A 1Y56A 3RT3B 4URKA 2BKFA 4A90A 3RNBC 1P98A 4IDIA 3MTNB 1WXQA 1QOAA 4NAWB 3AE3B 3QK0A 1WX8A 3BIID 3N1YC 3W9CB 4BKTA 2JWUA 1TS4A 4CQNA 3ETRA 4G11A 2KQ7A 2BQQA 4RGOS 1CQVA 2DZIA 2J52A 3CSFA 1WJ4A 2PE9A 3TUOA 1R7SA 2LGSA 3ZYYX 2OJRA 2BBCA 1HXYD 3EECA 3H6NA 3UINB 4GB9A 1NDDA 2FAZA 4C00A 1GB1A 5BYRA 4W9GA 3W1YA 1N60A 4LNOA 2KDBA 3R66C 1H8CA 3ZRCA 2WU2B 5G5GA 1JW9D 2DLBA 3BVGA 4WWNA 5G2NA 1ET6A 3GE3C 2WDRB 1WGKA 2FCSA 4ANWA 2RPQA 1J8CA 1V6EA 3U8ZA 4US8A 1JQ4A 2O6VB 2G4SA 1PUTA 2LMCA 4HPPA 1DOXA 1Y8RC 3WALA 1KLUD 2DENB 3EUB2 1SGHA 2ZEQA 1ISNA 4MH8A 4BKGA 4A3OA 2HD5B 1WF9A 2KJRA 2N1VA 3C8YA 1GOZA 3U4EG 2K1FA 3AV8A 3CF4A 4C7YA 1P0RA 1MG4A 4BFRA 4DXGA 2LGIA 2HE7A 3AE9B 4GSWA 1VRAB 1E10A 1NYRA 5AEKB 5DPTA 1OEYA 3X23A 1ZXHA 4XDCA 2XBBC 3RULA 3B2FA 2KOXA 2BW2A 3OWEB 4M0WB 1R4NB 3RYTA 3AU4A 3DBRB 1E90A 3GB1A 3V6CB 2UYZB 3B9JA 1WGYA 1QKZA 4DWFA 4OZCA 4IWOA 4EZJA 1Z5SB 2JUOA 1T3QA 5C2TB 1BMLC 2KDFB 3MFGA 5AZGA 1LGRA 4D2KA 1UGJA 4OVZA 3VRBB 3V3XA 2KWDA 4MEMA 3LXFA 2ONQA 5AZFA 4W9DA 3VR8B 1N61A 1XXGA 4RF0A 2H88B 3DWGC 2PE6B 3VRAB 4CO7A 1ENFA 1N63A 2BYTA 4ITKA 1D5XC 5LXIB 1S1QB 3ZTCA 4HRSA 4PS7A 2IY0B 3V6EB 3P4PB 4WQMA 4ZHPA 1OQQA 1TGZB 2TSSA 1FXIA 1GC7A 4J3OD 1ZE3D 4MT5A 2BT6A 4EUTA 2W3SA 2MJEA 3MHZA 1WGHA 4JPSA 5C1ZA 3QHTA 3DHGC 1SE3A 2CS4A 1TT5B 3RD2A 2QEJC 2WXRA 2L83A 2B3AA 1HZ6A 2KMMA 4PT5A 1JRUA 1WM3A 3ZNZB 3AMZA 1H7XA 3FILB 3QQ8B 5BO4B 1D6EC 3TJPA 2WDTB 4JL9A 1DGJA 1TKYA 3QA8A 4HWIB 3ZGZA 3PRMB 1ZKHA 2D3AA 2BTEA 1A70A 1VCBA 4M8NA 4NY0A 4WJNA 1F2RC 1YX5B 4RM9A 3Q8FA 3I57A 3OJ3A 4MJSB 2AQ3B 1OFFA 1WM2A 3VTWA 2G9HD 1XLNA 3RZFA 3RZWC 4RMAA 3P42A 1V1PB 2J7QB 1QF6A 2K0PA 3PHWB 3MC9A 4DHJB 3BINA 2H89B 2LHEA 5GXGB 4IM3A 4EEWA 3KUDB 3L13A 4PK1A 1VZ6A 4NJCA 2NBWB 4F7ZA 4HPMB 4AWJA 4HXDA 4OVVA 2PLPA 2MW5A 3R2IA 2MX2A 3GZNI 4QAYA 1GC6A 1QT9A 3AE8B 2IDYA 2IGHA 4EZKA 1PFDA 4FXCA 1WE7A 4K3BA 5IAAC 2INPE 5DPSA 3JYUA 1L5PA 1GUAB 2KAJA 3ENEA 2DHZA 3TIXA 2BS4B 1TYGB 1K50A 2VRRB 4I6PA 1IPGA 4E71A 3W1SC 4FHJA 4W9IA 4AP4C 1YJ1A 4ZRPA 2RSUA 2IO2B 1PYWD 3EFCA 2MBOA 3BYYB 2AX5A 1V80A 2XNAC 3NUHB 3HM6X 3PO0A 4DBGA 2C60A 5GMVA 4L1BA 3A9KA 1ET9A 3NZSA 2MH7A 1AW7A 1WX9A 4WAFA 1MFWA 2ZVNA 4GLSC 4LJPB 3HHMA 4MM3A 3AECB 2LXCA 2RDGA 3DBSA 3FC4A 3EGRA 4K7SA 2NBUA 2QDFA 4A55A 3KLSX 4EZLA 4US9A 3P4RB 3N20C 3Q3NC 2IZVB 1L2NA 1C4CA 2W55A 4JX1C 4BVUC 1E8XA 1RAXA 2GRIA 5KHQA 1I4PA 4ZYSA 3ZLZA 1GTEA 2G3QB 3O65B 5HKHA 3CWIA 4G0NB 4C4VA 1J7CA 2K6QA 1WSPA 2KD0A 4E74A 1IGDA 3U2SC 3B2GA 1N6ZA 3PLUA 3IG3A 2EELA 1L6VA 3KH0A 1C4PA 1TKGA 3I3TB 2WDQB 4NQLB 2RGFA 3KWVA 1L0XB 1JWUD 5DPRA 5J2RA 2JU6X 3H1UA 3BK1A 1NYQA 2V1YA 2L8JA 2NCNA 4ICUA 2WXLA 2M19A 2G45B 2CHXA 1SE9A 1Q1OA 3TL5A 3W5VB 1SB3C 3WA0A 2J42A 1IUEA 5D2MB 1PGBA 2L0TA 4XYCA 3ZNHB 3P2BA 4H2AA 2C9WB 1HEZE 1EU3A 4KSKC 4NPNA 3HIZA 1E7UA 2KLCA 3PLVA 4KX6B 2LEKA 3EHVA 3JSVB 3MJ5A 1SBBB 2JZZA 3L08A 3ZVVA 1LM8B 1DOIA 4GDLA 4X57B 1J7AA 2QILA 3WAMA 1AN8A 3AE4B 1WJUA 4HKZE 4KVGB 4C4VB 4IC7B 1P7EA 4XWWA 5CHWA 3Q69A 1M94A 2XEWA 2L7RA 4MGIE 1IP9A 4LTUA 2DZJA 4C80A 2V0GA 3Q6BA 1OQRA 2FNJB 1GB4A 5D94A 3QC8B 2KFJA 1I4QA 2DZMA 2CHWA 4WURA 1VZ8A 1WGGA 2KN4A 1YN3A 4LK0M 3U30A 2KMCA 3ZRFA 4NAWA 3P4SB 2ASQA 5LNK1 2GBRA 4MGYE 1V8CA 3CMMB 1TBEA 2FCMA 1E0ZA 1WXMA 2IGGA 1OEYJ 1L0YB 4WIPA 3U7ZA 3GZNB 1MI0A 4P7IA 1FNVA 3ALBA 2K25A 1H4RA 5IA7A 2WXMA 5J17A 5CHVC 2KO3A 3UIOB 1MPEA 2X38A 2AQ2B 3AM9A 2K22A 4RGNA 3JW0X 4GDLB 1JWBD 1WZ0A 3Q8EA 1CZPA 2NS5A 3CF6E 3K9OB 5AUIA 4CHKA 3QARA 4W9FA 2MBQA 3OLMD 2BB5A 4XDDA 4AOFA 4RFBA 4FN2A 2RMMA 1BUIC 2GLSA 4IWPA 3ZJVA 3WCQA 3BVMA 1V49A 1F77A 2J0KA 2KTFA 3R2TA 1I42A 1T0RC 3ECIA 5EE1A 4WAAA 3DHHC 4ACFA 2D11A 4S17A 3SR6A 1FM0D 3DCGA 4DXAB 1HQRD 1SJED 2G1EA 3L54A 1E8WA 1L4DB 1E5WA 3DOWA 2JRIB 2KACA 4HPLB 1BT0A 5EE9A 3WAPA 2MEKA 3E9SA 1YIWA 1WFYA 1L0VB 4W9KA 2MP2B 3O13A 2JZPA 4PS8A 5D3DA 4FADA 4GU2A 4OHJA 3CSTA 5BYQA 2WU5B 3V61A 1F52A 1QQRA 2A4ZA 4HROA 1D4BA 4AJYB 1KTKA 3RUIB 1YN4A 1IBXB 2IBIB 2IO0B 2I1KA 4M0WA 3FKYA 1NI2A 1P7FA 4GN1A 1F0ZA 1UELA 1U4AA 4B0EA 4JWSC 2Y5BB 2KWVB 1CJEA 1EWCA 1I35A 4BOZB 4F1SA 5L95C 2ON8A 2RDBC 3H7PB 2DYOA 1J7BA 3W5UB 4MGKE 4A3PA 3AEGB 1E8ZA 2FUG1 4AJWA 3HM3A 1CK1A 3JVZX 5G55A 3QIJA 3LB8C 3S2AA 1RRBA 3GP7A 2WS3B 1TJEA 3VTUA 3VVWB 3H9DA 2C5LC 2JPHA 3Q8BA 2IGDA 1KRHA 2JSVX 3DDCB 5JXVA 1ZW7A 2Y5CA 2FUHB 2MJDA 4F8CB 3PS6A 4YL8A 4DHZE 4OW0A 3W1SA 4W9JA 4KKJA 2R2QA 4NZLB 1I4XA 5EE3A 2LUEA 4KSLC 3AI5A 3VQIA 2CKHB 2G4DB 2WDVB 4PYZA 3AEEB 1XCQL 1QLBB 2KQSA 4P1CC 1VR9A 3OAWA 1NVID 3IAM1 3VHTC 1WE6A 2EKIA 4PS3A 4LJOB 5JHBA 2KFKB 2N4FA 3P4QB 3ONSA 2K6DB 3RNGC 3AE1B 5E6OA 2FBWB 3KYDD 1Q0WB 3A4RA 4OZBA 3VH3B 4AUQC 1ZPSA 1HTOA 4NAMA 2HJ8A 4JLCA 3FILA 1KH0A 5LXHA 4DDID 3CIRB 2L32A 2K8CA 4XZ4A 4ANUA 2LFIA 2W82A 1JMLA 4IG7B 1SF0A 2YEPB 3PZDA 2LVOA 1WRIA 2LASA 2CU3A 4MJSA 2CR5A 1ZGUB 4A9AA 3TEWA 4NNJB 2MQJA 2ZVOA 1GG3A 4YTMB 1V1PA 2FCQA 3DBLI 1WJNA 2N7JA 5FKAC 3ML9A 3V05A 1SXTA 2D3GA 1K52A 4KGRA 5C3JB 1V86A 4P16A 4LNFA 3AE6B 3ZKJC 4KZCA 1D5MC 2KTRA 3DVGX 1TIFA 3PSEB 3Q8AA 1QOFA 3A9JA 2ZJDA 2AL6A 2JRHA 4GGQA 3BYTB 3BZDB 3UI3A 2BKRB 1UUPA 3DWMA 4MSQB 3U52E 2QC8A 2ZCCA 4FJZA 1UBIA 4GIVA 3X0WA 2BGFA 3MC8A 2RPVA 2WXHA 3ABVB 3PV1A 5I4DA 1UF0A 1AARA 3TEYA 3OG5A 1QOGA 5BMIA 1Q5WB 2KJHB 1WY8A 1YMHE 3GE8C 4REZA 2DAFA 1KFYB 3H7SA 3PGEA 2N0SB 1X1MA 3DBHI 1E9MA 2OHFA 2JVCA 1V97A 3APFA 3RNFC 2KC1A 4I6NB 1V9JA 4KDLB 2C7NB 1YQ3B 2WQYB 1EUVB 3AEBB 4C7ZA 1KM7A 3AB5A 3NOBA 2M0AA 1DYQA 3C19A 2XK5B 3E56A 1UWXA 2QCZA 1GT8A 3Q14C 2N9PC 3GS2A 4NQKE 4KGTA 2E6XA 2KTRB 3AEDB 2DAJA 1FCCC 2LRUA 3A9JB 1N5XA 2LXAA 4LDTD 1T0YA 2KWUB 1HE8A 4IW0A 2DZKA 4RGMA 4LNIA 5KHOA 2QIEB 4YXDB 5BMGA
chains in the Genus database with same CATH topology
3W5VB 1Y56A 1SB3C 4DXFA 4A90A 2J42A 1IUEA 1TZOA 2WNMA 1PGBA 4IDIA 2WXGA 3SEBA 1JWMD 1WXQA 1QOAA 4NAWB 3AE3B 4RGTA 3BIID 4H2AA 3I9V1 3W9CB 1HEZE 1EU3A 2JWUA 1TS4A 1V1OA 4CQNA 2WXOA 3ETRA 4KX6B 2LEKA 3MJ5A 2XN9C 2CJOA 1KF6B 1SBBB 1TY0A 4XE0A 2PIAA 4RGOS 1DOIA 1CQVA 1J7AA 2QILA 4RNAA 1AN8A 3AE4B 2QMTA 2J52A 1TS2A 1SE4A 3P63A 3AEAB 4HKZE 3VR9B 4ZRQA 2PMVA 3NVVA 3H8HA 5EE0A 1P7EA 4XWWA 1C76A 3Q69A 3TUOA 2INNE 1R7SA 1T5XD 2N9KA 3ZYYX 2BBCA 1HXYD 2JQRB 4LTUA 2LJIA 4C80A 1TS5A 2V0GA 5D7GA 1D5ZC 1GB1A 1YJJA 2ZW0A 5BYRA 1OQRA 1GB4A 1N60A 1I4QA 3TSSA 4WURA 2PW9A 1VZ8A 1FIQA 4LLGM 2WU2B 5G5GA 2VZKD 1JW9D 2KN4A 1YN3A 2DLBA 3BVGA 1ET6A 4LK0M 2WDRB 2DYMA 1MHHE 5E6JA 1C79A 1WGKA 3P4SB 3MP9A 1RWSA 2CJNA 5LNK1 2JYEA 3RPFC 2KDMA 5H8YE 1V8CA 1VJKA 4US8A 2WXJA 1L4ZB 1JQ4A 5FK9C 1GAQB 3AH7A 1FRRA 1E0ZA 3AEFB 2WXNA 1PUTA 2IGGA 2LMCA 4HKQA 1L0YB 4WIPA 1DOXA 3U7ZA 2MJ3A 4ZHOA 1VDVA 1MI0A 1KLUD 4EE2A 1FNVA 3EUB2 2ICIA 3R8BA 1ROEA 4MH8A 3BWUD 4XWTA 4AQ7A 2WXMA 1JWAD 2ZW1A 1EWYC 3C8YA 1GOZA 1H7WA 1TKEA 2WP9B 3U4EG 1MPEA 3AV8A 2X38A 2AQ2B 3CF4A 3AM9A 4C7YA 2K22A 4RGNA 3TEXA 3AE7B 1YN5A 4GDLB 1GPXA 1JWBD 3URYA 4DXGA 2LGIA 3AE9B 1VLBA 3Q8EA 1C9FA 1CZPA 1AYFA 1I4GA 3LYYA 5AUIA 1VRAB 1E10A 1NYRA 1K51A 4TSSA 1T6BX 5T8IA 2V3NA 3RFZB 2D5GA 4HJGE 2BB5A 4XDDA 4USAA 5BYSA 4RFBA 4YTPB 2N9LA 2RMMA 1BUIC 1SE2A 1ZXHA 4GDKB 4XDCA 1SEBD 3ZJVA 3WCQA 4ARIA 3B2FA 3BVMA 2BW2A 1F77A 3OWEB 4UDUC 3R2TA 3GB1A 5EE1A 1HZ5A 3BK2A 1ZUD2 3B9JA 2WXKA 4A8XC 1FFUA 1RYJA 1QKZA 3SR6A 1FNUA 1FM0D 4OZCA 2B76B 4YSYB 1HQRD 2DWQA 1SJED 5C2TB 1T3QA 2G1EA 2ACZB 1BMLC 3IT4B 3MFGA 2WXIA 4D2KA 1L4DB 1QOBA 1UGJA 1E7PB 4TMAB 4OVZA 3VRBB 2KACA 4YSXB 1N5WA 5EE9A 1FO4A 3V3XA 2KWDA 2MEKA 3E9SA 1NI3A 2PVGC 5HG2A 1XCTL 3LXFA 2WXQA 4R3DA 2ONQA 1L0VB 3O13A 3VR8B 2JZPA 1N61A 1XXGA 3EA6A 4RF0A 5D3DA 1WYGA 4C56C 2H88B 3DWGC 4OHJA 1VZ7A 5BYQA 3VRAB 1XEEA 2WU5B 4JWUC 1ENFA 3T3NA 1YNTE 1QQRA 3SFDB 1N63A 2BYTA 3PZ8A 4HROA 1D4BA 3NVWA 1KTKA 1ZDVA 5D3IB 4ITKA 1D5XC 1YN4A 1B9RA 1IBXB 4M0WA 4HRSA 2LHDA 2W54A 1P7FA 1C78A 1F0ZA 3P4PB 4WQMA 4ZHPA 4B0EA 1OQQA 2TSSA 2L1AA 1ZXIA 1FXIA 4JWSC 4P6VF 5HHDG 4J3OD 1CJEA 1EWCA 1ZE3D 2HTME 4MT5A 2BT6A 2SAKA 1M4VA 3NZ3A 2ON8A 1SSNA 1LO5D 2FE8A 2DYOA 1J7BA 3W5UB 5FR3A 5MPOA 2W3SA 2KQ4X 3W2DA 2MJEA 1I4HA 3MHZA 4ARCA 4WWMA 2WXFA 4JPSA 3AEGB 3L4PA 1SE3A 3ZJUA 2FUG1 3MC0B 1CK1A 2QEJC 2WXRA 2I38A 2L83A 3KWLA 3LB8C 1HZ6A 2KMMA 4Q2JA 3GP7A 3KQ4A 2BS3B 4PT5A 1PDXA 2WS3B 1DOYA 1TJEA 1C77A 1MVKA 2JYTA 1FD6A 1PGXA 3AN1A 1RFKA 3AMZA 1H7XA 3FILB 2J4XA 1QILA 1D6EC 4YSZB 2W3RA 3NVYA 4N58A 3Q8BA 2IGDA 1DGJA 1KRHA 1TKYA 2J53A 2JSVX 1FMAD 5JXVA 3ZGZA 2Y5CA 2BB6A 2MJDA 1IBXA 1NEKB 1XLPA 2BTEA 1XLOA 1A70A 4OW0A 3W1SA 3HUIA 2GB1A 4KKJA 1F2RC 4NZLB 1I4XA 5EE3A 3Q8FA 3I57A 3J9CA 1FRDA 3ZQ4A 1L6UA 3Q8CA 2AQ3B 1OFFA 1PGAA 4OZAA 3VQIA 2WDVB 3AEEB 1XCQL 2SEBD 1QLBB 4N6EB 2G9HD 1XLNA 1FCLA 1ZDXA 3HRDD 1VR9A 3P42A 1TS3A 1V1PB 1NVID 2Y3AA 1QF6A 2DBYA 3IAM1 4WH4A 2EKIA 4B0MA 2K0PA 3P4QB 4HEA1 1JROA 2LUMA 2H89B 1TY2A 5TSSA 2HDEA 1FNWA 3AE1B 2LHEA 5GXGB 2FBWB 2WLBA 2PVOD 4L2YA 4OZBA 2E3TA 3AE2B 1ZPSA 1VZ6A 2GI9A 4NJCA 4NAMA 3FILA 1KH0A 3IT6B 2OEDA 2K3UA 1SJHD 5H92C 2PLPA 5HI1A 4MM3B 3CIRB 3BVZA 1Q10A 2L32A 2V3PA 3R2IA 1ZOYB 2LFIA 2W82A 3TEZA 1N62A 1QT9A 3AE8B 2IDYA 2IGHA 1JMLA 1WWTA 1SF0A 1PFDA 2YEPB 4FXCA 1ACCA 2INPE 3SFEB 1WRIA 1L5PA 4KGSA 2CU3A 4A6QA 2KAJA 1I4RA 2YEPF 1AWDA 2BS4B 1TYGB 1K50A 4A9AA 1MHXA 3TEWA 4N59A 2L52A 1GTHA 4YTMB 4ZRPA 1V1PA 1SIJA 2JXTA 1PYWD 1JWSD 2N7JA 1K53A 3BYYB 2AX5A 1E6EB 1KLGD 2XNAC 3NUHB 3PO0A 1XF5L 4L23A 5FKAC 3V05A 3PZ7A 4ZOHC 3ZJTA 1SXTA 1F2RI 4L1BA 1K52A 4KKIA 4KGRA 2VZKB 5C3JB 4YT0B 2PKOA 1ET9A 1JRPA 4P16A 2MH7A 1AW7A 3AE6B 4O1NA 4WAFA 1XO3A 1D5MC 4GLSC 4TQ1A 3T3OA 4DQOC 2Y5PA 3Q8AA 3AECB 1QOFA 4IKGA 1EM7A 4MACA 4RCOA 1UWMA 2RDGA 2K5PA 3FC4A 3EGRA 3BYTB 3BZDB 3P1MA 3UI3A 4RH6A 1UUPA 3DWMA 4A55A 3KLSX 3U52E 1JCKB 3NRZA 1YJIA 1FEHA 4US9A 3P4RB 2RPVA 2WXHA 3ABVB 2M56B 5I4DA 2Q5WD 3TEYA 1C4CA 1QOGA 2W55A 4JX1C 5BMIA 2K9XA 3N9YC 4AS1A 1YMHE 2GRIA 5G5HA 1I4PA 4ZYSA 4RF1A 1RM6C 3FAHA 1GTEA 4REZA 4TQ0A 1KFYB 2N0SB 3CWIA 1EU4A 1E9MA 2OHFA 1V97A 1J7CA 1FFVA 2IJ0A 1WSPA 2WXPA 3HVZA 1IGDA 2NTSA 1C4AA 3U2SC 1ZP0B 1YQ3B 2WQYB 3IAS1 4YWGG 3B2GA 2JX5A 1ESFA 3AEBB 2EELA 4C7ZA 1L6VA 3AE5B 3AB5A 1UNSA 2V4IB 2M0AA 4JE3B 4YTNB 2IPKD 2RDHA 3NVZA 1JALA 1C4PA 1DYQA 1TKGA 1IGCA 1YQ4B 2WDQB 3NS1A 3E56A 1UWXA 3HVDA 3KWVA 1L0XB 1GT8A 2NTTA 1JWUD 1NENB 2AQ1B 1I7HA 2I2YA 3GS2A 2JU6X 2Z8LA 2NMQA 2QSDA 4IOIE 4KGTA 3BK1A 3IXSA 5HFYA 2BS2B 2E6XA 1NYQA 3AEDB 5AUKA 1XLQA 1FCCC 2QJLA 1N5XA 2WXLA 2PTLA 2M19A 5BMHA 1BXTA 2R61A 1FXAA 1HA5A 4RGMA 2QIEB 1B1ZA 4YXDB 5BMGA 1STEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE9 B;  2BS3 B;  3W5V B;  1VLB A;  1SB3 C;  1PDX A;  2WS3 B;  5C3J B;  4YT0 B;  1AYF A;  1CZP A;  1TJE A;  1IUE A;  2PKO A;  1JRP A;  5AUI A;  1E10 A;  4IDI A;  1NYR A;  1RFK A;  2MH7 A;  1H7X A;  1WXQ A;  1QOA A;  3AMZ A;  3AE3 B;  3AN1 A;  3AE6 B;  3BII D;  4YSZ B;  2W3R A;  1XO3 A;  3NVY A;  4N58 A;  4USA A;  3W9C B;  4YTP B;  1DGJ A;  1KRH A;  1TKY A;  4P6V F;  1FMA D;  3AEC B;  1QOF A;  3WCQ A;  1DOY A;  3ETR A;  4KX6 B;  3B2F A;  2Y5C A;  2LEK A;  1UWM A;  2MJD A;  2K5P A;  2CJO A;  1KF6 B;  1NEK B;  1XLP A;  3FC4 A;  1XLO A;  1A70 A;  3P1M A;  3DWM A;  2PIA A;  1DOI A;  5EE1 A;  1J7A A;  3HUI A;  3AE4 B;  5EE3 A;  1ZUD 2;  3B9J A;  3NRZ A;  3P63 A;  3AEA B;  1FRD A;  1YJI A;  3VR9 B;  4US9 A;  3P4R B;  1FFU A;  1RYJ A;  1L6U A;  3NVV A;  5EE0 A;  3SR6 A;  3ABV B;  1FM0 D;  1OFF A;  2M56 B;  2WDV B;  2Q5W D;  2B76 B;  3AEE B;  1QOG A;  4YSY B;  2W55 A;  4JX1 C;  1QLB B;  1R7S A;  2K9X A;  1XLN A;  4N6E B;  3ZYY X;  2JQR B;  4LTU A;  3HRD D;  2DWQ A;  4C80 A;  1T3Q A;  5C2T B;  2G1E A;  5G5H A;  2ACZ B;  1NVI D;  1QF6 A;  2DBY A;  1YJJ A;  1E0Z A;  1RM6 C;  1OQR A;  2EKI A;  1QOB A;  3FAH A;  1E7P B;  1GTE A;  3VRB B;  1N60 A;  4YSX B;  3P4Q B;  1N5W A;  5EE9 A;  1FO4 A;  1JRO A;  1KFY B;  2H89 B;  1NI3 A;  2N0S B;  2PVG C;  1FIQ A;  3LXF A;  2WU2 B;  3CWI A;  5G5G A;  3AE1 B;  1JW9 D;  1L0V B;  2FBW B;  1E9M A;  2OHF A;  2WLB A;  2PVO D;  5GXG B;  1V97 A;  2WDR B;  3VR8 B;  2E3T A;  1J7C A;  3AE2 B;  1FFV A;  1N61 A;  1WGK A;  1WYG A;  2H88 B;  3P4S B;  3DWG C;  3HVZ A;  3VRA B;  1RWS A;  2CJN A;  2WU5 B;  3RPF C;  4JWU C;  1ZP0 B;  1YQ3 B;  2WQY B;  3SFD B;  1N63 A;  1V8C A;  1VJK A;  5H8Y E;  3B2G A;  4HRO A;  5H92 C;  2JX5 A;  3NVW A;  3CIR B;  4US8 A;  4ITK A;  3AEB B;  4C7Z A;  1L6V A;  1JQ4 A;  1B9R A;  1ZOY B;  3AE5 B;  3AB5 A;  1N62 A;  4HRS A;  4YTN B;  3AE8 B;  1QT9 A;  1GAQ B;  3AH7 A;  3NVZ A;  1JAL A;  1FRR A;  2W54 A;  1F0Z A;  3P4P B;  1SF0 A;  3AEF B;  1PFD A;  1TKG A;  1OQQ A;  1WWT A;  1PUT A;  1ZXI A;  1FXI A;  4FXC A;  1YQ4 B;  2WDQ B;  3NS1 A;  4JWS C;  1CJE A;  2HTM E;  1DOX A;  3SFE B;  1WRI A;  2BT6 A;  2MJ3 A;  1VDV A;  4ZHO A;  1L5P A;  1GT8 A;  2CU3 A;  2KAJ A;  1NEN B;  1I7H A;  1AWD A;  3EUB 2;  4WQM A;  4ZHP A;  2BS4 B;  1TYG B;  1J7B A;  1ROE A;  3W5U B;  4A9A A;  5MPO A;  2W3S A;  2BS2 B;  4N59 A;  2MJE A;  1NYQ A;  3AED B;  2L52 A;  1GTH A;  1JWA D;  1XLQ A;  4WWM A;  5AUK A;  4YTM B;  1EWY C;  2QJL A;  3AEG B;  1SIJ A;  3L4P A;  1H7W A;  1TKE A;  1N5X A;  2WP9 B;  2M19 A;  3AV8 A;  3AM9 A;  3CF4 A;  4C7Y A;  2K22 A;  2AX5 A;  1E6E B;  1FXA A;  3AE7 B;  3PO0 A;  1GPX A;  1JWB D;  4ZOH C;  2L83 A;  3KWL A;  2QIE B;  3LB8 C;  4YXD B;  2KMM A; 
#chains in the Genus database with same CATH topology
 5AZH A;  3C0R B;  3N3K B;  3SEB A;  2WXG A;  1JWM D;  4RGT A;  3I9V 1;  1WXA A;  2ZNV C;  4FA6 A;  1V1O A;  2XN9 C;  4ZDV A;  5LLI A;  4K3C A;  1TY0 A;  2CU1 A;  4XE0 A;  2PIA A;  4RNA A;  4LNN A;  5IP4 D;  3Q3F A;  1SE4 A;  1WJ6 A;  2Z59 B;  4ZRQ A;  2PMV A;  3NVV A;  3H8H A;  4ZRJ A;  2WGS A;  3ZXV A;  2INN E;  2N9K A;  3T8M A;  2BWE S;  1TS5 A;  1WMH B;  2AL3 A;  1V5T A;  4FLH A;  2PW9 A;  1FIQ A;  2KVZ A;  4B6W A;  3DQV A;  3MP9 A;  2CJN A;  4I6L B;  3RPF C;  2KDM A;  2OOB B;  2MSE D;  1VJK A;  4N9F 4;  5H8Y E;  2WXJ A;  3JSV A;  5IO9 A;  1YX6 B;  2KZR A;  1TZ1 A;  3A1Q A;  2KVR A;  2EMS A;  2RD0 A;  4HKQ A;  2MJ3 A;  4FUL A;  2LWP A;  4ZHO A;  1XT9 B;  2J0J A;  4EE2 A;  2ICI A;  2L0F A;  4HCN B;  2Z0E B;  1ROE A;  2D3C A;  3BWU D;  4XWT A;  1RLF A;  1JWA D;  1EWY C;  4ZYN A;  1TTN A;  2WP9 B;  1WI0 A;  3TEX A;  3AE7 B;  2O2V B;  1YN5 A;  5IN7 A;  4G50 A;  3RN9 C;  3DBL B;  1UBQ A;  1AYF A;  1I4G A;  3LYY A;  1K51 A;  4TSS A;  1T6B X;  1J19 A;  4ZRK A;  3RFZ B;  2D5G A;  1A5R A;  5BYS A;  4HJK A;  4USA A;  1C3T A;  4ANV A;  4GDK B;  4XC2 A;  1SE2 A;  1SEB D;  2I1J A;  4UDU C;  2WX0 A;  2LGD A;  3EFU A;  1EO6 A;  2WXK A;  3WIM A;  2KKC A;  4A8X C;  1FFU A;  1RYJ A;  1RFA A;  1FNU A;  2B76 B;  4HDQ A;  4HLE A;  4YSY B;  2MA9 B;  2DWQ A;  2ACZ B;  3Q3O C;  3IT4 B;  4II3 B;  2WXI A;  1QOB A;  4TMA B;  3D32 A;  1N5W A;  2LVP A;  3A1Q B;  1NI3 A;  5HG2 A;  1XCT L;  4WJO A;  2WXQ A;  4R3D A;  3EA6 A;  1VD2 A;  1VZ7 A;  3PRP B;  4BAX A;  3T3N A;  1C1Y B;  3DBH B;  3PZ8 A;  3NVW A;  5D3I B;  1ZDV A;  3QWZ B;  2LZ6 A;  1B9R A;  4WWO A;  5JHA A;  3RMK C;  2W54 A;  5FR6 A;  4P6V F;  2NPT A;  3UQB A;  4XGA B;  4K7U A;  1FPY A;  1R4N I;  3APC A;  5FR3 A;  5MPO A;  3ZTD A;  4ARC A;  3WAO A;  1R4M I;  1WRD B;  3L4P A;  2GMI C;  1EF1 A;  2ZZP B;  4KIK A;  2I38 A;  3K9P B;  3NG0 A;  4Q2J A;  2KK8 A;  3KQ4 A;  2BS3 B;  2MP2 A;  1PDX A;  1WYW B;  2LGX A;  3MHS D;  3SU8 X;  1DOY A;  2JYT A;  1FD6 A;  5JZE B;  1RFK A;  2LJ5 A;  1WGD A;  4YSZ B;  2W3R A;  1XD3 B;  4M8M A;  2J53 A;  1FMA D;  3KW5 B;  3LDZ E;  3IVF A;  2D07 B;  1IBX A;  1XLP A;  2KLG A;  3L10 B;  3Q3M C;  1UD7 A;  3DVN U;  3HUI A;  1WXS A;  2PJH A;  3J9C A;  3ZQ4 A;  1WH3 A;  4IWQ A;  1L6U A;  3Q8C A;  3H7P A;  3M63 B;  3RNA C;  3HK0 A;  3TCA A;  2SEB D;  4N6E B;  3HRD D;  3QJZ A;  4KDI C;  3QX1 A;  1TS3 A;  2V4L A;  3L0W B;  4WH4 A;  2IYD B;  4B0M A;  1XQQ A;  2BWF A;  1HTQ A;  4LDT B;  1TY2 A;  5TSS A;  2KHW B;  1FNW A;  2NPT B;  2PVO D;  4GMV A;  3IT6 B;  2V3S A;  2N7D A;  1YQB A;  2OED A;  2JXX A;  2K3U A;  1SJH D;  5HI1 A;  3BVZ A;  3DHI C;  3I5J C;  3B08 A;  3A33 B;  1CMX B;  2CHZ A;  1GJZ A;  3TEZ A;  2JY6 A;  1N62 A;  2L3Z A;  2NBV B;  1WWT A;  4KIK B;  2A5U A;  2MCN B;  3UIP B;  2DNF A;  1P9D U;  3SFE B;  3KUC B;  4RM8 A;  4A6Q A;  4JQW C;  1I4R A;  1AWD A;  2R2O A;  1MHX A;  3UF8 A;  4N59 A;  2L52 A;  1NBF C;  1GTH A;  4JIO U;  3KUZ A;  3SHQ A;  2KFK A;  1K53 A;  1E6E B;  2L76 A;  1KLG D;  4L23 A;  4FBJ B;  3I63 C;  3PZ7 A;  4ZOH C;  2M17 A;  4KZ0 A;  4KKI A;  3PRE A;  3VTV A;  5EDS A;  3A4S C;  4O1N A;  1XO3 A;  4LCD E;  2KDI A;  4TQ1 A;  3ZDT A;  2VH2 A;  3QCA A;  2JT4 B;  4DQO C;  2Y5P A;  4IKG A;  4RCO A;  4MAC A;  3ML8 A;  2K5P A;  4KV2 A;  3M3J A;  3P1M A;  4RH6 A;  2KT7 A;  2BYE A;  3N30 A;  1YJI A;  3VAW A;  1FEH A;  1V81 A;  3R7Q A;  2C7H A;  2M56 B;  2UU7 A;  3PTF C;  4ZRI A;  3N9Y C;  4AS1 A;  4MSM B;  1LFD A;  3BY4 B;  2KDE B;  3FAH A;  2N7E A;  2WYQ A;  3R7R A;  2D3B A;  1LXD A;  2LRW A;  2MRP A;  5L83 A;  2WXP A;  3HVZ A;  3VUX A;  3PHX B;  4BOS C;  2LI5 A;  2KJ6 A;  4BBN F;  1ESF A;  2KAN A;  4XX5 A;  3B1L X;  2V4I B;  4YTN B;  4K1R B;  2N9E B;  2HTH A;  4TKN A;  2EMT A;  2NR2 A;  2Z0D B;  3KYC D;  3HVD A;  2AWT A;  2GBJ A;  4FHK A;  1NEN B;  2PEA A;  2I2Y A;  2NMQ A;  2QSD A;  4GXB A;  4S0R A;  4B95 A;  5AUK A;  2LGY A;  2M4N A;  3AU5 A;  1P3Q U;  2PTL A;  1BXT A;  4B9K A;  1PQS A;  1FXA A;  1E7V A;  2UWQ A;  1HA5 A;  1R4M B;  5CTR C;  1B1Z A;  1WZ3 A;  4BKS D;  2MWS B;  5D6J B;  4DXF A;  1TZO A;  2WNM A;  4NJ7 A;  3VUY A;  2NVU I;  5E6N A;  2WXO A;  1QZE A;  2JWZ A;  1OTR B;  2CJO A;  4GOC A;  1KF6 B;  2XK5 A;  2ZNV B;  2QMT A;  1TS2 A;  4HDO A;  3P63 A;  3AEA B;  3VR9 B;  4M00 A;  5EE0 A;  2IY1 B;  1C76 A;  3TBL D;  1T5X D;  2REX A;  5TR5 A;  2JQR B;  2OJW A;  2LJI A;  1G6J A;  5D7G A;  1SIF A;  1D5Z C;  1WGR A;  1YJJ A;  2ZW0 A;  5C23 A;  4MH0 E;  2GBN A;  3TSS A;  2KN5 A;  4LLG M;  4M02 A;  2VZK D;  2DYM A;  1MHH E;  5E6J A;  1C79 A;  1T0Q C;  4LNK A;  1RWS A;  2JYE A;  2M1M A;  4P1B C;  1L4Z B;  3VXW A;  1GNU A;  2WWZ A;  5FK9 C;  1GAQ B;  3AH7 A;  3ZDM C;  1FRR A;  4HK2 A;  3AEF B;  2L00 B;  2WXN A;  1WX7 A;  3VDZ A;  2FID A;  2RR9 A;  3PVL A;  1VDV A;  2BYF A;  4HCP B;  3R8B A;  2YLM A;  3GOE A;  4AQ7 A;  2ZCB A;  2ZW1 A;  3APD A;  4W9H A;  1H7W A;  1TKE A;  3T9L A;  1WMH A;  5E6P A;  4WQO B;  1GPX A;  3URY A;  1VLB A;  1C9F A;  3AUL A;  3AXC A;  4J6I A;  4TUU A;  1FXT B;  3NY5 A;  5T8I A;  2V3N A;  4HJG E;  1K8R B;  4EKU A;  1P1A A;  4YTP B;  2K39 A;  2N9L A;  1V2Y A;  4ARI A;  2K8B A;  3SD5 A;  1HZ5 A;  3BK2 A;  2BF8 B;  1ZUD 2;  2N9X A;  3VH4 B;  2VH1 A;  3N32 A;  3ZXR A;  2MBE A;  3IBE A;  2KWC A;  2BPS A;  4FJY A;  5IOI A;  4II2 B;  1E7P B;  4YSX B;  1FO4 A;  2O2V A;  2PVG C;  1E8Y A;  3TMP B;  4C56 C;  1WYG A;  3QAQ A;  1XEE A;  4JWU C;  2BYV E;  1YNT E;  3SFD B;  2FIF A;  4GDK A;  1T0S C;  2C7M B;  5CX3 A;  4A20 A;  4MEL A;  2LHD A;  1C78 A;  2ZPY A;  2YVC A;  3ZNG C;  5HHD G;  1ZXI A;  3ZW3 A;  2HTM E;  2PPH A;  2SAK A;  1M4V A;  1MJD A;  3NZ3 A;  4BKS A;  2MBH A;  1SSN A;  1LO5 D;  4OVU A;  2J0M A;  2FE8 A;  3NS8 A;  3DPD A;  2KQ4 X;  3W2D A;  4WWP A;  1I4H A;  2KXJ A;  1KJT A;  4WWM A;  1WR1 A;  2WXF A;  4W9E A;  3ZJU A;  3R3M A;  2HJ1 A;  3MC0 B;  3KVF B;  2EKE C;  2KYW A;  3KWL A;  3NJT A;  3PRZ A;  1MG8 A;  2N1W A;  4K81 A;  1C77 A;  1MVK A;  2MBB B;  1PGX A;  3AN1 A;  3ZNI D;  2J4X A;  1QIL A;  3NVY A;  4N58 A;  2DYB A;  2AYO B;  1L7Y A;  2GBM A;  2O6V D;  1J0G A;  2BB6 A;  2GBK A;  1NEK B;  1D3Z A;  1XLO A;  4G3X B;  1LQB A;  2WHI A;  4EOY A;  1F1H A;  2L05 A;  2GB1 A;  4E3C A;  4NJ6 A;  4WJP A;  4EFO A;  1FRD A;  2BVC A;  1WIA A;  1PGA A;  4OZA A;  5IKC M;  3OJ4 B;  1FCL A;  1ZDX A;  2V9H A;  1OGW A;  3M95 A;  2KNB A;  2Y3A A;  2DBY A;  4DHZ B;  5DCN A;  3V62 A;  4MDK E;  4IM2 A;  4HEA 1;  1JRO A;  2LUM A;  2HDE A;  4IM0 A;  2GOW A;  3Q3J A;  2WLB A;  2D2Q A;  3A9K B;  3N1X C;  4L2Y A;  2E3T A;  4W9C A;  3AE2 B;  2X8X X;  1EF5 A;  2GI9 A;  1UH6 A;  5H92 C;  4MM3 B;  3NHE B;  1Q10 A;  2V3P A;  3L16 A;  3PPA A;  1ZOY B;  4DDG D;  2K8H A;  2KMA A;  2IO3 B;  1KOT A;  3DVG Y;  1ACC A;  3IFW B;  3IHP C;  4KGS A;  2AEH A;  2YEP F;  2JZ3 B;  4JGH B;  2DX5 B;  3EC8 A;  1Z2M A;  1SIJ A;  1S3S G;  2JXT A;  4K7W A;  2JF5 A;  1JWS D;  4PYU A;  3PT2 B;  2INC C;  3U7D A;  3ZIM A;  1XF5 L;  3ZJT A;  1F2R I;  2MLB A;  2W9N A;  2VZK B;  3M62 B;  4YT0 B;  2PKO A;  3ZUN A;  5JH5 C;  1JRP A;  2KX3 A;  4FJV B;  1UZX B;  3DBR I;  1YD8 U;  4CYE A;  2LVQ A;  3T3O A;  3V60 A;  1EM7 A;  1UWM A;  1F9J A;  4MGZ E;  3RI7 C;  2ZPN A;  3MJW A;  3NZU A;  1JCK B;  4M01 A;  3NRZ A;  3VFK A;  1OQY A;  3WAN A;  2M8S A;  4HVB A;  2Q5W D;  2K9X A;  3SDL C;  2LD9 A;  4W9L A;  4WJQ A;  1UGM A;  5G5H A;  3B0A A;  4BZA A;  4BBN C;  4IUM B;  4RF1 A;  2IO1 B;  1RM6 C;  2MHJ A;  4ICV A;  4TQ0 A;  2FCN A;  1IYF A;  1EU4 A;  2D10 A;  3LJ3 A;  3ZO5 B;  2WX1 A;  1FFV A;  2IJ0 A;  4DK5 A;  1KLV A;  2NTS A;  1C4A A;  1ZP0 B;  2QHO A;  3IAS 1;  4YWG G;  2JX5 A;  3L17 A;  3UQA A;  3DVN V;  3AE5 B;  1YOV B;  1UNS A;  4JE3 B;  5DPW A;  2IPK D;  2RDH A;  3NVZ A;  1JAL A;  3RNC C;  1IGC A;  1YQ4 B;  3NS1 A;  2NTT A;  3VUW A;  4ASW C;  3Q2A C;  2AQ1 B;  3RNE C;  1I7H A;  4TV3 A;  3N1Z C;  2Z8L A;  4IOI E;  3IXS A;  5HFY A;  2BS2 B;  1V5O A;  3UGB B;  1XLQ A;  4ANX A;  2M0X A;  2QJL A;  5CHF A;  2O6V A;  4DHJ D;  5BMH A;  2IND C;  1WR6 E;  2R61 A;  2KC2 A;  5J18 A;  1WXV A;  2L1A A;  1STE A;  3RCZ A;  2KX0 A;  1Y56 A;  3RT3 B;  4URK A;  2BKF A;  4A90 A;  3RNB C;  1P98 A;  4IDI A;  3MTN B;  1WXQ A;  1QOA A;  4NAW B;  3AE3 B;  3QK0 A;  1WX8 A;  3BII D;  3N1Y C;  3W9C B;  4BKT A;  2JWU A;  1TS4 A;  4CQN A;  3ETR A;  4G11 A;  2KQ7 A;  2BQQ A;  4RGO S;  1CQV A;  2DZI A;  2J52 A;  3CSF A;  1WJ4 A;  2PE9 A;  3TUO A;  1R7S A;  2LGS A;  3ZYY X;  2OJR A;  2BBC A;  1HXY D;  3EEC A;  3H6N A;  3UIN B;  4GB9 A;  1NDD A;  2FAZ A;  4C00 A;  1GB1 A;  5BYR A;  4W9G A;  3W1Y A;  1N60 A;  4LNO A;  2KDB A;  3R66 C;  1H8C A;  3ZRC A;  2WU2 B;  5G5G A;  1JW9 D;  2DLB A;  3BVG A;  4WWN A;  5G2N A;  1ET6 A;  3GE3 C;  2WDR B;  1WGK A;  2FCS A;  4ANW A;  2RPQ A;  1J8C A;  1V6E A;  3U8Z A;  4US8 A;  1JQ4 A;  2O6V B;  2G4S A;  1PUT A;  2LMC A;  4HPP A;  1DOX A;  1Y8R C;  3WAL A;  1KLU D;  2DEN B;  3EUB 2;  1SGH A;  2ZEQ A;  1ISN A;  4MH8 A;  4BKG A;  4A3O A;  2HD5 B;  1WF9 A;  2KJR A;  2N1V A;  3C8Y A;  1GOZ A;  3U4E G;  2K1F A;  3AV8 A;  3CF4 A;  4C7Y A;  1P0R A;  1MG4 A;  4BFR A;  4DXG A;  2LGI A;  2HE7 A;  3AE9 B;  4GSW A;  1VRA B;  1E10 A;  1NYR A;  5AEK B;  5DPT A;  1OEY A;  3X23 A;  1ZXH A;  4XDC A;  2XBB C;  3RUL A;  3B2F A;  2KOX A;  2BW2 A;  3OWE B;  4M0W B;  1R4N B;  3RYT A;  3AU4 A;  3DBR B;  1E90 A;  3GB1 A;  3V6C B;  2UYZ B;  3B9J A;  1WGY A;  1QKZ A;  4DWF A;  4OZC A;  4IWO A;  4EZJ A;  1Z5S B;  2JUO A;  1T3Q A;  5C2T B;  1BML C;  2KDF B;  3MFG A;  5AZG A;  1LGR A;  4D2K A;  1UGJ A;  4OVZ A;  3VRB B;  3V3X A;  2KWD A;  4MEM A;  3LXF A;  2ONQ A;  5AZF A;  4W9D A;  3VR8 B;  1N61 A;  1XXG A;  4RF0 A;  2H88 B;  3DWG C;  2PE6 B;  3VRA B;  4CO7 A;  1ENF A;  1N63 A;  2BYT A;  4ITK A;  1D5X C;  5LXI B;  1S1Q B;  3ZTC A;  4HRS A;  4PS7 A;  2IY0 B;  3V6E B;  3P4P B;  4WQM A;  4ZHP A;  1OQQ A;  1TGZ B;  2TSS A;  1FXI A;  1GC7 A;  4J3O D;  1ZE3 D;  4MT5 A;  2BT6 A;  4EUT A;  2W3S A;  2MJE A;  3MHZ A;  1WGH A;  4JPS A;  5C1Z A;  3QHT A;  3DHG C;  1SE3 A;  2CS4 A;  1TT5 B;  3RD2 A;  2QEJ C;  2WXR A;  2L83 A;  2B3A A;  1HZ6 A;  2KMM A;  4PT5 A;  1JRU A;  1WM3 A;  3ZNZ B;  3AMZ A;  1H7X A;  3FIL B;  3QQ8 B;  5BO4 B;  1D6E C;  3TJP A;  2WDT B;  4JL9 A;  1DGJ A;  1TKY A;  3QA8 A;  4HWI B;  3ZGZ A;  3PRM B;  1ZKH A;  2D3A A;  2BTE A;  1A70 A;  1VCB A;  4M8N A;  4NY0 A;  4WJN A;  1F2R C;  1YX5 B;  4RM9 A;  3Q8F A;  3I57 A;  3OJ3 A;  4MJS B;  2AQ3 B;  1OFF A;  1WM2 A;  3VTW A;  2G9H D;  1XLN A;  3RZF A;  3RZW C;  4RMA A;  3P42 A;  1V1P B;  2J7Q B;  1QF6 A;  2K0P A;  3PHW B;  3MC9 A;  4DHJ B;  3BIN A;  2H89 B;  2LHE A;  5GXG B;  4IM3 A;  4EEW A;  3KUD B;  3L13 A;  4PK1 A;  1VZ6 A;  4NJC A;  2NBW B;  4F7Z A;  4HPM B;  4AWJ A;  4HXD A;  4OVV A;  2PLP A;  2MW5 A;  3R2I A;  2MX2 A;  3GZN I;  4QAY A;  1GC6 A;  1QT9 A;  3AE8 B;  2IDY A;  2IGH A;  4EZK A;  1PFD A;  4FXC A;  1WE7 A;  4K3B A;  5IAA C;  2INP E;  5DPS A;  3JYU A;  1L5P A;  1GUA B;  2KAJ A;  3ENE A;  2DHZ A;  3TIX A;  2BS4 B;  1TYG B;  1K50 A;  2VRR B;  4I6P A;  1IPG A;  4E71 A;  3W1S C;  4FHJ A;  4W9I A;  4AP4 C;  1YJ1 A;  4ZRP A;  2RSU A;  2IO2 B;  1PYW D;  3EFC A;  2MBO A;  3BYY B;  2AX5 A;  1V80 A;  2XNA C;  3NUH B;  3HM6 X;  3PO0 A;  4DBG A;  2C60 A;  5GMV A;  4L1B A;  3A9K A;  1ET9 A;  3NZS A;  2MH7 A;  1AW7 A;  1WX9 A;  4WAF A;  1MFW A;  2ZVN A;  4GLS C;  4LJP B;  3HHM A;  4MM3 A;  3AEC B;  2LXC A;  2RDG A;  3DBS A;  3FC4 A;  3EGR A;  4K7S A;  2NBU A;  2QDF A;  4A55 A;  3KLS X;  4EZL A;  4US9 A;  3P4R B;  3N20 C;  3Q3N C;  2IZV B;  1L2N A;  1C4C A;  2W55 A;  4JX1 C;  4BVU C;  1E8X A;  1RAX A;  2GRI A;  5KHQ A;  1I4P A;  4ZYS A;  3ZLZ A;  1GTE A;  2G3Q B;  3O65 B;  5HKH A;  3CWI A;  4G0N B;  4C4V A;  1J7C A;  2K6Q A;  1WSP A;  2KD0 A;  4E74 A;  1IGD A;  3U2S C;  3B2G A;  1N6Z A;  3PLU A;  3IG3 A;  2EEL A;  1L6V A;  3KH0 A;  1C4P A;  1TKG A;  3I3T B;  2WDQ B;  4NQL B;  2RGF A;  3KWV A;  1L0X B;  1JWU D;  5DPR A;  5J2R A;  2JU6 X;  3H1U A;  3BK1 A;  1NYQ A;  2V1Y A;  2L8J A;  2NCN A;  4ICU A;  2WXL A;  2M19 A;  2G45 B;  2CHX A;  1SE9 A;  1Q1O A;  3TL5 A;  3W5V B;  1SB3 C;  3WA0 A;  2J42 A;  1IUE A;  5D2M B;  1PGB A;  2L0T A;  4XYC A;  3ZNH B;  3P2B A;  4H2A A;  2C9W B;  1HEZ E;  1EU3 A;  4KSK C;  4NPN A;  3HIZ A;  1E7U A;  2KLC A;  3PLV A;  4KX6 B;  2LEK A;  3EHV A;  3JSV B;  3MJ5 A;  1SBB B;  2JZZ A;  3L08 A;  3ZVV A;  1LM8 B;  1DOI A;  4GDL A;  4X57 B;  1J7A A;  2QIL A;  3WAM A;  1AN8 A;  3AE4 B;  1WJU A;  4HKZ E;  4KVG B;  4C4V B;  4IC7 B;  1P7E A;  4XWW A;  5CHW A;  3Q69 A;  1M94 A;  2XEW A;  2L7R A;  4MGI E;  1IP9 A;  4LTU A;  2DZJ A;  4C80 A;  2V0G A;  3Q6B A;  1OQR A;  2FNJ B;  1GB4 A;  5D94 A;  3QC8 B;  2KFJ A;  1I4Q A;  2DZM A;  2CHW A;  4WUR A;  1VZ8 A;  1WGG A;  2KN4 A;  1YN3 A;  4LK0 M;  3U30 A;  2KMC A;  3ZRF A;  4NAW A;  3P4S B;  2ASQ A;  5LNK 1;  2GBR A;  4MGY E;  1V8C A;  3CMM B;  1TBE A;  2FCM A;  1E0Z A;  1WXM A;  2IGG A;  1OEY J;  1L0Y B;  4WIP A;  3U7Z A;  3GZN B;  1MI0 A;  4P7I A;  1FNV A;  3ALB A;  2K25 A;  1H4R A;  5IA7 A;  2WXM A;  5J17 A;  5CHV C;  2KO3 A;  3UIO B;  1MPE A;  2X38 A;  2AQ2 B;  3AM9 A;  2K22 A;  4RGN A;  3JW0 X;  4GDL B;  1JWB D;  1WZ0 A;  3Q8E A;  1CZP A;  2NS5 A;  3CF6 E;  3K9O B;  5AUI A;  4CHK A;  3QAR A;  4W9F A;  2MBQ A;  3OLM D;  2BB5 A;  4XDD A;  4AOF A;  4RFB A;  4FN2 A;  2RMM A;  1BUI C;  2GLS A;  4IWP A;  3ZJV A;  3WCQ A;  3BVM A;  1V49 A;  1F77 A;  2J0K A;  2KTF A;  3R2T A;  1I42 A;  1T0R C;  3ECI A;  5EE1 A;  4WAA A;  3DHH C;  4ACF A;  2D11 A;  4S17 A;  3SR6 A;  1FM0 D;  3DCG A;  4DXA B;  1HQR D;  1SJE D;  2G1E A;  3L54 A;  1E8W A;  1L4D B;  1E5W A;  3DOW A;  2JRI B;  2KAC A;  4HPL B;  1BT0 A;  5EE9 A;  3WAP A;  2MEK A;  3E9S A;  1YIW A;  1WFY A;  1L0V B;  4W9K A;  2MP2 B;  3O13 A;  2JZP A;  4PS8 A;  5D3D A;  4FAD A;  4GU2 A;  4OHJ A;  3CST A;  5BYQ A;  2WU5 B;  3V61 A;  1F52 A;  1QQR A;  2A4Z A;  4HRO A;  1D4B A;  4AJY B;  1KTK A;  3RUI B;  1YN4 A;  1IBX B;  2IBI B;  2IO0 B;  2I1K A;  4M0W A;  3FKY A;  1NI2 A;  1P7F A;  4GN1 A;  1F0Z A;  1UEL A;  1U4A A;  4B0E A;  4JWS C;  2Y5B B;  2KWV B;  1CJE A;  1EWC A;  1I35 A;  4BOZ B;  4F1S A;  5L95 C;  2ON8 A;  2RDB C;  3H7P B;  2DYO A;  1J7B A;  3W5U B;  4MGK E;  4A3P A;  3AEG B;  1E8Z A;  2FUG 1;  4AJW A;  3HM3 A;  1CK1 A;  3JVZ X;  5G55 A;  3QIJ A;  3LB8 C;  3S2A A;  1RRB A;  3GP7 A;  2WS3 B;  1TJE A;  3VTU A;  3VVW B;  3H9D A;  2C5L C;  2JPH A;  3Q8B A;  2IGD A;  1KRH A;  2JSV X;  3DDC B;  5JXV A;  1ZW7 A;  2Y5C A;  2FUH B;  2MJD A;  4F8C B;  3PS6 A;  4YL8 A;  4DHZ E;  4OW0 A;  3W1S A;  4W9J A;  4KKJ A;  2R2Q A;  4NZL B;  1I4X A;  5EE3 A;  2LUE A;  4KSL C;  3AI5 A;  3VQI A;  2CKH B;  2G4D B;  2WDV B;  4PYZ A;  3AEE B;  1XCQ L;  1QLB B;  2KQS A;  4P1C C;  1VR9 A;  3OAW A;  1NVI D;  3IAM 1;  3VHT C;  1WE6 A;  2EKI A;  4PS3 A;  4LJO B;  5JHB A;  2KFK B;  2N4F A;  3P4Q B;  3ONS A;  2K6D B;  3RNG C;  3AE1 B;  5E6O A;  2FBW B;  3KYD D;  1Q0W B;  3A4R A;  4OZB A;  3VH3 B;  4AUQ C;  1ZPS A;  1HTO A;  4NAM A;  2HJ8 A;  4JLC A;  3FIL A;  1KH0 A;  5LXH A;  4DDI D;  3CIR B;  2L32 A;  2K8C A;  4XZ4 A;  4ANU A;  2LFI A;  2W82 A;  1JML A;  4IG7 B;  1SF0 A;  2YEP B;  3PZD A;  2LVO A;  1WRI A;  2LAS A;  2CU3 A;  4MJS A;  2CR5 A;  1ZGU B;  4A9A A;  3TEW A;  4NNJ B;  2MQJ A;  2ZVO A;  1GG3 A;  4YTM B;  1V1P A;  2FCQ A;  3DBL I;  1WJN A;  2N7J A;  5FKA C;  3ML9 A;  3V05 A;  1SXT A;  2D3G A;  1K52 A;  4KGR A;  5C3J B;  1V86 A;  4P16 A;  4LNF A;  3AE6 B;  3ZKJ C;  4KZC A;  1D5M C;  2KTR A;  3DVG X;  1TIF A;  3PSE B;  3Q8A A;  1QOF A;  3A9J A;  2ZJD A;  2AL6 A;  2JRH A;  4GGQ A;  3BYT B;  3BZD B;  3UI3 A;  2BKR B;  1UUP A;  3DWM A;  4MSQ B;  3U52 E;  2QC8 A;  2ZCC A;  4FJZ A;  1UBI A;  4GIV A;  3X0W A;  2BGF A;  3MC8 A;  2RPV A;  2WXH A;  3ABV B;  3PV1 A;  5I4D A;  1UF0 A;  1AAR A;  3TEY A;  3OG5 A;  1QOG A;  5BMI A;  1Q5W B;  2KJH B;  1WY8 A;  1YMH E;  3GE8 C;  4REZ A;  2DAF A;  1KFY B;  3H7S A;  3PGE A;  2N0S B;  1X1M A;  3DBH I;  1E9M A;  2OHF A;  2JVC A;  1V97 A;  3APF A;  3RNF C;  2KC1 A;  4I6N B;  1V9J A;  4KDL B;  2C7N B;  1YQ3 B;  2WQY B;  1EUV B;  3AEB B;  4C7Z A;  1KM7 A;  3AB5 A;  3NOB A;  2M0A A;  1DYQ A;  3C19 A;  2XK5 B;  3E56 A;  1UWX A;  2QCZ A;  1GT8 A;  3Q14 C;  2N9P C;  3GS2 A;  4NQK E;  4KGT A;  2E6X A;  2KTR B;  3AED B;  2DAJ A;  1FCC C;  2LRU A;  3A9J B;  1N5X A;  2LXA A;  4LDT D;  1T0Y A;  2KWU B;  1HE8 A;  4IW0 A;  2DZK A;  4RGM A;  4LNI A;  5KHO A;  2QIE B;  4YXD B;  5BMG A; 
#chains in the Genus database with same CATH homology
 3W5V B;  1Y56 A;  1SB3 C;  4DXF A;  4A90 A;  2J42 A;  1IUE A;  1TZO A;  2WNM A;  1PGB A;  4IDI A;  2WXG A;  3SEB A;  1JWM D;  1WXQ A;  1QOA A;  4NAW B;  3AE3 B;  4RGT A;  3BII D;  4H2A A;  3I9V 1;  3W9C B;  1HEZ E;  1EU3 A;  2JWU A;  1TS4 A;  1V1O A;  4CQN A;  2WXO A;  3ETR A;  4KX6 B;  2LEK A;  3MJ5 A;  2XN9 C;  2CJO A;  1KF6 B;  1SBB B;  1TY0 A;  4XE0 A;  2PIA A;  4RGO S;  1DOI A;  1CQV A;  1J7A A;  2QIL A;  4RNA A;  1AN8 A;  3AE4 B;  2QMT A;  2J52 A;  1TS2 A;  1SE4 A;  3P63 A;  3AEA B;  4HKZ E;  3VR9 B;  4ZRQ A;  2PMV A;  3NVV A;  3H8H A;  5EE0 A;  1P7E A;  4XWW A;  1C76 A;  3Q69 A;  3TUO A;  2INN E;  1R7S A;  1T5X D;  2N9K A;  3ZYY X;  2BBC A;  1HXY D;  2JQR B;  4LTU A;  2LJI A;  4C80 A;  1TS5 A;  2V0G A;  5D7G A;  1D5Z C;  1GB1 A;  1YJJ A;  2ZW0 A;  5BYR A;  1OQR A;  1GB4 A;  1N60 A;  1I4Q A;  3TSS A;  4WUR A;  2PW9 A;  1VZ8 A;  1FIQ A;  4LLG M;  2WU2 B;  5G5G A;  2VZK D;  1JW9 D;  2KN4 A;  1YN3 A;  2DLB A;  3BVG A;  1ET6 A;  4LK0 M;  2WDR B;  2DYM A;  1MHH E;  5E6J A;  1C79 A;  1WGK A;  3P4S B;  3MP9 A;  1RWS A;  2CJN A;  5LNK 1;  2JYE A;  3RPF C;  2KDM A;  5H8Y E;  1V8C A;  1VJK A;  4US8 A;  2WXJ A;  1L4Z B;  1JQ4 A;  5FK9 C;  1GAQ B;  3AH7 A;  1FRR A;  1E0Z A;  3AEF B;  2WXN A;  1PUT A;  2IGG A;  2LMC A;  4HKQ A;  1L0Y B;  4WIP A;  1DOX A;  3U7Z A;  2MJ3 A;  4ZHO A;  1VDV A;  1MI0 A;  1KLU D;  4EE2 A;  1FNV A;  3EUB 2;  2ICI A;  3R8B A;  1ROE A;  4MH8 A;  3BWU D;  4XWT A;  4AQ7 A;  2WXM A;  1JWA D;  2ZW1 A;  1EWY C;  3C8Y A;  1GOZ A;  1H7W A;  1TKE A;  2WP9 B;  3U4E G;  1MPE A;  3AV8 A;  2X38 A;  2AQ2 B;  3CF4 A;  3AM9 A;  4C7Y A;  2K22 A;  4RGN A;  3TEX A;  3AE7 B;  1YN5 A;  4GDL B;  1GPX A;  1JWB D;  3URY A;  4DXG A;  2LGI A;  3AE9 B;  1VLB A;  3Q8E A;  1C9F A;  1CZP A;  1AYF A;  1I4G A;  3LYY A;  5AUI A;  1VRA B;  1E10 A;  1NYR A;  1K51 A;  4TSS A;  1T6B X;  5T8I A;  2V3N A;  3RFZ B;  2D5G A;  4HJG E;  2BB5 A;  4XDD A;  4USA A;  5BYS A;  4RFB A;  4YTP B;  2N9L A;  2RMM A;  1BUI C;  1SE2 A;  1ZXH A;  4GDK B;  4XDC A;  1SEB D;  3ZJV A;  3WCQ A;  4ARI A;  3B2F A;  3BVM A;  2BW2 A;  1F77 A;  3OWE B;  4UDU C;  3R2T A;  3GB1 A;  5EE1 A;  1HZ5 A;  3BK2 A;  1ZUD 2;  3B9J A;  2WXK A;  4A8X C;  1FFU A;  1RYJ A;  1QKZ A;  3SR6 A;  1FNU A;  1FM0 D;  4OZC A;  2B76 B;  4YSY B;  1HQR D;  2DWQ A;  1SJE D;  5C2T B;  1T3Q A;  2G1E A;  2ACZ B;  1BML C;  3IT4 B;  3MFG A;  2WXI A;  4D2K A;  1L4D B;  1QOB A;  1UGJ A;  1E7P B;  4TMA B;  4OVZ A;  3VRB B;  2KAC A;  4YSX B;  1N5W A;  5EE9 A;  1FO4 A;  3V3X A;  2KWD A;  2MEK A;  3E9S A;  1NI3 A;  2PVG C;  5HG2 A;  1XCT L;  3LXF A;  2WXQ A;  4R3D A;  2ONQ A;  1L0V B;  3O13 A;  3VR8 B;  2JZP A;  1N61 A;  1XXG A;  3EA6 A;  4RF0 A;  5D3D A;  1WYG A;  4C56 C;  2H88 B;  3DWG C;  4OHJ A;  1VZ7 A;  5BYQ A;  3VRA B;  1XEE A;  2WU5 B;  4JWU C;  1ENF A;  3T3N A;  1YNT E;  1QQR A;  3SFD B;  1N63 A;  2BYT A;  3PZ8 A;  4HRO A;  1D4B A;  3NVW A;  1KTK A;  1ZDV A;  5D3I B;  4ITK A;  1D5X C;  1YN4 A;  1B9R A;  1IBX B;  4M0W A;  4HRS A;  2LHD A;  2W54 A;  1P7F A;  1C78 A;  1F0Z A;  3P4P B;  4WQM A;  4ZHP A;  4B0E A;  1OQQ A;  2TSS A;  2L1A A;  1ZXI A;  1FXI A;  4JWS C;  4P6V F;  5HHD G;  4J3O D;  1CJE A;  1EWC A;  1ZE3 D;  2HTM E;  4MT5 A;  2BT6 A;  2SAK A;  1M4V A;  3NZ3 A;  2ON8 A;  1SSN A;  1LO5 D;  2FE8 A;  2DYO A;  1J7B A;  3W5U B;  5FR3 A;  5MPO A;  2W3S A;  2KQ4 X;  3W2D A;  2MJE A;  1I4H A;  3MHZ A;  4ARC A;  4WWM A;  2WXF A;  4JPS A;  3AEG B;  3L4P A;  1SE3 A;  3ZJU A;  2FUG 1;  3MC0 B;  1CK1 A;  2QEJ C;  2WXR A;  2I38 A;  2L83 A;  3KWL A;  3LB8 C;  1HZ6 A;  2KMM A;  4Q2J A;  3GP7 A;  3KQ4 A;  2BS3 B;  4PT5 A;  1PDX A;  2WS3 B;  1DOY A;  1TJE A;  1C77 A;  1MVK A;  2JYT A;  1FD6 A;  1PGX A;  3AN1 A;  1RFK A;  3AMZ A;  1H7X A;  3FIL B;  2J4X A;  1QIL A;  1D6E C;  4YSZ B;  2W3R A;  3NVY A;  4N58 A;  3Q8B A;  2IGD A;  1DGJ A;  1KRH A;  1TKY A;  2J53 A;  2JSV X;  1FMA D;  5JXV A;  3ZGZ A;  2Y5C A;  2BB6 A;  2MJD A;  1IBX A;  1NEK B;  1XLP A;  2BTE A;  1XLO A;  1A70 A;  4OW0 A;  3W1S A;  3HUI A;  2GB1 A;  4KKJ A;  1F2R C;  4NZL B;  1I4X A;  5EE3 A;  3Q8F A;  3I57 A;  3J9C A;  1FRD A;  3ZQ4 A;  1L6U A;  3Q8C A;  2AQ3 B;  1OFF A;  1PGA A;  4OZA A;  3VQI A;  2WDV B;  3AEE B;  1XCQ L;  2SEB D;  1QLB B;  4N6E B;  2G9H D;  1XLN A;  1FCL A;  1ZDX A;  3HRD D;  1VR9 A;  3P42 A;  1TS3 A;  1V1P B;  1NVI D;  2Y3A A;  1QF6 A;  2DBY A;  3IAM 1;  4WH4 A;  2EKI A;  4B0M A;  2K0P A;  3P4Q B;  4HEA 1;  1JRO A;  2LUM A;  2H89 B;  1TY2 A;  5TSS A;  2HDE A;  1FNW A;  3AE1 B;  2LHE A;  5GXG B;  2FBW B;  2WLB A;  2PVO D;  4L2Y A;  4OZB A;  2E3T A;  3AE2 B;  1ZPS A;  1VZ6 A;  2GI9 A;  4NJC A;  4NAM A;  3FIL A;  1KH0 A;  3IT6 B;  2OED A;  2K3U A;  1SJH D;  5H92 C;  2PLP A;  5HI1 A;  4MM3 B;  3CIR B;  3BVZ A;  1Q10 A;  2L32 A;  2V3P A;  3R2I A;  1ZOY B;  2LFI A;  2W82 A;  3TEZ A;  1N62 A;  1QT9 A;  3AE8 B;  2IDY A;  2IGH A;  1JML A;  1WWT A;  1SF0 A;  1PFD A;  2YEP B;  4FXC A;  1ACC A;  2INP E;  3SFE B;  1WRI A;  1L5P A;  4KGS A;  2CU3 A;  4A6Q A;  2KAJ A;  1I4R A;  2YEP F;  1AWD A;  2BS4 B;  1TYG B;  1K50 A;  4A9A A;  1MHX A;  3TEW A;  4N59 A;  2L52 A;  1GTH A;  4YTM B;  4ZRP A;  1V1P A;  1SIJ A;  2JXT A;  1PYW D;  1JWS D;  2N7J A;  1K53 A;  3BYY B;  2AX5 A;  1E6E B;  1KLG D;  2XNA C;  3NUH B;  3PO0 A;  1XF5 L;  4L23 A;  5FKA C;  3V05 A;  3PZ7 A;  4ZOH C;  3ZJT A;  1SXT A;  1F2R I;  4L1B A;  1K52 A;  4KKI A;  4KGR A;  2VZK B;  5C3J B;  4YT0 B;  2PKO A;  1ET9 A;  1JRP A;  4P16 A;  2MH7 A;  1AW7 A;  3AE6 B;  4O1N A;  4WAF A;  1XO3 A;  1D5M C;  4GLS C;  4TQ1 A;  3T3O A;  4DQO C;  2Y5P A;  3Q8A A;  3AEC B;  1QOF A;  4IKG A;  1EM7 A;  4MAC A;  4RCO A;  1UWM A;  2RDG A;  2K5P A;  3FC4 A;  3EGR A;  3BYT B;  3BZD B;  3P1M A;  3UI3 A;  4RH6 A;  1UUP A;  3DWM A;  4A55 A;  3KLS X;  3U52 E;  1JCK B;  3NRZ A;  1YJI A;  1FEH A;  4US9 A;  3P4R B;  2RPV A;  2WXH A;  3ABV B;  2M56 B;  5I4D A;  2Q5W D;  3TEY A;  1C4C A;  1QOG A;  2W55 A;  4JX1 C;  5BMI A;  2K9X A;  3N9Y C;  4AS1 A;  1YMH E;  2GRI A;  5G5H A;  1I4P A;  4ZYS A;  4RF1 A;  1RM6 C;  3FAH A;  1GTE A;  4REZ A;  4TQ0 A;  1KFY B;  2N0S B;  3CWI A;  1EU4 A;  1E9M A;  2OHF A;  1V97 A;  1J7C A;  1FFV A;  2IJ0 A;  1WSP A;  2WXP A;  3HVZ A;  1IGD A;  2NTS A;  1C4A A;  3U2S C;  1ZP0 B;  1YQ3 B;  2WQY B;  3IAS 1;  4YWG G;  3B2G A;  2JX5 A;  1ESF A;  3AEB B;  2EEL A;  4C7Z A;  1L6V A;  3AE5 B;  3AB5 A;  1UNS A;  2V4I B;  2M0A A;  4JE3 B;  4YTN B;  2IPK D;  2RDH A;  3NVZ A;  1JAL A;  1C4P A;  1DYQ A;  1TKG A;  1IGC A;  1YQ4 B;  2WDQ B;  3NS1 A;  3E56 A;  1UWX A;  3HVD A;  3KWV A;  1L0X B;  1GT8 A;  2NTT A;  1JWU D;  1NEN B;  2AQ1 B;  1I7H A;  2I2Y A;  3GS2 A;  2JU6 X;  2Z8L A;  2NMQ A;  2QSD A;  4IOI E;  4KGT A;  3BK1 A;  3IXS A;  5HFY A;  2BS2 B;  2E6X A;  1NYQ A;  3AED B;  5AUK A;  1XLQ A;  1FCC C;  2QJL A;  1N5X A;  2WXL A;  2PTL A;  2M19 A;  5BMH A;  1BXT A;  2R61 A;  1FXA A;  1HA5 A;  4RGM A;  2QIE B;  1B1Z A;  4YXD B;  5BMG A;  1STE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...