2ACZB

Complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/electron transport
molecule keywords Succinate dehydrogenase flavoprotein subunit
total genus 58
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2aczB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aczB01
1JQ4A 4YTNB 1WXQA 3P4SB 1L0VB 1FRDA 1JRPA 1WGKA 3FAHA 3LB8C 3AE8B 1DOXA 4C7ZA 4JWSC 1DGJA 1SB3C 1EWYC 1JALA 1TJEA 2BT6A 3AB5A 1ZUD2 5MPOA 1PFDA 1VDVA 1N5WA 3AE9B 3AE2B 1E9MA 1L5PA 2BS3B 2PIAA 4JX1C 1NVID 1NYRA 1QT9A 4P6VF 2HTME 1TYGB 3AEAB 3AE6B 1QOBA 4ZOHC 3NS1A 5EE1A 2L83A 1R7SA 1L6VA 5G5HA 4ZHOA 1AYFA 2M56B 1H7WA 2ACZB 3AE7B 1YJJA 3NVWA 3AEFB 1FFVA 4US9A 3SR6A 1KRHA 3AE5B 1XLNA 1FRRA 2FBWB 2KAJA 3AE4B 1GTEA 2BS4B 1FIQA 1IUEA 1ZXIA 1SIJA 4IDIA 5EE3A 1A70A 1PUTA 1V8CA 5H8YE 1OQQA 2AX5A 3AV8A 3P4QB 1RWSA 3AE1B 3AEBB 4WWMA 1XLOA 1CZPA 3VRBB 2JQRB 3NVZA 3DWMA 3W5VB 2WDVB 4C80A 1JROA 1XLPA 1YJIA 2WDRB 1QOGA 2DBYA 3AMZA 1RYJA 4KX6B 1N61A 2W3RA 4LTUA 1YQ4B 4C7YA 2WP9B 1JW9D 2G1EA 1L6UA 2QJLA 1VLBA 1KF6B 1F0ZA 1XO3A 3W9CB 3NRZA 3B2GA 1NEKB 2LEKA 1J7CA 3B2FA 4N6EB 2WQYB 2M19A 3PO0A 3VRAB 1TKGA 3HUIA 3SFEB 3BIID 3AM9A 1JWBD 4ITKA 1E6EB 1AWDA 5AUIA 3AECB 2E3TA 1ZP0B 1FMAD 1WWTA 2CJNA 1T3QA 5H92C 5C2TB 2Y5CA 4A9AA 1WRIA 4YSXB 2MJEA 1J7BA 2W3SA 1JWAD 1KFYB 3FC4A 1V97A 2MH7A 4YXDB 2MJDA 1N5XA 3AEDB 1CJEA 2PVGC 1FXAA 2W55A 4HROA 1TKYA 2CU3A 1E7PB 1GT8A 1NENB 4YT0B 1FO4A 5C3JB 1N60A 2EKIA 1GAQB 1QLBB 1FFUA 3HRDD 1N63A 3SFDB 2Q5WD 3VR9B 4WQMA 5G5GA 4YSYB 1OFFA 4ZHPA 3P63A 4FXCA 2JX5A 2K22A 3P1MA 5EE0A 4YTMB 4N58A 2PKOA 3KWLA 2DWQA 2MJ3A 1NYQA 2WU2B 2W54A 3CWIA 3AEGB 1ROEA 1TKEA 3ETRA 2QIEB 2K5PA 3B9JA 3NVYA 4JWUC 4N59A 3RPFC 1GTHA 4YSZB 2WS3B 5GXGB 3AH7A 3NVVA 2CJOA 1DOYA 2PVOD 2WLBA 5EE9A 4YTPB 1RM6C 2B76B 1OQRA 1WYGA 2KMMA 3P4RB 1UWMA 3HVZA 2N0SB 3W5UB 3P4PB 2OHFA 1H7XA 3DWGC 2BS2B 1QF6A 3L4PA 2H88B 4US8A 1J7AA 1E10A 1FM0D 2K9XA 1I7HA 1ZOYB 1QOFA 1FXIA 3EUB2 1DOIA 3CF4A 3LXFA 3CIRB 2H89B 1N62A 1PDXA 2L52A 3ABVB 1E0ZA 3AE3B 3AEEB 4USAA 2WU5B 2WDQB 1QOAA 1VJKA 1B9RA 1YQ3B 1XLQA 3ZYYX 1SF0A 1NI3A 1RFKA 3AN1A 4HRSA 5AUKA 1GPXA 3VR8B 3WCQA
chains in the Genus database with same CATH superfamily
1V5OA 2QEJC 3R2TA 3AE8B 4JWSC 4JQWC 2KWVB 2VH1A 4FN2A 5FR6A 1K51A 4OHJA 2L3ZA 2NTSA 3E9SA 4XWWA 3AE6B 2XN9C 5CX3A 1L6VA 2M56B 4G11A 3NVWA 2QMTA 3DHIC 4QAYA 3ZRFA 3W1SA 1C1YB 1FNVA 4NQKE 2AQ1B 1V8CA 2RDGA 5H8YE 3X23A 4ARCA 4HXDA 4NPNA 4WWNA 5HFYA 3ALBA 4LK0M 4ACFA 1RLFA 3I5JC 1R4MB 1R4MI 4A90A 4AS1A 3ZJTA 3LDZE 5LXIB 3S2AA 1YOVB 3MTNB 4JGHB 2V3SA 2EELA 1CQVA 2ZPYA 4BOZB 2E3TA 3T9LA 4MGYE 4E74A 4IWQA 1HA5A 3UQAA 1GJZA 2C5LC 2WXOA 1EU4A 2K8BA 2JYTA 2N7EA 2AEHA 3KW5B 1V81A 2GBMA 2HDEA 4EEWA 5C1ZA 4HVBA 1ZXHA 4FXCA 2JX5A 3KH0A 4DK5A 1NI2A 4JWUC 2QIEB 1LXDA 2CJOA 1UBQA 1JRUA 1OQRA 3VUWA 3DWGC 3MFGA 3OWEB 3B1LX 3N9YC 3UGBB 1FCLA 3CF4A 2O2VA 4BFRA 1N6ZA 4G3XB 3ECIA 4K7SA 2WDQB 3VTUA 3ZIMA 1SF0A 3CSFA 3H9DA 3TEWA 1DYQA 2LGYA 1T0RC 4TMAB 1DOXA 1N5WA 2WXKA 5BYSA 1SIFA 4FADA 2PPHA 1UBIA 3QX1A 1V1PA 1FFVA 4JPSA 4S17A 1AARA 3RFZB 3L16A 3SDLC 2WXLA 4DHZB 3KQ4A 1OQQA 2AX5A 3AV8A 3Q8AA 3BZDB 1RWSA 3AE1B 3PSEB 1CZPA 3V62A 1JCKB 2M0AA 1YJIA 1PGXA 1QOGA 3PRZA 1P0RA 1N61A 3RNEC 5DCNA 3RNBC 1D6EC 1T0QC 2WQYB 3B2FA 4EKUA 3Q8CA 4M01A 2IO1B 2V3NA 5C2TB 3UIPB 3Q69A 3J9CA 1UELA 3ZNID 2KTRB 4S0RA 4GLSC 2KANA 3R8BA 3ML8A 1GT8A 3H7SA 2VH2A 3T3NA 2BGFA 2KWDA 3AULA 2LJ5A 3UF8A 3ZVVA 3ZDTA 3A9JB 1ZKHA 4ANVA 2JXTA 4W9JA 2CHWA 3R7RA 2N9LA 4W9CA 1GTHA 4YSZB 3RMKC 2WLBA 4MGIE 4URKA 2PMVA 4AOFA 2ONQA 2G9HD 3EFUA 4GDKA 3N3KB 2K9XA 2KLCA 2MHJA 2BTEA 1VD2A 2DZJA 4GOCA 1N62A 3DHGC 3ABVB 2K1FA 1WZ3A 2WU5B 1UH6A 1TTNA 3B0AA 2DAJA 2CR5A 4MACA 2QILA 2KTFA 4OVUA 4B9KA 2JRHA 3IT6B 1NVID 4TQ1A 4RF1A 1EM7A 2QCZA 3AE7B 1UZXB 1YJ1A 2IO0B 4J3OD 2J0MA 1FIQA 2LFIA 1V49A 2IBIB 4LDTD 2UYZB 2WXIA 3A1QB 1ZPSA 1YD8U 4W9IA 1ENFA 1RYJA 2WWZA 1WMHA 4M00A 4W9FA 2M1MA 4GGQA 1NEKB 5DPRA 3CSTA 4ITKA 4F7ZA 3GB1A 3HVDA 1F2RC 2N7JA 4DXFA 1YN4A 2FCSA 2WXGA 2I2YA 2Y5CA 1PGBA 1WGHA 2KHWB 1R4NB 3DBHB 4HDQA 1ISNA 1HZ6A 4MH0E 2DZMA 3U8ZA 2XBBC 1GB4A 3QA8A 3P63A 1WF9A 2GLSA 2W82A 2DWQA 3U7DA 1YIWA 2W54A 4TV3A 1TKEA 1WZ0A 3B9JA 3NVYA 3QQ8B 3U52E 2AQ2B 5GXGB 1ZE3D 2ZJDA 5EE9A 2KC1A 3QWZB 1RM6C 1TBEA 3GE8C 3PZ8A 3P4RB 2LXAA 5LNK1 1I4PA 4KSLC 2MP2B 1HQRD 1OQYA 4HKQA 2H88B 2JWZA 2N7DA 4M8NA 3T3OA 1P7EA 2L52A 3ZTCA 1E90A 4B95A 1B9RA 2L0FA 3WA0A 5AUKA 3N32A 4HLEA 1FEHA 1L0VB 3C0RB 4ZRPA 5BMGA 1L4DB 1E5WA 3HM6X 2KKCA 2K25A 1GNUA 1PFDA 3AE9B 3LYYA 2IZVB 5EE1A 2D3GA 3KLSX 4GMVA 5E6PA 1EF1A 3W5UB 4K3BA 3ZRCA 4EUTA 1D3ZA 3AE5B 3MJWA 4MM3B 3BYYB 2JY6A 1WJUA 2J42A 4LNIA 3FKYA 3PZ7A 2JT4B 1F52A 4IM3A 3AXCA 2G1EA 2SEBD 2X38A 3DBRI 3AECB 3ZXVA 4FHJA 2MBEA 3DQVA 4KGTA 1VCBA 4FULA 2W55A 2CU3A 4FJYA 3ZNZB 3Q3MC 1QLBB 4RGOS 3UIOB 3ZNHB 1TS5A 3ZDMC 1PQSA 4ZHPA 4RGMA 5JHAA 4HK2A 2XNAC 2HJ8A 2N1VA 3E56A 2LUEA 1P9DU 2HTHA 4YTPB 1XF5L 2AL3A 1E8XA 2LD9A 1H7XA 1TS4A 1SBBB 3T8MA 2BW2A 1HE8A 1FNUA 3MC8A 3ZJUA 2RPQA 3L08A 4ZRIA 3A33B 4LJOB 1KOTA 2BQQA 1TZ1A 4L2YA 1SE3A 2NTTA 1K8RB 4NZLB 4MELA 3UINB 1EO6A 3HHMA 4C7ZA 4XDCA 1J0GA 2MLBA 2NS5A 3AEAB 2L83A 4LJPB 2LRWA 2ACZB 2CU1A 3IT4B 3H7PB 2N9PC 2KWCA 3TIXA 1VRAB 3BK1A 4IDIA 1A70A 4II3B 4K81A 4L1BA 4A20A 4AWJA 3NVZA 1V80A 3PLVA 3PS6A 1C9FA 3H1UA 4KDLB 1YQ4B 2WXJA 4FJZA 5J18A 4C4VA 3ZGZA 4KDIC 2J0KA 1FXTB 1WX7A 2PLPA 4A55A 4ICVA 3VRAB 1UNSA 1V5TA 2BYVE 1E6EB 2KFJA 1HZ5A 3TSSA 1KLUD 2NBUA 2WNMA 1V97A 1LFDA 2MJDA 4RNAA 3C19A 1Z2MA 2SAKA 4XE0A 3VTWA 1WJ6A 2Z59B 3KWLA 3W1SC 3M3JA 4PT5A 3N1ZC 3RZFA 1WE7A 1ROEA 2K5PA 5BMHA 1ZW7A 3ZO5B 2Y5PA 4BZAA 1JWSD 3DVNU 1TS3A 2JZZA 4IKGA 3KVFB 5HHDG 3N30A 1UUPA 2R2QA 1FM0D 3LJ3A 2JWUA 5D94A 5HG2A 4OW0A 1K50A 2EMSA 2PE9A 2DLBA 3LB8C 3P4SB 1SE2A 1FRDA 2KJ6A 3PGEA 3A1QA 3DVGX 2WX1A 3CF6E 3AE2B 1KLGD 1MG8A 2HTME 1MJDA 4KKJA 3VUXA 1KRHA 3MP9A 2FBWB 4LLGM 4LDTB 3VH3B 1C4PA 4GXBA 2ZZPB 4RF0A 1L7YA 1GG3A 4WURA 3W5VB 3AMZA 1LQBA 3Q3JA 1KF6B 2D3BA 1UGMA 1XXGA 3NY5A 2DHZA 4MDKE 3C8YA 3I57A 1S1QB 2INCC 3APCA 3RULA 4A9AA 1I4QA 4RM8A 2MH7A 2KOXA 4BOSC 5LXHA 3TMPB 3DOWA 3IAM1 4AUQC 3GZNB 1J8CA 4JLCA 1Q0WB 4YSYB 3BVMA 5T8IA 4YTMB 3O13A 4N58A 4EZLA 3RYTA 5IOIA 4DQOC 2FCQA 2I1JA 3ETRA 2KN5A 2WS3B 3BVGA 2KZRA 4DBGA 2GB1A 2BB6A 2KYWA 3BYTB 1E8ZA 1M94A 2LGIA 4MGZE 2BWES 1VR9A 1WXVA 3M62B 1ET9A 1UWXA 4A3OA 2MWSB 5G2NA 2BB5A 2K0PA 1MPEA 4B0MA 1SE9A 2KX3A 3WAOA 1NYRA 2UU7A 2WYQA 4HDOA 1QOBA 3ZJVA 2DYMA 3V6CB 2J0JA 1OEYA 1QKZA 3SU8X 4ZHOA 3DBSA 1F1HA 1R4NI 4KGSA 4A6QA 3R66C 3Q8EA 5DPWA 4AJYB 2KN4A 3H7PA 2IDYA 2KQSA 2FCMA 1Y8RC 1OGWA 1C78A 1VZ8A 1XLPA 2WDRB 3BVZA 2LHDA 4C7YA 3D32A 1VLBA 2DAFA 1Y56A 1C4CA 5J2RA 3EECA 5H92C 3VH4B 3Q3NC 3FC4A 4KZCA 2NPTA 3UQBA 1CJEA 4IW0A 2PEAA 2BYFA 4RGNA 3NZ3A 5C3JB 4GSWA 5CHVC 1GAQB 3FILA 4TSSA 3U7ZA 3NHEB 4WQMA 2RDBC 1EUVB 1QZEA 4HPMB 3TUOA 4RH6A 4RGTA 2L8JA 4RM9A 5EE0A 2PKOA 4KSKC 3ZLZA 2N9EB 4XWTA 5BO4B 3AH7A 3TBLD 2JZPA 5JHBA 1IGDA 4C4VB 2B76B 1YQBA 4NAMA 3N1YC 2YEPF 5CHWA 1ZOYB 2KJHB 2LUMA 5AZGA 3LXFA 3CIRB 2H89B 3A9KA 3HIZA 4GU2A 4USAA 1P7FA 1VJKA 5BYQA 2KLGA 2HD5B 1PGAA 3ZYYX 4PYZA 4EZJA 2K39A 2QC8A 1WXQA 2ZEQA 1SB3C 2BT6A 3AB5A 3PLUA 2DX5B 1E9MA 2FAZA 1MG4A 2NPTB 1TYGB 3JW0X 2MP2A 4G0NB 2G4DB 2GOWA 3DCGA 3I9V1 1WJ4A 1SJHD 1WM3A 3IG3A 1PUTA 3I63C 2INPE 5EDSA 2WDVB 2WXFA 4C80A 3OG5A 2DBYA 3EGRA 3VTVA 2W3RA 2WP9B 2QJLA 2EMTA 2CKHB 4AJWA 1M4VA 3VVWB 3BY4B 2C60A 2IGHA 1B1ZA 1WI0A 2ZCCA 4L23A 4BVUC 2KACA 3HM3A 4YSXB 1WRIA 2R61A 4BBNF 1I35A 3AU5A 2PVGC 3Q8BA 2Z8LA 4HROA 1WGYA 2KFKB 2N9XA 2LMCA 1NENB 2E6XA 2W9NA 1FFUA 2ON8A 4HPLB 5E6JA 2PJHA 4EE2A 1Q1OA 3CMMB 1WYWB 3TEXA 2KD0A 1NYQA 3GZNI 4PYUA 5CHFA 2Y3AA 2QDFA 2RD0A 2KFKA 2WXHA 1KTKA 1STEA 3P4PB 1T0YA 1AN8A 4NNJB 4A3PA 1YNTE 4WWPA 3L4PA 4HJKA 3SD5A 1E10A 1UD7A 1I7HA 2LGSA 2KMCA 2L32A 1XCQL 4M0WB 4D2KA 1TGZB 4II2B 2FIDA 2PTLA 1P1AA 3EC8A 2N4FA 1YQ3B 2A5UA 3JYUA 2MBOA 5AEKB 2MW5A 4K3CA 1ACCA 4ARIA 1JQ4A 1WGKA 2D11A 1QQRA 4O1NA 3B08A 3GOEA 3QAQA 2DZKA 4ANXA 3R7QA 1L0YB 2RGFA 4LCDE 3MC0B 1H7WA 4BBNC 1OEYJ 4OZCA 4TQ0A 2JU6X 2KT7A 3DBLB 2BS4B 5EE3A 1NBFC 5JXVA 1SJED 4GDLB 1F2RI 1V1OA 3QC8B 3V3XA 4W9DA 3VHTC 1NDDA 5D3IB 2GBJA 3WANA 1F0ZA 1G6JA 4N6EB 3MHSD 2BVCA 3A9KB 4ZRKA 3NS8A 4HJGE 1WWTA 4XGAB 4XDDA 1IBXA 1JWAD 4FHKA 2KDEB 3TEYA 4K1RB 4I6PA 4YT0B 1FO4A 2EKIA 4FA6A 1JWUD 1TS2A 1WM2A 3VR9B 4MJSA 2D3AA 5D7GA 1WXAA 1T0SC 5IAAC 5J17A 4GN1A 1CK1A 2OJRA 3GE3C 5L95C 4XZ4A 4W9GA 4BKSA 3RZWC 1C4AA 3IAS1 2QHOA 1WH3A 3PPAA 1KJTA 4KGRA 2C7NB 1L2NA 2DENB 2AWTA 2LXCA 4W9HA 4FLHA 1YMHE 4KIKB 3VR8B 1TY2A 2NR2A 3PHWB 4MSQB 3UI3A 1XD3B 2O6VD 1FCCC 3IFWB 3V6EB 3W2DA 1WY8A 4P6VF 4ZYNA 5LLIA 4G50A 2WXMA 1XEEA 1FRRA 2UWQA 4IC7B 1VZ7A 1IUEA 1ZXIA 1SIJA 2MEKA 1HXYD 4KZ0A 1P3QU 3RT3B 2IGGA 4DXAB 3KYCD 4GIVA 3NRZA 1SEBD 3PO0A 3L0WB 3IVFA 5JZEB 2V9HA 5AUIA 3V05A 2GMIC 1EF5A 2O6VA 2O6VB 2R2OA 2MJEA 2LVOA 1WXMA 4HCPB 3WIMA 3RCZA 1PYWD 2YVCA 4MJSB 2NVUI 4WJOA 5C23A 3EFCA 3FILB 4RMAA 2MX2A 3HRDD 4WQOB 2EKEC 3BINA 4NQLB 1C79A 2LZ6A 4P1CC 2KDFB 3RNFC 2FNJB 1MHHE 3AEGB 2KQ4X 4NJ6A 4WWOA 2JVCA 2KJRA 3P42A 2RPVA 2X8XX 4ANWA 1IYFA 1D4BA 3M63B 1YX6B 1ZGUB 1Z5SB 3IXSA 2LHEA 4OVVA 1TT5B 1QOFA 3VXWA 3IBEA 1PDXA 1WR6E 2C7MB 2KQ7A 4P7IA 4E71A 1JMLA 2KO3A 5TR5A 1ESFA 4HRSA 1RFKA 3AN1A 5G55A 3NZUA 3ZTDA 3WCQA 1HEZE 3QJZA 5TSSA 1WMHB 5JH5C 4JX1C 1L5PA 1QT9A 2GBRA 1GC7A 2V1YA 3TCAA 4LNNA 3DBHI 1MI0A 4GDLA 2KAJA 3AE4B 4HEA1 2Z0EB 3QCAA 4YL8A 3VQIA 2FUHB 2KXJA 4M0WA 3APFA 3R3MA 4E3CA 2LGDA 3URYA 4XX5A 2KC2A 4LTUA 1YN5A 2PW9A 2MQJA 2JUOA 1XO3A 2DYBA 3Q14C 1D5XC 5HKHA 1H8CA 1F9JA 2MBQA 3BIID 3AM9A 1AWDA 2N1WA 4DHZE 1V6EA 4ICUA 2IGDA 5FKAC 4W9EA 3AEDB 3L54A 2KNBA 1BXTA 1UGJA 5D3DA 3DHHC 1E7PB 3I3TB 4TKNA 1I4HA 4WJPA 2LVQA 2L76A 4M02A 4ASWC 1N63A 4R3DA 1GC6A 4LNOA 2G45B 3P1MA 1F77A 2GBNA 2HE7A 5E6NA 2WU2B 3PV1A 3DVNV 2KDIA 4FJVB 3RPFC 1L0XB 2XEWA 3MJ5A 2ICIA 2IPKD 4JL9A 1J19A 1XQQA 2D10A 3DPDA 1CMXB 5IA7A 3RD2A 4PS7A 4F1SA 3TL5A 2Y5BB 5BMIA 2LGXA 3VUYA 1D5ZC 1NI3A 2M4NA 3TEZA 3ZUNA 4M8MA 4P16A 2NMQA 4H2AA 2DZIA 4EZKA 1LM8B 1WX8A 2D2QA 1XCTL 2PIAA 4IOIE 2LJIA 3RNGC 1HTOA 3Q3OC 4DHJD 4RCOA 2D3CA 4UDUC 1R7SA 1I42A 1YJJA 3K9PB 4NAWA 2FUG1 2IYDB 2KK8A 2MCNB 3ZNGC 1SGHA 2K8HA 3RN9C 2ZNVC 1QILA 2M0XA 4WWMA 1XLOA 3P2BA 2JRIB 1KM7A 2RDHA 2L00B 3DWMA 1BT0A 4HPPA 1Q5WB 2WDTB 1Q10A 2BPSA 3W9CB 3B2GA 4NAWB 1WGDA 2GRIA 1JWBD 1MFWA 1V86A 1C77A 3PTFC 3NOBA 2CS4A 2LWPA 1VZ6A 1WR1A 1EWCA 4YXDB 1OTRB 3GP7A 1WGGA 1TKYA 2K6QA 1WJNA 4KV2A 2XK5A 2ZW0A 5IO9A 2ZVOA 1XT9B 2ZW1A 3Q8FA 4BKSD 4JIOU 1P98A 4MT5A 2YLMA 4IG7B 3KUZA 2INNE 2REXA 2N9KA 1WX9A 2K6DB 3NVVA 1DOYA 2PVOD 4WIPA 4CQNA 1WYGA 2KMMA 3DVGY 1UWMA 2KX0A 2OHFA 2BS2B 1T5XD 1J7AA 2MA9B 2IY0B 3SEBA 2PE6B 3ZW3A 4BKGA 1GPXA 1JRPA 1X1MA 3PRPB 4K7WA 3WALA 2HJ1A 3L10B 3NS1A 1GOZA 3R2IA 2ZPNA 2NCNA 1BMLC 1E7UA 3RNCC 3AEFB 2ZCBA 1V2YA 1XLNA 5AZFA 2J4XA 4WJNA 4BKTA 3PHXB 1SXTA 1T6BX 4Q2JA 2V3PA 4I6LB 2L1AA 1SSNA 4HKZE 5KHQA 4DWFA 1I4GA 4DHJB 5D6JB 1JW9D 3WAPA 3ML9A 2LEKA 3HUIA 4RFBA 2LASA 1ZP0B 2CJNA 3DBLI 5DPTA 2D5GA 3DDCB 2V4IB 2W3SA 4LNFA 2C9WB 1WFYA 1KH0A 5IKCM 2BBCA 2JXXA 1OFFA 1RAXA 2ZNVB 2B3AA 1IGCA 3U2SC 4BAXA 2C7HA 4TUUA 2DYOA 1IPGA 1KLVA 2JZ3B 2KMAA 5E6OA 1RFAA 1C3TA 3HVZA 2KTRA 5CTRC 2IO2B 4PS3A 2M8SA 4FBJB 1V1PB 2OOBB 1FXIA 4J6IA 1TIFA 4B6WA 5GMVA 4C00A 1E0ZA 2K8CA 2WX0A 1QOAA 4GDKB 1XLQA 4LNKA 3N20C 4A8XC 2KWUB 4YTNB 3FAHA 1H4RA 4I6NB 2AQ3B 4IWOA 2L05A 1TJEA 4NJ7A 2RSUA 3BK2A 1GB1A 1VDVA 4KVGB 4K7UA 4ZOHC 4OZAA 4JE3B 1BUIC 2O2VB 5G5HA 3O65B 3L17A 4US9A 4CHKA 4MSMB 1YN3A 3PZDA 1GTEA 3ZKJC 2AL6A 2BF8B 3ZQ4A 3X0WA 3P4QB 3ZXRA 3DBRB 1E7VA 2L7RA 1U4AA 3RI7C 4W9LA 1MHXA 2G4SA 3A4SC 2KDMA 3A9JA 3JSVA 2JYEA 3N1XC 4DDGD 3VAWA 1J7CA 3SFEB 4PS8A 4ZYSA 2FIFA 4C56C 2INDC 2L0TA 1J7BA 1RRBA 2MBBB 1UF0A 3OLMD 2CHXA 1E8WA 3JSVB 5AZHA 1N60A 2Z0DB 2Q5WD 3ENEA 2GBKA 2K22A 1I4XA 4WAFA 2ZVNA 3W1YA 2WXQA 1MVKA 3KWVA 2V4LA 2JSVX 1K53A 2LI5A 1K52A 3SHQA 2OJWA 5BYRA 3KUCB 3A4RA 3AEEB 2BWFA 4REZA 1ET6A 1LGRA 4MEMA 1TZOA 3L13A 1HTQA 5HI1A 2BKRB 1WIAA 3PREA 2G3QB 1S3SG 1DGJA 1JALA 3IHPC 1GUAB 5MPOA 2BS3B 3HK0A 1FNWA 2IJ0A 1AYFA 2I1KA 3SR6A 3V61A 1FPYA 3M95A 2JPHA 3Q3FA 3VRBB 3K9OB 3QK0A 3RUIB 4XC2A 4ANUA 5DPSA 2MBHA 4F8CB 3NJTA 3OJ3A 2V0GA 2ASQA 5FR3A 4HCNB 3JVZX 4P1BC 4OVZA 2VZKD 1I4RA 1FMAD 3APDA 3KYDD 3ONSA 3KUDB 3EHVA 4EOYA 4WH4A 4MGKE 3TJPA 1FXAA 2J52A 1WSPA 1WRDB 5IN7A 4PK1A 4ZRQA 3MC9A 2XK5B 4NY0A 5IP4D 2MRPA 3BWUD 1SE4A 1TY0A 2FCNA 3QARA 3WAMA 5KHOA 2OEDA 1ZDVA 3V60A 2MJ3A 2RR9A 3RNAC 4B0EA 3OAWA 2WXNA 2GI9A 2N0SB 1QF6A 2KVZA 2TSSA 2MSED 3EUB2 3H8HA 2IY1B 3AE3B 3PVLA 1L4ZB 4KKIA 4GB9A 4MH8A 3EA6A 2CHZA 1C76A 4YWGG 4XYCA 1EWYC 1ZUD2 2WHIA 4X57B 4WAAA 2BYTA 4NJCA 2AYOB 2A4ZA 2IO3B 4WJQA 3U30A 2J7QB 3NG0A 2I38A 2DNFA 3PT2B 4MM3A 1EU3A 1LO5D 4HWIB 4AQ7A 3AEBB 3MHZA 2JQRB 1IP9A 2KVRA 4CYEA 1JROA 4IWPA 3VFKA 4KX6B 5I4DA 2BYEA 5D2MB 1L6UA 3H6NA 1WXSA 2YEPB 2D07B 2M19A 3Q2AC 2RMMA 1TKGA 1JWMD 2LVPA 4W9KA 1T3QA 1FD6A 1IBXB 2VZKB 2WXPA 1E8YA 1ZDXA 1KFYB 3AI5A 1WE6A 1N5XA 3PRMB 2J53A 1D5MC 1WGRA 4N9F4 1V9JA 1YX5B 2BKFA 3QHTA 3OJ4B 2NBVB 2FE8A 4ZDVA 3Q6BA 2WGSA 3SFDB 5G5GA 4DXGA 2NBWB 2QSDA 3NUHB 2M17A 3GS2A 3CWIA 4N59A 4KIKA 2VRRB 1A5RA 5FK9C 4DDID 3VDZA 2WXRA 4IM2A 4US8A 4IUMB 4OZBA 4EFOA 1DOIA 3AU4A 2KDBA 4IM0A 4CO7A 4ZRJA 5L83A 1AW7A 2JF5A 2LRUA 2K3UA 3NZSA 4AP4C 3QIJA 3U4EG
chains in the Genus database with same CATH topology
4ARIA 1JQ4A 1JRPA 1WGKA 2QEJC 3R2TA 3AE8B 1QQRA 4O1NA 4JWSC 4C7ZA 4XDCA 1K51A 4OHJA 1L0YB 2NTSA 3E9SA 3AEAB 3AE6B 4XWWA 2XN9C 3NS1A 1GOZA 3MC0B 3R2IA 2L83A 1L6VA 1BMLC 2M56B 1H7WA 2ACZB 3IT4B 3NVWA 3AEFB 2QMTA 1XLNA 4OZCA 4TQ0A 1VRAB 2JU6X 2J4XA 2BS4B 3W1SA 5EE3A 3BK1A 4IDIA 1A70A 1FNVA 1SXTA 1T6BX 2AQ1B 1V8CA 2RDGA 2V3PA 4Q2JA 5H8YE 5JXVA 1SJED 4GDLB 1F2RI 1V1OA 4L1BA 4ARCA 2L1AA 1SSNA 3NVZA 4HKZE 3V3XA 1I4GA 5HFYA 4LK0M 1C9FA 1YQ4B 5D3IB 1JW9D 4A90A 4AS1A 2WXJA 1F0ZA 3ZJTA 3ZGZA 2LEKA 4N6EB 4A55A 2PLPA 3VRAB 1UNSA 2EELA 3HUIA 1E6EB 4RFBA 1HZ5A 1CQVA 2E3TA 4HJGE 1ZP0B 1WWTA 2CJNA 3TSSA 2D5GA 4XDDA 1KLUD 1IBXA 2V4IB 2W3SA 1JWAD 2WNMA 1HA5A 1V97A 2MJDA 4RNAA 3TEYA 2SAKA 2WXOA 4YT0B 1EU4A 4XE0A 1FO4A 2JYTA 1KH0A 2EKIA 1JWUD 1TS2A 2BBCA 2HDEA 3VR9B 1OFFA 1ZXHA 5D7GA 4FXCA 2JX5A 1IGCA 3KWLA 4PT5A 3U2SC 1ROEA 4JWUC 1CK1A 2K5PA 2QIEB 5BMHA 2DYOA 2CJOA 2Y5PA 1JWSD 1C4AA 1OQRA 3IAS1 3HVZA 1TS3A 3DWGC 4IKGA 4KGRA 5HHDG 3MFGA 1UUPA 3OWEB 1FM0D 3N9YC 1FCLA 1V1PB 2JWUA 1FXIA 3CF4A 5HG2A 1E0ZA 1YMHE 2WDQB 4OW0A 1QOAA 4GDKB 1K50A 1XLQA 1SF0A 3TEWA 1DYQA 3VR8B 1TY2A 4A8XC 4YTNB 2DLBA 3P4SB 1SE2A 1FRDA 3FAHA 3LB8C 4TMAB 3UI3A 1DOXA 2AQ3B 1TJEA 3BK2A 1GB1A 1VDVA 1N5WA 3AE2B 2WXKA 5BYSA 1FCCC 1KLGD 3W2DA 4P6VF 2HTME 4ZOHC 4OZAA 4JE3B 1BUIC 4KKJA 5G5HA 2WXMA 4US9A 1V1PA 1FFVA 4JPSA 1KRHA 1XEEA 1FRRA 3MP9A 2FBWB 1YN3A 4LLGM 1GTEA 3RFZB 1VZ7A 1IUEA 1C4PA 1SIJA 1ZXIA 2MEKA 2WXLA 3ZQ4A 3KQ4A 4RF0A 1OQQA 2AX5A 3AV8A 3P4QB 1HXYD 3Q8AA 3BZDB 1RWSA 3AE1B 1CZPA 4WURA 1JCKB 3W5VB 2M0AA 1MHXA 1YJIA 1PGXA 1QOGA 3AMZA 2KDMA 1N61A 2IGGA 2JYEA 1KF6B 3NRZA 1XXGA 1SEBD 1J7CA 1D6EC 3B2FA 2WQYB 3PO0A 3Q8CA 3SFEB 5AUIA 3V05A 3C8YA 3I57A 4ZYSA 2V3NA 4C56C 5C2TB 4A9AA 3Q69A 2MJEA 3J9CA 1J7BA 1I4QA 2MH7A 4GLSC 1PYWD 3IAM1 3R8BA 1GT8A 1N60A 3FILB 3T3NA 2KWDA 3HRDD 2Q5WD 3BVMA 4YSYB 5T8IA 1C79A 2K22A 1I4XA 4YTMB 3O13A 4N58A 2JXTA 4WAFA 4DQOC 1MHHE 3AEGB 3ETRA 2KQ4X 2N9LA 1GTHA 4YSZB 2WS3B 3BVGA 2WLBA 3P42A 2RPVA 2GB1A 2BB6A 2WXQA 2PMVA 1D4BA 2ONQA 2G9HD 1MVKA 3KWVA 3BYTB 2LHEA 3IXSA 2LGIA 2JSVX 1K53A 2K9XA 1K52A 2BTEA 1QOFA 5BYRA 1N62A 1VR9A 1PDXA 3ABVB 3AEEB 2WU5B 1JMLA 4REZA 1ET9A 1ET6A 1ESFA 1TZOA 1UWXA 4HRSA 1RFKA 3AN1A 3WCQA 5HI1A 1HEZE 4MACA 2BB5A 2QILA 5TSSA 2K0PA 1MPEA 1DGJA 4B0MA 1JALA 5MPOA 4JX1C 3IT6B 1L5PA 2BS3B 1NVID 1NYRA 1QT9A 4TQ1A 1FNWA 1QOBA 2IJ0A 3ZJVA 2DYMA 4RF1A 1EM7A 1QKZA 4ZHOA 1AYFA 3AE7B 1MI0A 3SR6A 4J3OD 4KGSA 4A6QA 2KAJA 3AE4B 4HEA1 1FIQA 2LFIA 3Q8EA 2KN4A 2WXIA 2IDYA 1ZPSA 3VQIA 3VRBB 1C78A 4M0WA 1VZ8A 1ENFA 1XLPA 2WDRB 3BVZA 3URYA 1RYJA 2LHDA 4LTUA 1YN5A 2PW9A 4C7YA 1VLBA 1XO3A 2V0GA 1D5XC 1NEKB 5FR3A 4ITKA 1Y56A 3BIID 3AM9A 3GB1A 4OVZA 1AWDA 3HVDA 2VZKD 1C4CA 1F2RC 2N7JA 1I4RA 4DXFA 1FMAD 5H92C 1YN4A 2WXGA 2I2YA 2Y5CA 2IGDA 1PGBA 5FKAC 3FC4A 3AEDB 1CJEA 4WH4A 1BXTA 1FXAA 1UGJA 5D3DA 1E7PB 2J52A 1WSPA 4RGNA 1I4HA 3NZ3A 1HZ6A 4ZRQA 5C3JB 1GAQB 3FILA 4TSSA 1N63A 4R3DA 3U7ZA 4WQMA 1GB4A 3BWUD 1SE4A 1TY0A 3TUOA 3P63A 4RH6A 4RGTA 3P1MA 5EE0A 1F77A 2PKOA 2OEDA 1ZDVA 2DWQA 2MJ3A 2W82A 2WU2B 2W54A 1TKEA 3B9JA 3NVYA 4XWTA 3U52E 3RPFC 2AQ2B 5GXGB 3AH7A 1ZE3D 5EE9A 1L0XB 2JZPA 3MJ5A 1IGDA 4B0EA 2ICIA 1RM6C 2IPKD 2B76B 3PZ8A 3P4RB 2WXNA 5LNK1 1I4PA 2GI9A 2N0SB 1HQRD 4NAMA 4HKQA 1QF6A 2H88B 2TSSA 2YEPF 1ZOYB 2LUMA 3EUB2 3H8HA 3T3OA 3LXFA 3CIRB 2H89B 1P7EA 2L52A 5BMIA 3AE3B 4USAA 1P7FA 1VJKA 1B9RA 5BYQA 1L4ZB 4KKIA 1PGAA 3ZYYX 1D5ZC 1NI3A 5AUKA 3TEZA 4MH8A 4P16A 3EA6A 1FEHA 1C76A 1WXQA 1L0VB 2NMQA 4H2AA 4ZRPA 4YWGG 5BMGA 1L4DB 1SB3C 2BT6A 1EWYC 3AB5A 1ZUD2 1PFDA 3AE9B 1E9MA 1XCTL 2PIAA 3LYYA 4IOIE 2BYTA 4NJCA 5EE1A 1TYGB 2LJIA 3KLSX 4RCOA 4UDUC 1R7SA 3W5UB 1YJJA 3AE5B 2FUG1 3I9V1 1SJHD 2I38A 4MM3B 3BYYB 1EU3A 1PUTA 1LO5D 2J42A 1QILA 4AQ7A 2INPE 3AEBB 3MHZA 1XLOA 4WWMA 2JQRB 2RDHA 3PZ7A 3DWMA 2WDVB 2WXFA 4C80A 1JROA 2DBYA 3EGRA 4KX6B 5I4DA 2W3RA 2WP9B 1Q10A 2G1EA 1L6UA 2QJLA 3W9CB 3B2GA 1M4VA 4NAWB 2SEBD 2YEPB 2M19A 2RMMA 2X38A 2IGHA 1TKGA 1B1ZA 2GRIA 1JWMD 1JWBD 1C77A 3AECB 4L23A 1T3QA 2KACA 1FD6A 1VZ6A 1IBXB 1EWCA 4YSXB 1WRIA 2VZKB 2WXPA 1ZDXA 1KFYB 4KGTA 2R61A 4YXDB 3GP7A 1N5XA 2J53A 2PVGC 3Q8BA 1D5MC 2Z8LA 2W55A 4HROA 1TKYA 2CU3A 2LMCA 1NENB 2E6XA 2FE8A 1QLBB 1FFUA 4RGOS 2ON8A 2ZW0A 1TS5A 3SFDB 5E6JA 2ZW1A 3Q8FA 5G5GA 4DXGA 4EE2A 3TEXA 2QSDA 4ZHPA 3NUHB 4MT5A 4RGMA 2XNAC 1NYQA 3GS2A 3CWIA 2INNE 3E56A 4N59A 2Y3AA 2N9KA 3NVVA 1DOYA 2PVOD 2WXHA 1KTKA 1STEA 4YTPB 4WIPA 1XF5L 4CQNA 1WYGA 2KMMA 5FK9C 1UWMA 3P4PB 2OHFA 1H7XA 1AN8A 2WXRA 1TS4A 2BS2B 1T5XD 1YNTE 3L4PA 1SBBB 4US8A 1J7AA 2BW2A 1E10A 1FNUA 1I7HA 4OZBA 3ZJUA 2L32A 1XCQL 1DOIA 4D2KA 2PTLA 3SEBA 1AW7A 4L2YA 1YQ3B 1SE3A 2NTTA 2K3UA 4NZLB 1GPXA 3U4EG 1ACCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQ4 A;  4YTN B;  1WXQ A;  3P4S B;  1L0V B;  1FRD A;  1JRP A;  1WGK A;  3FAH A;  3LB8 C;  3AE8 B;  1DOX A;  4C7Z A;  4JWS C;  1DGJ A;  1SB3 C;  1EWY C;  1JAL A;  1TJE A;  2BT6 A;  3AB5 A;  1ZUD 2;  5MPO A;  1PFD A;  1VDV A;  1N5W A;  3AE9 B;  3AE2 B;  1E9M A;  1L5P A;  2BS3 B;  2PIA A;  4JX1 C;  1NVI D;  1NYR A;  1QT9 A;  4P6V F;  2HTM E;  1TYG B;  3AEA B;  3AE6 B;  1QOB A;  4ZOH C;  3NS1 A;  5EE1 A;  2L83 A;  1R7S A;  1L6V A;  5G5H A;  4ZHO A;  1AYF A;  2M56 B;  1H7W A;  2ACZ B;  3AE7 B;  1YJJ A;  3NVW A;  3AEF B;  1FFV A;  4US9 A;  3SR6 A;  1KRH A;  3AE5 B;  1XLN A;  1FRR A;  2FBW B;  2KAJ A;  3AE4 B;  1GTE A;  2BS4 B;  1FIQ A;  1IUE A;  1ZXI A;  1SIJ A;  4IDI A;  5EE3 A;  1A70 A;  1PUT A;  1V8C A;  5H8Y E;  1OQQ A;  2AX5 A;  3AV8 A;  3P4Q B;  1RWS A;  3AE1 B;  3AEB B;  4WWM A;  1XLO A;  1CZP A;  3VRB B;  2JQR B;  3NVZ A;  3DWM A;  3W5V B;  2WDV B;  4C80 A;  1JRO A;  1XLP A;  1YJI A;  2WDR B;  1QOG A;  2DBY A;  3AMZ A;  1RYJ A;  4KX6 B;  1N61 A;  2W3R A;  4LTU A;  1YQ4 B;  4C7Y A;  2WP9 B;  1JW9 D;  2G1E A;  1L6U A;  2QJL A;  1VLB A;  1KF6 B;  1F0Z A;  1XO3 A;  3W9C B;  3NRZ A;  3B2G A;  1NEK B;  2LEK A;  1J7C A;  3B2F A;  4N6E B;  2WQY B;  2M19 A;  3PO0 A;  3VRA B;  1TKG A;  3HUI A;  3SFE B;  3BII D;  3AM9 A;  1JWB D;  4ITK A;  1E6E B;  1AWD A;  5AUI A;  3AEC B;  2E3T A;  1ZP0 B;  1FMA D;  1WWT A;  2CJN A;  1T3Q A;  5H92 C;  5C2T B;  2Y5C A;  4A9A A;  1WRI A;  4YSX B;  2MJE A;  1J7B A;  2W3S A;  1JWA D;  1KFY B;  3FC4 A;  1V97 A;  2MH7 A;  4YXD B;  2MJD A;  1N5X A;  3AED B;  1CJE A;  2PVG C;  1FXA A;  2W55 A;  4HRO A;  1TKY A;  2CU3 A;  1E7P B;  1GT8 A;  1NEN B;  4YT0 B;  1FO4 A;  5C3J B;  1N60 A;  2EKI A;  1GAQ B;  1QLB B;  1FFU A;  3HRD D;  1N63 A;  3SFD B;  2Q5W D;  3VR9 B;  4WQM A;  5G5G A;  4YSY B;  1OFF A;  4ZHP A;  3P63 A;  4FXC A;  2JX5 A;  2K22 A;  3P1M A;  5EE0 A;  4YTM B;  4N58 A;  2PKO A;  3KWL A;  2DWQ A;  2MJ3 A;  1NYQ A;  2WU2 B;  2W54 A;  3CWI A;  3AEG B;  1ROE A;  1TKE A;  3ETR A;  2QIE B;  2K5P A;  3B9J A;  3NVY A;  4JWU C;  4N59 A;  3RPF C;  1GTH A;  4YSZ B;  2WS3 B;  5GXG B;  3AH7 A;  3NVV A;  2CJO A;  1DOY A;  2PVO D;  2WLB A;  5EE9 A;  4YTP B;  1RM6 C;  2B76 B;  1OQR A;  1WYG A;  2KMM A;  3P4R B;  1UWM A;  3HVZ A;  2N0S B;  3W5U B;  3P4P B;  2OHF A;  1H7X A;  3DWG C;  2BS2 B;  1QF6 A;  3L4P A;  2H88 B;  4US8 A;  1J7A A;  1E10 A;  1FM0 D;  2K9X A;  1I7H A;  1ZOY B;  1QOF A;  1FXI A;  3EUB 2;  1DOI A;  3CF4 A;  3LXF A;  3CIR B;  2H89 B;  1N62 A;  1PDX A;  2L52 A;  3ABV B;  1E0Z A;  3AE3 B;  3AEE B;  4USA A;  2WU5 B;  2WDQ B;  1QOA A;  1VJK A;  1B9R A;  1YQ3 B;  1XLQ A;  3ZYY X;  1SF0 A;  1NI3 A;  1RFK A;  3AN1 A;  4HRS A;  5AUK A;  1GPX A;  3VR8 B;  3WCQ A; 
#chains in the Genus database with same CATH topology
 1V5O A;  2QEJ C;  3R2T A;  3AE8 B;  4JWS C;  4JQW C;  2KWV B;  2VH1 A;  4FN2 A;  5FR6 A;  1K51 A;  4OHJ A;  2L3Z A;  2NTS A;  3E9S A;  4XWW A;  3AE6 B;  2XN9 C;  5CX3 A;  1L6V A;  2M56 B;  4G11 A;  3NVW A;  2QMT A;  3DHI C;  4QAY A;  3ZRF A;  3W1S A;  1C1Y B;  1FNV A;  4NQK E;  2AQ1 B;  1V8C A;  2RDG A;  5H8Y E;  3X23 A;  4ARC A;  4HXD A;  4NPN A;  4WWN A;  5HFY A;  3ALB A;  4LK0 M;  4ACF A;  1RLF A;  3I5J C;  1R4M B;  1R4M I;  4A90 A;  4AS1 A;  3ZJT A;  3LDZ E;  5LXI B;  3S2A A;  1YOV B;  3MTN B;  4JGH B;  2V3S A;  2EEL A;  1CQV A;  2ZPY A;  4BOZ B;  2E3T A;  3T9L A;  4MGY E;  4E74 A;  4IWQ A;  1HA5 A;  3UQA A;  1GJZ A;  2C5L C;  2WXO A;  1EU4 A;  2K8B A;  2JYT A;  2N7E A;  2AEH A;  3KW5 B;  1V81 A;  2GBM A;  2HDE A;  4EEW A;  5C1Z A;  4HVB A;  1ZXH A;  4FXC A;  2JX5 A;  3KH0 A;  4DK5 A;  1NI2 A;  4JWU C;  2QIE B;  1LXD A;  2CJO A;  1UBQ A;  1JRU A;  1OQR A;  3VUW A;  3DWG C;  3MFG A;  3OWE B;  3B1L X;  3N9Y C;  3UGB B;  1FCL A;  3CF4 A;  2O2V A;  4BFR A;  1N6Z A;  4G3X B;  3ECI A;  4K7S A;  2WDQ B;  3VTU A;  3ZIM A;  1SF0 A;  3CSF A;  3H9D A;  3TEW A;  1DYQ A;  2LGY A;  1T0R C;  4TMA B;  1DOX A;  1N5W A;  2WXK A;  5BYS A;  1SIF A;  4FAD A;  2PPH A;  1UBI A;  3QX1 A;  1V1P A;  1FFV A;  4JPS A;  4S17 A;  1AAR A;  3RFZ B;  3L16 A;  3SDL C;  2WXL A;  4DHZ B;  3KQ4 A;  1OQQ A;  2AX5 A;  3AV8 A;  3Q8A A;  3BZD B;  1RWS A;  3AE1 B;  3PSE B;  1CZP A;  3V62 A;  1JCK B;  2M0A A;  1YJI A;  1PGX A;  1QOG A;  3PRZ A;  1P0R A;  1N61 A;  3RNE C;  5DCN A;  3RNB C;  1D6E C;  1T0Q C;  2WQY B;  3B2F A;  4EKU A;  3Q8C A;  4M01 A;  2IO1 B;  2V3N A;  5C2T B;  3UIP B;  3Q69 A;  3J9C A;  1UEL A;  3ZNI D;  2KTR B;  4S0R A;  4GLS C;  2KAN A;  3R8B A;  3ML8 A;  1GT8 A;  3H7S A;  2VH2 A;  3T3N A;  2BGF A;  2KWD A;  3AUL A;  2LJ5 A;  3UF8 A;  3ZVV A;  3ZDT A;  3A9J B;  1ZKH A;  4ANV A;  2JXT A;  4W9J A;  2CHW A;  3R7R A;  2N9L A;  4W9C A;  1GTH A;  4YSZ B;  3RMK C;  2WLB A;  4MGI E;  4URK A;  2PMV A;  4AOF A;  2ONQ A;  2G9H D;  3EFU A;  4GDK A;  3N3K B;  2K9X A;  2KLC A;  2MHJ A;  2BTE A;  1VD2 A;  2DZJ A;  4GOC A;  1N62 A;  3DHG C;  3ABV B;  2K1F A;  1WZ3 A;  2WU5 B;  1UH6 A;  1TTN A;  3B0A A;  2DAJ A;  2CR5 A;  4MAC A;  2QIL A;  2KTF A;  4OVU A;  4B9K A;  2JRH A;  3IT6 B;  1NVI D;  4TQ1 A;  4RF1 A;  1EM7 A;  2QCZ A;  3AE7 B;  1UZX B;  1YJ1 A;  2IO0 B;  4J3O D;  2J0M A;  1FIQ A;  2LFI A;  1V49 A;  2IBI B;  4LDT D;  2UYZ B;  2WXI A;  3A1Q B;  1ZPS A;  1YD8 U;  4W9I A;  1ENF A;  1RYJ A;  2WWZ A;  1WMH A;  4M00 A;  4W9F A;  2M1M A;  4GGQ A;  1NEK B;  5DPR A;  3CST A;  4ITK A;  4F7Z A;  3GB1 A;  3HVD A;  1F2R C;  2N7J A;  4DXF A;  1YN4 A;  2FCS A;  2WXG A;  2I2Y A;  2Y5C A;  1PGB A;  1WGH A;  2KHW B;  1R4N B;  3DBH B;  4HDQ A;  1ISN A;  1HZ6 A;  4MH0 E;  2DZM A;  3U8Z A;  2XBB C;  1GB4 A;  3QA8 A;  3P63 A;  1WF9 A;  2GLS A;  2W82 A;  2DWQ A;  3U7D A;  1YIW A;  2W54 A;  4TV3 A;  1TKE A;  1WZ0 A;  3B9J A;  3NVY A;  3QQ8 B;  3U52 E;  2AQ2 B;  5GXG B;  1ZE3 D;  2ZJD A;  5EE9 A;  2KC1 A;  3QWZ B;  1RM6 C;  1TBE A;  3GE8 C;  3PZ8 A;  3P4R B;  2LXA A;  5LNK 1;  1I4P A;  4KSL C;  2MP2 B;  1HQR D;  1OQY A;  4HKQ A;  2H88 B;  2JWZ A;  2N7D A;  4M8N A;  3T3O A;  1P7E A;  2L52 A;  3ZTC A;  1E90 A;  4B95 A;  1B9R A;  2L0F A;  3WA0 A;  5AUK A;  3N32 A;  4HLE A;  1FEH A;  1L0V B;  3C0R B;  4ZRP A;  5BMG A;  1L4D B;  1E5W A;  3HM6 X;  2KKC A;  2K25 A;  1GNU A;  1PFD A;  3AE9 B;  3LYY A;  2IZV B;  5EE1 A;  2D3G A;  3KLS X;  4GMV A;  5E6P A;  1EF1 A;  3W5U B;  4K3B A;  3ZRC A;  4EUT A;  1D3Z A;  3AE5 B;  3MJW A;  4MM3 B;  3BYY B;  2JY6 A;  1WJU A;  2J42 A;  4LNI A;  3FKY A;  3PZ7 A;  2JT4 B;  1F52 A;  4IM3 A;  3AXC A;  2G1E A;  2SEB D;  2X38 A;  3DBR I;  3AEC B;  3ZXV A;  4FHJ A;  2MBE A;  3DQV A;  4KGT A;  1VCB A;  4FUL A;  2W55 A;  2CU3 A;  4FJY A;  3ZNZ B;  3Q3M C;  1QLB B;  4RGO S;  3UIO B;  3ZNH B;  1TS5 A;  3ZDM C;  1PQS A;  4ZHP A;  4RGM A;  5JHA A;  4HK2 A;  2XNA C;  2HJ8 A;  2N1V A;  3E56 A;  2LUE A;  1P9D U;  2HTH A;  4YTP B;  1XF5 L;  2AL3 A;  1E8X A;  2LD9 A;  1H7X A;  1TS4 A;  1SBB B;  3T8M A;  2BW2 A;  1HE8 A;  1FNU A;  3MC8 A;  3ZJU A;  2RPQ A;  3L08 A;  4ZRI A;  3A33 B;  4LJO B;  1KOT A;  2BQQ A;  1TZ1 A;  4L2Y A;  1SE3 A;  2NTT A;  1K8R B;  4NZL B;  4MEL A;  3UIN B;  1EO6 A;  3HHM A;  4C7Z A;  4XDC A;  1J0G A;  2MLB A;  2NS5 A;  3AEA B;  2L83 A;  4LJP B;  2LRW A;  2ACZ B;  2CU1 A;  3IT4 B;  3H7P B;  2N9P C;  2KWC A;  3TIX A;  1VRA B;  3BK1 A;  4IDI A;  1A70 A;  4II3 B;  4K81 A;  4L1B A;  4A20 A;  4AWJ A;  3NVZ A;  1V80 A;  3PLV A;  3PS6 A;  1C9F A;  3H1U A;  4KDL B;  1YQ4 B;  2WXJ A;  4FJZ A;  5J18 A;  4C4V A;  3ZGZ A;  4KDI C;  2J0K A;  1FXT B;  1WX7 A;  2PLP A;  4A55 A;  4ICV A;  3VRA B;  1UNS A;  1V5T A;  2BYV E;  1E6E B;  2KFJ A;  1HZ5 A;  3TSS A;  1KLU D;  2NBU A;  2WNM A;  1V97 A;  1LFD A;  2MJD A;  4RNA A;  3C19 A;  1Z2M A;  2SAK A;  4XE0 A;  3VTW A;  1WJ6 A;  2Z59 B;  3KWL A;  3W1S C;  3M3J A;  4PT5 A;  3N1Z C;  3RZF A;  1WE7 A;  1ROE A;  2K5P A;  5BMH A;  1ZW7 A;  3ZO5 B;  2Y5P A;  4BZA A;  1JWS D;  3DVN U;  1TS3 A;  2JZZ A;  4IKG A;  3KVF B;  5HHD G;  3N30 A;  1UUP A;  2R2Q A;  1FM0 D;  3LJ3 A;  2JWU A;  5D94 A;  5HG2 A;  4OW0 A;  1K50 A;  2EMS A;  2PE9 A;  2DLB A;  3LB8 C;  3P4S B;  1SE2 A;  1FRD A;  2KJ6 A;  3PGE A;  3A1Q A;  3DVG X;  2WX1 A;  3CF6 E;  3AE2 B;  1KLG D;  1MG8 A;  2HTM E;  1MJD A;  4KKJ A;  3VUX A;  1KRH A;  3MP9 A;  2FBW B;  4LLG M;  4LDT B;  3VH3 B;  1C4P A;  4GXB A;  2ZZP B;  4RF0 A;  1L7Y A;  1GG3 A;  4WUR A;  3W5V B;  3AMZ A;  1LQB A;  3Q3J A;  1KF6 B;  2D3B A;  1UGM A;  1XXG A;  3NY5 A;  2DHZ A;  4MDK E;  3C8Y A;  3I57 A;  1S1Q B;  2INC C;  3APC A;  3RUL A;  4A9A A;  1I4Q A;  4RM8 A;  2MH7 A;  2KOX A;  4BOS C;  5LXH A;  3TMP B;  3DOW A;  3IAM 1;  4AUQ C;  3GZN B;  1J8C A;  4JLC A;  1Q0W B;  4YSY B;  3BVM A;  5T8I A;  4YTM B;  3O13 A;  4N58 A;  4EZL A;  3RYT A;  5IOI A;  4DQO C;  2FCQ A;  2I1J A;  3ETR A;  2KN5 A;  2WS3 B;  3BVG A;  2KZR A;  4DBG A;  2GB1 A;  2BB6 A;  2KYW A;  3BYT B;  1E8Z A;  1M94 A;  2LGI A;  4MGZ E;  2BWE S;  1VR9 A;  1WXV A;  3M62 B;  1ET9 A;  1UWX A;  4A3O A;  2MWS B;  5G2N A;  2BB5 A;  2K0P A;  1MPE A;  4B0M A;  1SE9 A;  2KX3 A;  3WAO A;  1NYR A;  2UU7 A;  2WYQ A;  4HDO A;  1QOB A;  3ZJV A;  2DYM A;  3V6C B;  2J0J A;  1OEY A;  1QKZ A;  3SU8 X;  4ZHO A;  3DBS A;  1F1H A;  1R4N I;  4KGS A;  4A6Q A;  3R66 C;  3Q8E A;  5DPW A;  4AJY B;  2KN4 A;  3H7P A;  2IDY A;  2KQS A;  2FCM A;  1Y8R C;  1OGW A;  1C78 A;  1VZ8 A;  1XLP A;  2WDR B;  3BVZ A;  2LHD A;  4C7Y A;  3D32 A;  1VLB A;  2DAF A;  1Y56 A;  1C4C A;  5J2R A;  3EEC A;  5H92 C;  3VH4 B;  3Q3N C;  3FC4 A;  4KZC A;  2NPT A;  3UQB A;  1CJE A;  4IW0 A;  2PEA A;  2BYF A;  4RGN A;  3NZ3 A;  5C3J B;  4GSW A;  5CHV C;  1GAQ B;  3FIL A;  4TSS A;  3U7Z A;  3NHE B;  4WQM A;  2RDB C;  1EUV B;  1QZE A;  4HPM B;  3TUO A;  4RH6 A;  4RGT A;  2L8J A;  4RM9 A;  5EE0 A;  2PKO A;  4KSK C;  3ZLZ A;  2N9E B;  4XWT A;  5BO4 B;  3AH7 A;  3TBL D;  2JZP A;  5JHB A;  1IGD A;  4C4V B;  2B76 B;  1YQB A;  4NAM A;  3N1Y C;  2YEP F;  5CHW A;  1ZOY B;  2KJH B;  2LUM A;  5AZG A;  3LXF A;  3CIR B;  2H89 B;  3A9K A;  3HIZ A;  4GU2 A;  4USA A;  1P7F A;  1VJK A;  5BYQ A;  2KLG A;  2HD5 B;  1PGA A;  3ZYY X;  4PYZ A;  4EZJ A;  2K39 A;  2QC8 A;  1WXQ A;  2ZEQ A;  1SB3 C;  2BT6 A;  3AB5 A;  3PLU A;  2DX5 B;  1E9M A;  2FAZ A;  1MG4 A;  2NPT B;  1TYG B;  3JW0 X;  2MP2 A;  4G0N B;  2G4D B;  2GOW A;  3DCG A;  3I9V 1;  1WJ4 A;  1SJH D;  1WM3 A;  3IG3 A;  1PUT A;  3I63 C;  2INP E;  5EDS A;  2WDV B;  2WXF A;  4C80 A;  3OG5 A;  2DBY A;  3EGR A;  3VTV A;  2W3R A;  2WP9 B;  2QJL A;  2EMT A;  2CKH B;  4AJW A;  1M4V A;  3VVW B;  3BY4 B;  2C60 A;  2IGH A;  1B1Z A;  1WI0 A;  2ZCC A;  4L23 A;  4BVU C;  2KAC A;  3HM3 A;  4YSX B;  1WRI A;  2R61 A;  4BBN F;  1I35 A;  3AU5 A;  2PVG C;  3Q8B A;  2Z8L A;  4HRO A;  1WGY A;  2KFK B;  2N9X A;  2LMC A;  1NEN B;  2E6X A;  2W9N A;  1FFU A;  2ON8 A;  4HPL B;  5E6J A;  2PJH A;  4EE2 A;  1Q1O A;  3CMM B;  1WYW B;  3TEX A;  2KD0 A;  1NYQ A;  3GZN I;  4PYU A;  5CHF A;  2Y3A A;  2QDF A;  2RD0 A;  2KFK A;  2WXH A;  1KTK A;  1STE A;  3P4P B;  1T0Y A;  1AN8 A;  4NNJ B;  4A3P A;  1YNT E;  4WWP A;  3L4P A;  4HJK A;  3SD5 A;  1E10 A;  1UD7 A;  1I7H A;  2LGS A;  2KMC A;  2L32 A;  1XCQ L;  4M0W B;  4D2K A;  1TGZ B;  4II2 B;  2FID A;  2PTL A;  1P1A A;  3EC8 A;  2N4F A;  1YQ3 B;  2A5U A;  3JYU A;  2MBO A;  5AEK B;  2MW5 A;  4K3C A;  1ACC A;  4ARI A;  1JQ4 A;  1WGK A;  2D11 A;  1QQR A;  4O1N A;  3B08 A;  3GOE A;  3QAQ A;  2DZK A;  4ANX A;  3R7Q A;  1L0Y B;  2RGF A;  4LCD E;  3MC0 B;  1H7W A;  4BBN C;  1OEY J;  4OZC A;  4TQ0 A;  2JU6 X;  2KT7 A;  3DBL B;  2BS4 B;  5EE3 A;  1NBF C;  5JXV A;  1SJE D;  4GDL B;  1F2R I;  1V1O A;  3QC8 B;  3V3X A;  4W9D A;  3VHT C;  1NDD A;  5D3I B;  2GBJ A;  3WAN A;  1F0Z A;  1G6J A;  4N6E B;  3MHS D;  2BVC A;  3A9K B;  4ZRK A;  3NS8 A;  4HJG E;  1WWT A;  4XGA B;  4XDD A;  1IBX A;  1JWA D;  4FHK A;  2KDE B;  3TEY A;  4K1R B;  4I6P A;  4YT0 B;  1FO4 A;  2EKI A;  4FA6 A;  1JWU D;  1TS2 A;  1WM2 A;  3VR9 B;  4MJS A;  2D3A A;  5D7G A;  1WXA A;  1T0S C;  5IAA C;  5J17 A;  4GN1 A;  1CK1 A;  2OJR A;  3GE3 C;  5L95 C;  4XZ4 A;  4W9G A;  4BKS A;  3RZW C;  1C4A A;  3IAS 1;  2QHO A;  1WH3 A;  3PPA A;  1KJT A;  4KGR A;  2C7N B;  1L2N A;  2DEN B;  2AWT A;  2LXC A;  4W9H A;  4FLH A;  1YMH E;  4KIK B;  3VR8 B;  1TY2 A;  2NR2 A;  3PHW B;  4MSQ B;  3UI3 A;  1XD3 B;  2O6V D;  1FCC C;  3IFW B;  3V6E B;  3W2D A;  1WY8 A;  4P6V F;  4ZYN A;  5LLI A;  4G50 A;  2WXM A;  1XEE A;  1FRR A;  2UWQ A;  4IC7 B;  1VZ7 A;  1IUE A;  1ZXI A;  1SIJ A;  2MEK A;  1HXY D;  4KZ0 A;  1P3Q U;  3RT3 B;  2IGG A;  4DXA B;  3KYC D;  4GIV A;  3NRZ A;  1SEB D;  3PO0 A;  3L0W B;  3IVF A;  5JZE B;  2V9H A;  5AUI A;  3V05 A;  2GMI C;  1EF5 A;  2O6V A;  2O6V B;  2R2O A;  2MJE A;  2LVO A;  1WXM A;  4HCP B;  3WIM A;  3RCZ A;  1PYW D;  2YVC A;  4MJS B;  2NVU I;  4WJO A;  5C23 A;  3EFC A;  3FIL B;  4RMA A;  2MX2 A;  3HRD D;  4WQO B;  2EKE C;  3BIN A;  4NQL B;  1C79 A;  2LZ6 A;  4P1C C;  2KDF B;  3RNF C;  2FNJ B;  1MHH E;  3AEG B;  2KQ4 X;  4NJ6 A;  4WWO A;  2JVC A;  2KJR A;  3P42 A;  2RPV A;  2X8X X;  4ANW A;  1IYF A;  1D4B A;  3M63 B;  1YX6 B;  1ZGU B;  1Z5S B;  3IXS A;  2LHE A;  4OVV A;  1TT5 B;  1QOF A;  3VXW A;  3IBE A;  1PDX A;  1WR6 E;  2C7M B;  2KQ7 A;  4P7I A;  4E71 A;  1JML A;  2KO3 A;  5TR5 A;  1ESF A;  4HRS A;  1RFK A;  3AN1 A;  5G55 A;  3NZU A;  3ZTD A;  3WCQ A;  1HEZ E;  3QJZ A;  5TSS A;  1WMH B;  5JH5 C;  4JX1 C;  1L5P A;  1QT9 A;  2GBR A;  1GC7 A;  2V1Y A;  3TCA A;  4LNN A;  3DBH I;  1MI0 A;  4GDL A;  2KAJ A;  3AE4 B;  4HEA 1;  2Z0E B;  3QCA A;  4YL8 A;  3VQI A;  2FUH B;  2KXJ A;  4M0W A;  3APF A;  3R3M A;  4E3C A;  2LGD A;  3URY A;  4XX5 A;  2KC2 A;  4LTU A;  1YN5 A;  2PW9 A;  2MQJ A;  2JUO A;  1XO3 A;  2DYB A;  3Q14 C;  1D5X C;  5HKH A;  1H8C A;  1F9J A;  2MBQ A;  3BII D;  3AM9 A;  1AWD A;  2N1W A;  4DHZ E;  1V6E A;  4ICU A;  2IGD A;  5FKA C;  4W9E A;  3AED B;  3L54 A;  2KNB A;  1BXT A;  1UGJ A;  5D3D A;  3DHH C;  1E7P B;  3I3T B;  4TKN A;  1I4H A;  4WJP A;  2LVQ A;  2L76 A;  4M02 A;  4ASW C;  1N63 A;  4R3D A;  1GC6 A;  4LNO A;  2G45 B;  3P1M A;  1F77 A;  2GBN A;  2HE7 A;  5E6N A;  2WU2 B;  3PV1 A;  3DVN V;  2KDI A;  4FJV B;  3RPF C;  1L0X B;  2XEW A;  3MJ5 A;  2ICI A;  2IPK D;  4JL9 A;  1J19 A;  1XQQ A;  2D10 A;  3DPD A;  1CMX B;  5IA7 A;  3RD2 A;  4PS7 A;  4F1S A;  3TL5 A;  2Y5B B;  5BMI A;  2LGX A;  3VUY A;  1D5Z C;  1NI3 A;  2M4N A;  3TEZ A;  3ZUN A;  4M8M A;  4P16 A;  2NMQ A;  4H2A A;  2DZI A;  4EZK A;  1LM8 B;  1WX8 A;  2D2Q A;  1XCT L;  2PIA A;  4IOI E;  2LJI A;  3RNG C;  1HTO A;  3Q3O C;  4DHJ D;  4RCO A;  2D3C A;  4UDU C;  1R7S A;  1I42 A;  1YJJ A;  3K9P B;  4NAW A;  2FUG 1;  2IYD B;  2KK8 A;  2MCN B;  3ZNG C;  1SGH A;  2K8H A;  3RN9 C;  2ZNV C;  1QIL A;  2M0X A;  4WWM A;  1XLO A;  3P2B A;  2JRI B;  1KM7 A;  2RDH A;  2L00 B;  3DWM A;  1BT0 A;  4HPP A;  1Q5W B;  2WDT B;  1Q10 A;  2BPS A;  3W9C B;  3B2G A;  4NAW B;  1WGD A;  2GRI A;  1JWB D;  1MFW A;  1V86 A;  1C77 A;  3PTF C;  3NOB A;  2CS4 A;  2LWP A;  1VZ6 A;  1WR1 A;  1EWC A;  4YXD B;  1OTR B;  3GP7 A;  1WGG A;  1TKY A;  2K6Q A;  1WJN A;  4KV2 A;  2XK5 A;  2ZW0 A;  5IO9 A;  2ZVO A;  1XT9 B;  2ZW1 A;  3Q8F A;  4BKS D;  4JIO U;  1P98 A;  4MT5 A;  2YLM A;  4IG7 B;  3KUZ A;  2INN E;  2REX A;  2N9K A;  1WX9 A;  2K6D B;  3NVV A;  1DOY A;  2PVO D;  4WIP A;  4CQN A;  1WYG A;  2KMM A;  3DVG Y;  1UWM A;  2KX0 A;  2OHF A;  2BS2 B;  1T5X D;  1J7A A;  2MA9 B;  2IY0 B;  3SEB A;  2PE6 B;  3ZW3 A;  4BKG A;  1GPX A;  1JRP A;  1X1M A;  3PRP B;  4K7W A;  3WAL A;  2HJ1 A;  3L10 B;  3NS1 A;  1GOZ A;  3R2I A;  2ZPN A;  2NCN A;  1BML C;  1E7U A;  3RNC C;  3AEF B;  2ZCB A;  1V2Y A;  1XLN A;  5AZF A;  2J4X A;  4WJN A;  4BKT A;  3PHX B;  1SXT A;  1T6B X;  4Q2J A;  2V3P A;  4I6L B;  2L1A A;  1SSN A;  4HKZ E;  5KHQ A;  4DWF A;  1I4G A;  4DHJ B;  5D6J B;  1JW9 D;  3WAP A;  3ML9 A;  2LEK A;  3HUI A;  4RFB A;  2LAS A;  1ZP0 B;  2CJN A;  3DBL I;  5DPT A;  2D5G A;  3DDC B;  2V4I B;  2W3S A;  4LNF A;  2C9W B;  1WFY A;  1KH0 A;  5IKC M;  2BBC A;  2JXX A;  1OFF A;  1RAX A;  2ZNV B;  2B3A A;  1IGC A;  3U2S C;  4BAX A;  2C7H A;  4TUU A;  2DYO A;  1IPG A;  1KLV A;  2JZ3 B;  2KMA A;  5E6O A;  1RFA A;  1C3T A;  3HVZ A;  2KTR A;  5CTR C;  2IO2 B;  4PS3 A;  2M8S A;  4FBJ B;  1V1P B;  2OOB B;  1FXI A;  4J6I A;  1TIF A;  4B6W A;  5GMV A;  4C00 A;  1E0Z A;  2K8C A;  2WX0 A;  1QOA A;  4GDK B;  1XLQ A;  4LNK A;  3N20 C;  4A8X C;  2KWU B;  4YTN B;  3FAH A;  1H4R A;  4I6N B;  2AQ3 B;  4IWO A;  2L05 A;  1TJE A;  4NJ7 A;  2RSU A;  3BK2 A;  1GB1 A;  1VDV A;  4KVG B;  4K7U A;  4ZOH C;  4OZA A;  4JE3 B;  1BUI C;  2O2V B;  5G5H A;  3O65 B;  3L17 A;  4US9 A;  4CHK A;  4MSM B;  1YN3 A;  3PZD A;  1GTE A;  3ZKJ C;  2AL6 A;  2BF8 B;  3ZQ4 A;  3X0W A;  3P4Q B;  3ZXR A;  3DBR B;  1E7V A;  2L7R A;  1U4A A;  3RI7 C;  4W9L A;  1MHX A;  2G4S A;  3A4S C;  2KDM A;  3A9J A;  3JSV A;  2JYE A;  3N1X C;  4DDG D;  3VAW A;  1J7C A;  3SFE B;  4PS8 A;  4ZYS A;  2FIF A;  4C56 C;  2IND C;  2L0T A;  1J7B A;  1RRB A;  2MBB B;  1UF0 A;  3OLM D;  2CHX A;  1E8W A;  3JSV B;  5AZH A;  1N60 A;  2Z0D B;  2Q5W D;  3ENE A;  2GBK A;  2K22 A;  1I4X A;  4WAF A;  2ZVN A;  3W1Y A;  2WXQ A;  1MVK A;  3KWV A;  2V4L A;  2JSV X;  1K53 A;  2LI5 A;  1K52 A;  3SHQ A;  2OJW A;  5BYR A;  3KUC B;  3A4R A;  3AEE B;  2BWF A;  4REZ A;  1ET6 A;  1LGR A;  4MEM A;  1TZO A;  3L13 A;  1HTQ A;  5HI1 A;  2BKR B;  1WIA A;  3PRE A;  2G3Q B;  1S3S G;  1DGJ A;  1JAL A;  3IHP C;  1GUA B;  5MPO A;  2BS3 B;  3HK0 A;  1FNW A;  2IJ0 A;  1AYF A;  2I1K A;  3SR6 A;  3V61 A;  1FPY A;  3M95 A;  2JPH A;  3Q3F A;  3VRB B;  3K9O B;  3QK0 A;  3RUI B;  4XC2 A;  4ANU A;  5DPS A;  2MBH A;  4F8C B;  3NJT A;  3OJ3 A;  2V0G A;  2ASQ A;  5FR3 A;  4HCN B;  3JVZ X;  4P1B C;  4OVZ A;  2VZK D;  1I4R A;  1FMA D;  3APD A;  3KYD D;  3ONS A;  3KUD B;  3EHV A;  4EOY A;  4WH4 A;  4MGK E;  3TJP A;  1FXA A;  2J52 A;  1WSP A;  1WRD B;  5IN7 A;  4PK1 A;  4ZRQ A;  3MC9 A;  2XK5 B;  4NY0 A;  5IP4 D;  2MRP A;  3BWU D;  1SE4 A;  1TY0 A;  2FCN A;  3QAR A;  3WAM A;  5KHO A;  2OED A;  1ZDV A;  3V60 A;  2MJ3 A;  2RR9 A;  3RNA C;  4B0E A;  3OAW A;  2WXN A;  2GI9 A;  2N0S B;  1QF6 A;  2KVZ A;  2TSS A;  2MSE D;  3EUB 2;  3H8H A;  2IY1 B;  3AE3 B;  3PVL A;  1L4Z B;  4KKI A;  4GB9 A;  4MH8 A;  3EA6 A;  2CHZ A;  1C76 A;  4YWG G;  4XYC A;  1EWY C;  1ZUD 2;  2WHI A;  4X57 B;  4WAA A;  2BYT A;  4NJC A;  2AYO B;  2A4Z A;  2IO3 B;  4WJQ A;  3U30 A;  2J7Q B;  3NG0 A;  2I38 A;  2DNF A;  3PT2 B;  4MM3 A;  1EU3 A;  1LO5 D;  4HWI B;  4AQ7 A;  3AEB B;  3MHZ A;  2JQR B;  1IP9 A;  2KVR A;  4CYE A;  1JRO A;  4IWP A;  3VFK A;  4KX6 B;  5I4D A;  2BYE A;  5D2M B;  1L6U A;  3H6N A;  1WXS A;  2YEP B;  2D07 B;  2M19 A;  3Q2A C;  2RMM A;  1TKG A;  1JWM D;  2LVP A;  4W9K A;  1T3Q A;  1FD6 A;  1IBX B;  2VZK B;  2WXP A;  1E8Y A;  1ZDX A;  1KFY B;  3AI5 A;  1WE6 A;  1N5X A;  3PRM B;  2J53 A;  1D5M C;  1WGR A;  4N9F 4;  1V9J A;  1YX5 B;  2BKF A;  3QHT A;  3OJ4 B;  2NBV B;  2FE8 A;  4ZDV A;  3Q6B A;  2WGS A;  3SFD B;  5G5G A;  4DXG A;  2NBW B;  2QSD A;  3NUH B;  2M17 A;  3GS2 A;  3CWI A;  4N59 A;  4KIK A;  2VRR B;  1A5R A;  5FK9 C;  4DDI D;  3VDZ A;  2WXR A;  4IM2 A;  4US8 A;  4IUM B;  4OZB A;  4EFO A;  1DOI A;  3AU4 A;  2KDB A;  4IM0 A;  4CO7 A;  4ZRJ A;  5L83 A;  1AW7 A;  2JF5 A;  2LRU A;  2K3U A;  3NZS A;  4AP4 C;  3QIJ A;  3U4E G; 
#chains in the Genus database with same CATH homology
 4ARI A;  1JQ4 A;  1JRP A;  1WGK A;  2QEJ C;  3R2T A;  3AE8 B;  1QQR A;  4O1N A;  4JWS C;  4C7Z A;  4XDC A;  1K51 A;  4OHJ A;  1L0Y B;  2NTS A;  3E9S A;  3AEA B;  3AE6 B;  4XWW A;  2XN9 C;  3NS1 A;  1GOZ A;  3MC0 B;  3R2I A;  2L83 A;  1L6V A;  1BML C;  2M56 B;  1H7W A;  2ACZ B;  3IT4 B;  3NVW A;  3AEF B;  2QMT A;  1XLN A;  4OZC A;  4TQ0 A;  1VRA B;  2JU6 X;  2J4X A;  2BS4 B;  3W1S A;  5EE3 A;  3BK1 A;  4IDI A;  1A70 A;  1FNV A;  1SXT A;  1T6B X;  2AQ1 B;  1V8C A;  2RDG A;  2V3P A;  4Q2J A;  5H8Y E;  5JXV A;  1SJE D;  4GDL B;  1F2R I;  1V1O A;  4L1B A;  4ARC A;  2L1A A;  1SSN A;  3NVZ A;  4HKZ E;  3V3X A;  1I4G A;  5HFY A;  4LK0 M;  1C9F A;  1YQ4 B;  5D3I B;  1JW9 D;  4A90 A;  4AS1 A;  2WXJ A;  1F0Z A;  3ZJT A;  3ZGZ A;  2LEK A;  4N6E B;  4A55 A;  2PLP A;  3VRA B;  1UNS A;  2EEL A;  3HUI A;  1E6E B;  4RFB A;  1HZ5 A;  1CQV A;  2E3T A;  4HJG E;  1ZP0 B;  1WWT A;  2CJN A;  3TSS A;  2D5G A;  4XDD A;  1KLU D;  1IBX A;  2V4I B;  2W3S A;  1JWA D;  2WNM A;  1HA5 A;  1V97 A;  2MJD A;  4RNA A;  3TEY A;  2SAK A;  2WXO A;  4YT0 B;  1EU4 A;  4XE0 A;  1FO4 A;  2JYT A;  1KH0 A;  2EKI A;  1JWU D;  1TS2 A;  2BBC A;  2HDE A;  3VR9 B;  1OFF A;  1ZXH A;  5D7G A;  4FXC A;  2JX5 A;  1IGC A;  3KWL A;  4PT5 A;  3U2S C;  1ROE A;  4JWU C;  1CK1 A;  2K5P A;  2QIE B;  5BMH A;  2DYO A;  2CJO A;  2Y5P A;  1JWS D;  1C4A A;  1OQR A;  3IAS 1;  3HVZ A;  1TS3 A;  3DWG C;  4IKG A;  4KGR A;  5HHD G;  3MFG A;  1UUP A;  3OWE B;  1FM0 D;  3N9Y C;  1FCL A;  1V1P B;  2JWU A;  1FXI A;  3CF4 A;  5HG2 A;  1E0Z A;  1YMH E;  2WDQ B;  4OW0 A;  1QOA A;  4GDK B;  1K50 A;  1XLQ A;  1SF0 A;  3TEW A;  1DYQ A;  3VR8 B;  1TY2 A;  4A8X C;  4YTN B;  2DLB A;  3P4S B;  1SE2 A;  1FRD A;  3FAH A;  3LB8 C;  4TMA B;  3UI3 A;  1DOX A;  2AQ3 B;  1TJE A;  3BK2 A;  1GB1 A;  1VDV A;  1N5W A;  3AE2 B;  2WXK A;  5BYS A;  1FCC C;  1KLG D;  3W2D A;  4P6V F;  2HTM E;  4ZOH C;  4OZA A;  4JE3 B;  1BUI C;  4KKJ A;  5G5H A;  2WXM A;  4US9 A;  1V1P A;  1FFV A;  4JPS A;  1KRH A;  1XEE A;  1FRR A;  3MP9 A;  2FBW B;  1YN3 A;  4LLG M;  1GTE A;  3RFZ B;  1VZ7 A;  1IUE A;  1C4P A;  1SIJ A;  1ZXI A;  2MEK A;  2WXL A;  3ZQ4 A;  3KQ4 A;  4RF0 A;  1OQQ A;  2AX5 A;  3AV8 A;  3P4Q B;  1HXY D;  3Q8A A;  3BZD B;  1RWS A;  3AE1 B;  1CZP A;  4WUR A;  1JCK B;  3W5V B;  2M0A A;  1MHX A;  1YJI A;  1PGX A;  1QOG A;  3AMZ A;  2KDM A;  1N61 A;  2IGG A;  2JYE A;  1KF6 B;  3NRZ A;  1XXG A;  1SEB D;  1J7C A;  1D6E C;  3B2F A;  2WQY B;  3PO0 A;  3Q8C A;  3SFE B;  5AUI A;  3V05 A;  3C8Y A;  3I57 A;  4ZYS A;  2V3N A;  4C56 C;  5C2T B;  4A9A A;  3Q69 A;  2MJE A;  3J9C A;  1J7B A;  1I4Q A;  2MH7 A;  4GLS C;  1PYW D;  3IAM 1;  3R8B A;  1GT8 A;  1N60 A;  3FIL B;  3T3N A;  2KWD A;  3HRD D;  2Q5W D;  3BVM A;  4YSY B;  5T8I A;  1C79 A;  2K22 A;  1I4X A;  4YTM B;  3O13 A;  4N58 A;  2JXT A;  4WAF A;  4DQO C;  1MHH E;  3AEG B;  3ETR A;  2KQ4 X;  2N9L A;  1GTH A;  4YSZ B;  2WS3 B;  3BVG A;  2WLB A;  3P42 A;  2RPV A;  2GB1 A;  2BB6 A;  2WXQ A;  2PMV A;  1D4B A;  2ONQ A;  2G9H D;  1MVK A;  3KWV A;  3BYT B;  2LHE A;  3IXS A;  2LGI A;  2JSV X;  1K53 A;  2K9X A;  1K52 A;  2BTE A;  1QOF A;  5BYR A;  1N62 A;  1VR9 A;  1PDX A;  3ABV B;  3AEE B;  2WU5 B;  1JML A;  4REZ A;  1ET9 A;  1ET6 A;  1ESF A;  1TZO A;  1UWX A;  4HRS A;  1RFK A;  3AN1 A;  3WCQ A;  5HI1 A;  1HEZ E;  4MAC A;  2BB5 A;  2QIL A;  5TSS A;  2K0P A;  1MPE A;  1DGJ A;  4B0M A;  1JAL A;  5MPO A;  4JX1 C;  3IT6 B;  1L5P A;  2BS3 B;  1NVI D;  1NYR A;  1QT9 A;  4TQ1 A;  1FNW A;  1QOB A;  2IJ0 A;  3ZJV A;  2DYM A;  4RF1 A;  1EM7 A;  1QKZ A;  4ZHO A;  1AYF A;  3AE7 B;  1MI0 A;  3SR6 A;  4J3O D;  4KGS A;  4A6Q A;  2KAJ A;  3AE4 B;  4HEA 1;  1FIQ A;  2LFI A;  3Q8E A;  2KN4 A;  2WXI A;  2IDY A;  1ZPS A;  3VQI A;  3VRB B;  1C78 A;  4M0W A;  1VZ8 A;  1ENF A;  1XLP A;  2WDR B;  3BVZ A;  3URY A;  1RYJ A;  2LHD A;  4LTU A;  1YN5 A;  2PW9 A;  4C7Y A;  1VLB A;  1XO3 A;  2V0G A;  1D5X C;  1NEK B;  5FR3 A;  4ITK A;  1Y56 A;  3BII D;  3AM9 A;  3GB1 A;  4OVZ A;  1AWD A;  3HVD A;  2VZK D;  1C4C A;  1F2R C;  2N7J A;  1I4R A;  4DXF A;  1FMA D;  5H92 C;  1YN4 A;  2WXG A;  2I2Y A;  2Y5C A;  2IGD A;  1PGB A;  5FKA C;  3FC4 A;  3AED B;  1CJE A;  4WH4 A;  1BXT A;  1FXA A;  1UGJ A;  5D3D A;  1E7P B;  2J52 A;  1WSP A;  4RGN A;  1I4H A;  3NZ3 A;  1HZ6 A;  4ZRQ A;  5C3J B;  1GAQ B;  3FIL A;  4TSS A;  1N63 A;  4R3D A;  3U7Z A;  4WQM A;  1GB4 A;  3BWU D;  1SE4 A;  1TY0 A;  3TUO A;  3P63 A;  4RH6 A;  4RGT A;  3P1M A;  5EE0 A;  1F77 A;  2PKO A;  2OED A;  1ZDV A;  2DWQ A;  2MJ3 A;  2W82 A;  2WU2 B;  2W54 A;  1TKE A;  3B9J A;  3NVY A;  4XWT A;  3U52 E;  3RPF C;  2AQ2 B;  5GXG B;  3AH7 A;  1ZE3 D;  5EE9 A;  1L0X B;  2JZP A;  3MJ5 A;  1IGD A;  4B0E A;  2ICI A;  1RM6 C;  2IPK D;  2B76 B;  3PZ8 A;  3P4R B;  2WXN A;  5LNK 1;  1I4P A;  2GI9 A;  2N0S B;  1HQR D;  4NAM A;  4HKQ A;  1QF6 A;  2H88 B;  2TSS A;  2YEP F;  1ZOY B;  2LUM A;  3EUB 2;  3H8H A;  3T3O A;  3LXF A;  3CIR B;  2H89 B;  1P7E A;  2L52 A;  5BMI A;  3AE3 B;  4USA A;  1P7F A;  1VJK A;  1B9R A;  5BYQ A;  1L4Z B;  4KKI A;  1PGA A;  3ZYY X;  1D5Z C;  1NI3 A;  5AUK A;  3TEZ A;  4MH8 A;  4P16 A;  3EA6 A;  1FEH A;  1C76 A;  1WXQ A;  1L0V B;  2NMQ A;  4H2A A;  4ZRP A;  4YWG G;  5BMG A;  1L4D B;  1SB3 C;  2BT6 A;  1EWY C;  3AB5 A;  1ZUD 2;  1PFD A;  3AE9 B;  1E9M A;  1XCT L;  2PIA A;  3LYY A;  4IOI E;  2BYT A;  4NJC A;  5EE1 A;  1TYG B;  2LJI A;  3KLS X;  4RCO A;  4UDU C;  1R7S A;  3W5U B;  1YJJ A;  3AE5 B;  2FUG 1;  3I9V 1;  1SJH D;  2I38 A;  4MM3 B;  3BYY B;  1EU3 A;  1PUT A;  1LO5 D;  2J42 A;  1QIL A;  4AQ7 A;  2INP E;  3AEB B;  3MHZ A;  1XLO A;  4WWM A;  2JQR B;  2RDH A;  3PZ7 A;  3DWM A;  2WDV B;  2WXF A;  4C80 A;  1JRO A;  2DBY A;  3EGR A;  4KX6 B;  5I4D A;  2W3R A;  2WP9 B;  1Q10 A;  2G1E A;  1L6U A;  2QJL A;  3W9C B;  3B2G A;  1M4V A;  4NAW B;  2SEB D;  2YEP B;  2M19 A;  2RMM A;  2X38 A;  2IGH A;  1TKG A;  1B1Z A;  2GRI A;  1JWM D;  1JWB D;  1C77 A;  3AEC B;  4L23 A;  1T3Q A;  2KAC A;  1FD6 A;  1VZ6 A;  1IBX B;  1EWC A;  4YSX B;  1WRI A;  2VZK B;  2WXP A;  1ZDX A;  1KFY B;  4KGT A;  2R61 A;  4YXD B;  3GP7 A;  1N5X A;  2J53 A;  2PVG C;  3Q8B A;  1D5M C;  2Z8L A;  2W55 A;  4HRO A;  1TKY A;  2CU3 A;  2LMC A;  1NEN B;  2E6X A;  2FE8 A;  1QLB B;  1FFU A;  4RGO S;  2ON8 A;  2ZW0 A;  1TS5 A;  3SFD B;  5E6J A;  2ZW1 A;  3Q8F A;  5G5G A;  4DXG A;  4EE2 A;  3TEX A;  2QSD A;  4ZHP A;  3NUH B;  4MT5 A;  4RGM A;  2XNA C;  1NYQ A;  3GS2 A;  3CWI A;  2INN E;  3E56 A;  4N59 A;  2Y3A A;  2N9K A;  3NVV A;  1DOY A;  2PVO D;  2WXH A;  1KTK A;  1STE A;  4YTP B;  4WIP A;  1XF5 L;  4CQN A;  1WYG A;  2KMM A;  5FK9 C;  1UWM A;  3P4P B;  2OHF A;  1H7X A;  1AN8 A;  2WXR A;  1TS4 A;  2BS2 B;  1T5X D;  1YNT E;  3L4P A;  1SBB B;  4US8 A;  1J7A A;  2BW2 A;  1E10 A;  1FNU A;  1I7H A;  4OZB A;  3ZJU A;  2L32 A;  1XCQ L;  1DOI A;  4D2K A;  2PTL A;  3SEB A;  1AW7 A;  4L2Y A;  1YQ3 B;  1SE3 A;  2NTT A;  2K3U A;  4NZL B;  1GPX A;  3U4E G;  1ACC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...