2ACZB

Complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/electron transport
total genus 58
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2aczB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aczB01
3LXFA 3P1MA 1QOGA 2JX5A 1FXIA 2M19A 2WQYB 3AEFB 1JW9D 4HRSA 4N58A 3WCQA 2PIAA 3RPFC 1NYRA 1WXQA 4C7YA 2WDRB 1NENB 1TKEA 3AEAB 2LEKA 4C80A 1GAQB 3CWIA 1ZOYB 2WDQB 2FBWB 3AE9B 1VDVA 3VRAB 1L6UA 1TKGA 2CU3A 1TJEA 1TKYA 1L6VA 4A9AA 3NVYA 4FXCA 1JQ4A 3AEEB 3P4RB 1WWTA 1XLQA 2E3TA 3DWMA 2Y5CA 3HRDD 1DOXA 1DOYA 1PFDA 3B9JA 2L83A 5EE1A 5C3JB 5G5GA 1YQ3B 3AE4B 2EKIA 1E6EB 3AECB 3W5UB 1YQ4B 3VRBB 1J7CA 1FFUA 1RYJA 2Q5WD 1CJEA 2W3RA 3CIRB 1E7PB 2JQRB 3FAHA 4US9A 1JROA 2AX5A 1WYGA 3DWGC 4N6EB 3SFDB 4YSXB 3AE2B 4YTPB 3W5VB 3KWLA 1FO4A 3AEBB 1ZUD2 3AEDB 1RM6C 2DWQA 3SR6A 1IUEA 3VR9B 1QOAA 2WS3B 2PKOA 4HROA 1WGKA 3ETRA 1V97A 1F0ZA 1OFFA 1WRIA 4ZHPA 5EE3A 1FIQA 1DOIA 3ABVB 3AV8A 2G1EA 4YTNB 1FMAD 1AWDA 2K9XA 2K5PA 3P4SB 2W3SA 2HTME 3EUB2 1VLBA 1E0ZA 5MPOA 3AE5B 1XLOA 2DBYA 1H7WA 3NS1A 3LB8C 2PVOD 2WP9B 1FRRA 3P63A 5AUIA 1OQQA 5G5HA 3BIID 1TYGB 1R7SA 2N0SB 3AM9A 3ZYYX 4WQMA 4C7ZA 1E10A 1J7BA 1JRPA 4P6VF 3B2FA 4US8A 1JALA 1ZXIA 1GT8A 1N61A 4LTUA 2W54A 1GTHA 1AYFA 1NI3A 1RWSA 1FRDA 1YJIA 3AEGB 3P4PB 3CF4A 1JWAD 5EE9A 1B9RA 2ACZB 4ZOHC 1GPXA 4JWUC 2H88B 2WU2B 1N5XA 4ZHOA 3SFEB 3AMZA 1SB3C 1V8CA 1KF6B 1NEKB 1SIJA 4KX6B 4IDIA 5AUKA 2MJ3A 1FXAA 1NVID 2WLBA 1N63A 1N5WA 3FC4A 3AN1A 3NRZA 3NVVA 4JWSC 2PVGC 4YT0B 3NVZA 1H7XA 1A70A 3L4PA 4YSZB 1ROEA 2K22A 1XLPA 2BS4B 1KFYB 2KMMA 3VR8B 1L0VB 2MJEA 2WDVB 3AE6B 1XLNA 2KAJA 3AB5A 4WWMA 1QF6A 1PDXA 1VJKA 1T3QA 2CJNA 2CJOA 5H8YE 4N59A 1QLBB 1I7HA 3AE3B 1NYQA 1QOFA 3HVZA 1E9MA 1N60A 1KRHA 2BT6A 2QJLA 1SF0A 1GTEA 2OHFA 3AH7A 1OQRA 5H92C 2MH7A 2WU5B 3AE7B 4YTMB 1L5PA 1EWYC 1N62A 2QIEB 5GXGB 3P4QB 2H89B 3NVWA 1YJJA 3HUIA 2B76B 1UWMA 1QOBA 3AE8B 1CZPA 1XO3A 3W9CB 2BS2B 4USAA 1J7AA 1QT9A 5C2TB 1FFVA 1JWBD 3AE1B 2L52A 3PO0A 2BS3B 2M56B 2W55A 4JX1C 1DGJA 5EE0A 1ZP0B 1FM0D 4ITKA 4YSYB 1RFKA 2MJDA 1PUTA 4YXDB 3B2GA
chains in the Genus database with same CATH superfamily
1WZ0A 4EE2A 1CK1A 1C76A 3EFCA 4MELA 1TKGA 4M02A 1TT5B 3JYUA 4BFRA 2KTFA 2RPQA 3TEWA 3UIOB 4MEMA 4ICVA 1SIFA 3DBHI 3MC8A 2K3UA 2J7QB 4AJWA 4HROA 2CHWA 2WXGA 1FIQA 3RZFA 2DENB 3VAWA 1TZ1A 2V9HA 2J52A 3KUDB 3L08A 3R8BA 3PZ7A 2QMTA 4W9KA 2DYMA 4LNKA 1AW7A 4II3B 2IO0B 4YWGG 5IOIA 4JPSA 3TUOA 2AEHA 3PT2B 1LFDA 2D07B 3N1YC 4KZ0A 4W9LA 2GRIA 2NPTB 1UNSA 1FRDA 4N9F4 1LO5D 1ZGUB 2KXJA 2N9EB 2K25A 2LVOA 2BB6A 4ZHOA 4LJOB 4RF1A 3ZTCA 1WR6E 2KHWB 1WYWB 2KAJA 3ZNZB 2LVPA 1SSNA 2N7EA 1T3QA 2GI9A 4IC7B 2L8JA 3A9JB 3C8YA 3L0WB 1GTEA 2LWPA 4A3OA 3IT6B 4YTMB 1V5TA 2UU7A 1WMHA 3L16A 2TSSA 1T0RC 2B76B 2JUOA 1WXVA 5D2MB 2LGDA 4W9CA 2PE6B 2WXHA 3ZNHB 2LRUA 4KSKC 2M4NA 2QEJC 1ZW7A 2KFJA 4N58A 1STEA 3RT3B 2GOWA 2HJ1A 3KLSX 3B9JA 1FPYA 1I4PA 3BK1A 3EA6A 3WAPA 3ZJTA 1L7YA 3EECA 2GBRA 2KX3A 4EOYA 4A55A 3AEDB 1S1QB 3LYYA 4AUQC 1WGKA 3N32A 1U4AA 2JZPA 2G1EA 4YTNB 5BMGA 5LXIB 1KTKA 3ONSA 4KIKB 1YMHE 2KN4A 2ZNVC 4IW0A 4B95A 2M0AA 1SBBB 2WX1A 1VZ6A 2INDC 1V5OA 4ANWA 4W9GA 2L0TA 3PTFC 5CHVC 2VH2A 2FIDA 1WM2A 4F1SA 4G0NB 1QQRA 2QDFA 2H88B 3TMPB 4NJ6A 2Z0EB 5AUKA 2MBQA 4GDKB 2BB5A 3NRZA 3NVVA 2QILA 5HKHA 5AZHA 2JZZA 1WJNA 1ET6A 3PLVA 4NY0A 3AE6B 2R61A 3SEBA 4E71A 1R4MI 4OVVA 2FCSA 1HA5A 1L5PA 1MVKA 3Q8BA 3NVWA 2FE8A 5FR6A 4P1BC 1QOBA 2ICIA 3W9CB 4EKUA 2WX0A 2GLSA 2L52A 2KJHB 1DGJA 3RCZA 3U7ZA 3HHMA 4K3BA 1MHXA 3ZRCA 3DBLB 3SD5A 4I6NB 3IT4B 1TKEA 1FCCC 5TR5A 1EF5A 2WXMA 1E5WA 3HRDD 2WXOA 3QHTA 2KDEB 3VH4B 2KTRA 1PFDA 2Y3AA 3AE4B 3N20C 1RYJA 4WJPA 5JH5C 3Q3MC 4N6EB 1WYGA 3L10B 2ZVOA 3QAQA 1RM6C 3FILB 3H6NA 1IUEA 3V3XA 1DYQA 4BKSA 4LDTB 4MT5A 2BF8B 1I4QA 2V3PA 3V62A 4ZHPA 5L95C 1UELA 3Q14C 2FAZA 3R2TA 1AN8A 2LD9A 4M0WA 2SAKA 2EMSA 2V4LA 2PVOD 5AUIA 3RNEC 3WA0A 1E10A 4G11A 2VH1A 5BO4B 4BAXA 3CSFA 1YJIA 2L32A 1B1ZA 2D10A 2A4ZA 2YVCA 1N5WA 1WGDA 1XCTL 1V1OA 1WXAA 4GDKA 1XLNA 2KANA 2GB1A 3X0WA 3AE3B 4JE3B 1NYQA 1HQRD 1WXSA 2BGFA 2BWFA 2QIEB 1P7FA 3HUIA 1UWMA 3V05A 3ZVVA 3VFKA 3ZNID 2G3QB 4H2AA 4ITKA 2MHJA 4XX5A 3L54A 2ZCCA 4B0MA 1TJEA 4WAAA 5T8IA 3QWZB 4FXCA 1C3TA 4LNIA 1GB1A 4FADA 4LK0M 4TUUA 1KLUD 5D94A 3NJTA 2JWZA 4GMVA 2HD5B 4YTPB 4R3DA 3KWLA 4IM2A 1IPGA 4XDDA 2PKOA 2KC1A 4GB9A 4TQ0A 1E8XA 4J3OD 1DOIA 2WXFA 3ABVB 1D5XC 2V1YA 1H7WA 1YD8U 1VRAB 1FRRA 3RULA 2KK8A 2DAFA 2BTEA 3WANA 3O65B 3H9DA 4ZRJA 1YNTE 4GXBA 1N6ZA 1E7UA 5EDSA 2D2QA 2AL3A 1NVID 4RGOS 5IN7A 2L7RA 5D7GA 4XYCA 3VR8B 4L2YA 2JSVX 2NBWB 3VQIA 1YN3A 2XEWA 3AH7A 3ECIA 5IKCM 5L83A 3DBSA 1T0SC 3QQ8B 2VRRB 4CO7A 1P7EA 3V6EB 1CMXB 4YSYB 1RFKA 2MJDA 5E6NA 4GSWA 4TKNA 1D4BA 3AEFB 3ML8A 1C78A 3W1SC 1ZOYB 1L6UA 1V9JA 4ANXA 2GBNA 2IYDB 4A9AA 3TEYA 3N30A 1XLQA 4OVUA 4BOSC 4BZAA 3S2AA 4FA6A 2L83A 5D3IB 1E6EB 3VRBB 4K7WA 4EFOA 1LM8B 2CU1A 5HFYA 1K52A 3IHPC 3SFDB 3H1UA 2WDTB 1ZDVA 1QOAA 4L23A 3K9OB 3SHQA 3ZJUA 1YIWA 4HCPB 2G45B 1SE9A 1FMAD 2C7NB 2WXNA 3WIMA 1AWDA 3P4SB 1GC6A 1VLBA 4DDGD 2LGYA 4PS7A 2BW2A 5I4DA 2W82A 2WXLA 3P63A 3DCGA 2OOBB 1H4RA 1C1YB 4AQ7A 3U2SC 3B2FA 4US8A 2D11A 2MBEA 1F52A 4D2KA 1UD7A 3ZDTA 2YLMA 3A9KA 1IGCA 3GE3C 2KC2A 2BVCA 5CHFA 3SU8X 1SB3C 1IYFA 1OEYJ 2Y5PA 3ZJVA 2J0MA 4DBGA 3VTWA 3VUYA 4DHJB 2CJNA 2CJOA 2WXJA 1Q1OA 2GBKA 2LMCA 1EO6A 1SF0A 2RSUA 1CQVA 2O2VB 2MH7A 4KSLC 1ZDXA 3QX1A 1YN4A 4ZRIA 1YJJA 1OTRB 3DVGX 1WGRA 2YEPB 1K50A 2IZVB 4JQWC 1XO3A 1I42A 2AQ2B 3PRPB 3VTVA 2CKHB 3ZXVA 1GC7A 3BYTB 5EE0A 1NDDA 5TSSA 1TIFA 3WCQA 3NY5A 2MLBA 3BVMA 2O6VB 4JGHB 2OJWA 1NENB 4IG7B 1T0QC 1GAQB 3CWIA 3QJZA 2XN9C 3T8MA 3KWVA 4XGAB 2WXKA 3KH0A 2HJ8A 2KQ7A 1WX7A 5E6JA 2JRIB 4OVZA 3E56A 2CR5A 4US9A 3U8ZA 2NBVB 2G4SA 3OJ3A 3Q6BA 4LLGM 4BBNC 1WGYA 1E90A 1TS3A 4NJ7A 2K9XA 2KQSA 5AZFA 1MHHE 1XCQL 2N9PC 2KKCA 2N1VA 4OHJA 2GBJA 3BIID 2N0SB 1C79A 4WQMA 2LJ5A 1UGJA 2J53A 5D3DA 5J17A 2HDEA 4KKJA 1JRUA 1WI0A 2RR9A 2PEAA 2NR2A 4JWUC 2AQ3B 3AMZA 1KF6B 1F77A 4ZDVA 3FC4A 2K39A 3U4EG 1XLPA 1FXTB 4WWMA 1FD6A 1WSPA 1P3QU 1V2YA 2DZMA 1WH3A 1QLBB 3ZLZA 1I7HA 3OLMD 4M8NA 1KRHA 4WJOA 1ENFA 4LCDE 4IWOA 1YJ1A 3R66C 2QCZA 4HKZE 4DWFA 2WXIA 2RDGA 1XF5L 2O2VA 1VZ8A 2IO3B 2K6DB 3ALBA 4LNFA 5KHQA 3IBEA 5BYSA 1SEBD 4KZCA 2PLPA 2M1MA 2Z0DB 2HTHA 1M94A 2DHZA 3RI7C 2WDQB 1TKYA 2G4DB 3AEEB 1F1HA 4W9HA 3WALA 1UUPA 3BVZA 5DCNA 3X23A 2ZEQA 1LGRA 2BQQA 3IAM1 2WNMA 4XE0A 2K0PA 1ISNA 4BKTA 2GBMA 3PV1A 1E8YA 4F7ZA 1C4AA 2DBYA 2KVZA 1D5ZC 4A20A 3Q8AA 4NAWB 4YL8A 1UH6A 1JCKB 4REZA 3A4SC 3DBRI 4PK1A 2W54A 1GTHA 1XEEA 4PT5A 1JWAD 4OZCA 1NI2A 5J18A 4AP4C 1EF1A 1N63A 2JT4B 2KWCA 4S17A 3L17A 2C7HA 3Q3FA 1Q10A 3L4PA 4AJYB 1H8CA 3H8HA 5JXVA 2FNJB 3AB5A 3OJ4B 2BYVE 2KYWA 1EM7A 2KJRA 4FBJB 3PSEB 5JZEB 2N4FA 3I3TB 2KFKB 4C4VB 4PS3A 3HM6X 4FULA 3R7QA 1BXTA 2NPTA 2KWDA 1J0GA 4HJKA 2L05A 2LGSA 1BMLC 1MPEA 1QT9A 2KACA 4IUMB 4XC2A 3HIZA 1HZ5A 3PS6A 3BVGA 5C23A 1WJ6A 1PUTA 1WZ3A 2M19A 4C7YA 4ARIA 4DXAB 3RFZB 2R2QA 2RMMA 1GOZA 2FIFA 1R4MB 5BYRA 3A9JA 3I57A 2X8XX 3UI3A 2EKIA 1MFWA 1FFUA 3PZ8A 5DPSA 1HXYD 2BYEA 1C4CA 1LXDA 3TIXA 2DYOA 4S0RA 1Z5SB 2JYEA 3ZDMC 1TGZB 4KDLB 4MM3B 3SR6A 2DWQA 1GB4A 2KT7A 3GZNI 3T9LA 4I6LB 4CQNA 5BMIA 2KNBA 4II2B 1KOTA 4BKGA 2KWUB 3AV8A 3IG3A 4FLHA 4LJPB 3UINB 2ZPNA 1WX9A 3AE5B 1XLOA 4F8CB 2KDMA 3DBLI 3NS1A 1MG8A 3ZIMA 3GOEA 3MHZA 5C1ZA 4XZ4A 2A5UA 4LTUA 4NAWA 1AYFA 1RWSA 3P42A 3TJPA 3P4PB 3PGEA 5EE9A 4M00A 1V1PB 1WY8A 4ZRQA 2JVCA 1HTOA 3AU4A 1WXMA 3W2DA 2KZRA 3PPAA 2N9KA 4KIKA 4ZYSA 4B0EA 1J19A 4RGTA 4IM0A 2EMTA 1VJKA 1FNWA 2KDIA 3E9SA 4X57B 2DAJA 2I1KA 2D5GA 1VCBA 3M3JA 2CS4A 1BT0A 1HE8A 1RLFA 2DZJA 3MJWA 3ZNGC 3AE8B 1J8CA 3VTUA 1JWBD 3IFWB 1P98A 4B6WA 1WJ4A 2K1FA 3OG5A 2I38A 2JX5A 2XNAC 4HRSA 3BZDB 1UBQA 2FCQA 3AE9B 1Z2MA 1VDVA 4QAYA 2BYFA 2XK5B 4JLCA 4GDLB 1LQBA 2K8CA 2NVUI 4DHJD 3DOWA 3W5UB 1YQ4B 2Q5WD 4GGQA 1WIAA 3EHVA 2JQRB 3UQAA 2E6XA 4A6QA 4DQOC 4WWNA 3AE2B 2L0FA 3AEBB 2KOXA 2L00B 1P9DU 2MP2B 4GN1A 3DVNU 1TS5A 1L2NA 1RFAA 3J9CA 2ASQA 5IO9A 1OQYA 2WYQA 1QKZA 1F9JA 3MJ5A 1KM7A 3OWEB 4W9FA 2HTME 2O6VD 1E0ZA 4RCOA 4PYZA 3H7PB 3LB8C 4MGYE 2ONQA 1R7SA 4RFBA 3A1QB 4P6VF 3RNAC 2REXA 3PREA 4JL9A 1A5RA 4J6IA 3D32A 3FILA 3M62B 1N5XA 3SFEB 3JVZX 1V8CA 1UZXB 2D3BA 3AN1A 3QC8B 4YT0B 1V1PA 3N9YC 4FJVB 1OGWA 1GPXA 1OEYA 4EZJA 2IO1B 2JZ3B 2BT6A 2LRWA 3DVGY 5H92C 1OQRA 1N62A 4UDUC 5GXGB 2FUHB 4USAA 2LHDA 1J7AA 3QARA 1GG3A 2D3CA 3C19A 3GS2A 2V3NA 1FM0D 2M17A 3KYCD 4L1BA 1ZKHA 3FAHA 3NOBA 3BYYB 2JWUA 3ZW3A 2D3AA 3CF6E 4C80A 2JU6X 3VXWA 4IWPA 2FBWB 3VDZA 4DHZE 1G6JA 4FHKA 1K8RB 4WH4A 4ANUA 3PLUA 2D3GA 4GIVA 1D3ZA 5EE1A 5C3JB 1YQ3B 2GMIC 1TS4A 3DHGC 1UBIA 3CIRB 1E7PB 3Q2AC 2KX0A 4YSXB 1VD2A 4ANVA 4K3CA 1MJDA 1XQQA 3H7SA 3ETRA 2QHOA 5AZGA 2WWZA 3EUB2 3VH3B 1D6EC 2PPHA 4HPPA 3DQVA 1R4NB 1V49A 5DPWA 4XDCA 3ZYYX 4AWJA 4CHKA 1JRPA 5DPRA 1PQSA 2EELA 1N61A 1E8WA 1NI3A 5CX3A 1RAXA 4OZBA 3VUWA 1WGGA 2ACZB 1Y8RC 2K6QA 2YEPF 4NNJB 2W9NA 1Q0WB 2N9LA 3HK0A 1TBEA 4O1NA 2MJEA 5E6PA 2LASA 1KJTA 1F2RI 2L1AA 5GMVA 2OHFA 3GB1A 2BBCA 2XBBC 3BK2A 1TTNA 2KWVB 3RNGC 3U7DA 4AOFA 5HG2A 4M01A 3JW0X 2WXQA 3ZO5B 2OEDA 2WHIA 4WJNA 1JW9D 3RNCC 3NS8A 2R2OA 1SXTA 3ZXRA 4B9KA 3VRAB 1L6VA 2RGFA 3V6CB 1D5MC 4HLEA 1JQ4A 1JWMD 4RH6A 1MG4A 4E3CA 5G5GA 4KKIA 2FUG1 1J7CA 2LJIA 2ZW0A 1SGHA 4TV3A 1L4ZB 2W3RA 2BWES 1HEZE 3KQ4A 5G2NA 4OW0A 3AU5A 3W5VB 4BOZB 3PZDA 1PYWD 3VR9B 4DK5A 1WF9A 3O13A 3TEZA 4HVBA 1WRIA 5CTRC 1TS2A 4P1CC 3EC8A 2L76A 3APFA 4TSSA 3MHSD 3PHWB 5MPOA 3WAMA 2RDHA 2ZNVB 4MH0E 4ASWC 3JSVB 2UWQA 4KV2A 3B1LX 4C7ZA 1J7BA 1MI0A 1WMHB 2DZKA 2IGDA 1JALA 2LXCA 1WFYA 4K7UA 1L4DB 1AARA 2DYBA 5LXHA 4WWOA 1I4XA 4ZRPA 4K1RB 1NEKB 1SIJA 1FXAA 4WAFA 2ZVNA 1ROEA 1QILA 4Q2JA 1PDXA 1WE6A 3BINA 4C56C 3DBHB 4FJYA 1QOFA 4ACFA 3NUHB 2WU5B 2MSED 2J4XA 5G55A 4CYEA 4GOCA 1K53A 3LDZE 5C2TB 2M56B 2W55A 3NZUA 1FNVA 2IY0B 2ON8A 4K81A 4LDTD 5IP4D 3Q3OC 2PIAA 1JWSD 4FN2A 2IGGA 3AEAB 2LEKA 3PVLA 1FEHA 4KGTA 2BKRB 2Y5CA 2MWSB 2ZPYA 2RD0A 4A90A 2MBBB 4ZYNA 1SJHD 4PYUA 1UF0A 1VR9A 1X1MA 1Y56A 3DWGC 1YX6B 2Z59B 1YOVB 1V81A 4MACA 3WAOA 5E6OA 3IXSA 1V97A 2KDFB 1F0ZA 2WGSA 2O6VA 3ZKJC 3VUXA 2M0XA 1M4VA 1F2RC 3CMMB 2K8BA 2KLCA 2VZKB 2LGXA 2LUMA 1C77A 1JWUD 1T5XD 3RNFC 4RM8A 4WWPA 2WXRA 3IVFA 2Z8LA 3AXCA 1UWXA 3JSVA 2LGIA 4RGNA 4EUTA 2MCNB 1RRBA 2JF5A 2DLBA 1T0YA 3AI5A 3CF4A 4P16A 1B9RA 2IY1B 3BWUD 1ZXHA 3A4RA 2ZZPB 1TY0A 3ZTDA 3A33B 3NVZA 2LVQA 3ENEA 1KFYB 3AULA 1UGMA 3GE8C 4GLSC 1WJUA 3V60A 1ACCA 2JY6A 1L0YB 2KTRB 2LI5A 1EU4A 1EWCA 3DBRB 3DVNV 2CHZA 2K8HA 1CZPA 5KHOA 1SE3A 3AE1B 1E8ZA 3PO0A 2BS3B 3HM3A 1I35A 3TBLD 1YQBA 3APDA 2KN5A 1FXIA 4NQLB 3M63B 2MW5A 4HPLB 2WXPA 1WXQA 5FK9C 2C5LC 5J2RA 1V6EA 2J0JA 2BPSA 4KDIC 3URYA 2IPKD 4M0WB 3P4RB 2E3TA 1XT9B 2AQ1B 3HVDA 3N1ZC 2LUEA 1QZEA 1ET9A 1K51A 3QK0A 1WX8A 4HPMB 1XXGA 2RDBC 1FO4A 2KD0A 2KJ6A 2IGHA 4EEWA 5LNK1 4HXDA 4MGZE 5DPTA 4RF0A 3RYTA 4W9EA 3KW5B 4W9JA 2WP9B 2KVRA 1E7VA 1C4PA 4AS1A 1ZXIA 2NCNA 4ICUA 4MGKE 3VHTC 3GZNB 5HHDG 4HK2A 1IBXB 1I4HA 3ZQ4A 1WGHA 2MJ3A 3UIPB 2WLBA 3VVWB 2MX2A 3OAWA 1A70A 2K22A 2BS4B 3NZSA 5IAAC 4ZRKA 2N1WA 3HVZA 1E9MA 2INCC 3MP9A 3AE7B 2NBUA 1NBFC 2MA9B 3KUCB 2BS2B 2LZ6A 2DX5B 3Q8EA 2G9HD 4FJZA 3NHEB 3Q69A 4W9DA 3PRZA 3B2GA 3P1MA 2IO2B 2NTTA 2IDYA 2V0GA 1ZE3D 3Q8FA 4IWQA 2JXTA 3ZGZA 2CU3A 1PGXA 3RMKC 3DWMA 2Y5BB 4GU2A 2FCNA 4KGSA 1XD3B 4DHZB 3TEXA 1PGBA 1IGDA 3I9V1 2KFKA 4C4VA 4G3XB 2N7JA 4DDID 1CJEA 2PMVA 1WR1A 1GNUA 2PJHA 4MSQB 2AL6A 1GJZA 1ZUD2 1SE2A 1SJED 2WS3B 3U30A 4KVGB 5EE3A 1YX5B 4I6PA 2C7MB 2K5PA 2EKEC 3RUIB 3CSTA 3N1XC 2QC8A 5FKAC 1OQQA 3I63C 3T3OA 3L13A 2ZW1A 2KQ4X 4FHJA 4HCNB 3MTNB 1KLVA 2JYTA 3N3KB 4MM3A 4LNOA 4ARCA 2KO3A 1C9FA 4KX6B 2J42A 3ML9A 4JWSC 1IBXA 2PVGC 2IJ0A 2PE9A 4YSZB 3R2IA 2ZCBA 2KMMA 2KLGA 2PTLA 2C60A 3P2BA 3PHXB 2SEBD 1EWYC 2INPE 3P4QB 1V86A 4BBNF 3TCAA 2NTSA 1WE7A 4WIPA 4BVUC 2DNFA 1ESFA 2M8SA 4MJSB 4NPNA 3EFUA 3Q3JA 4URKA 1TY2A 2X38A 4JX1C 1ZP0B 1P0RA 2I1JA 2LXAA 3QA8A 2WQYB 2JPHA 5BYQA 3RPFC 1NYRA 1S3SG 2WDRB 4DXGA 1P1AA 3Q8CA 2QJLA 3V61A 3NVYA 4OZAA 4HKQA 1WWTA 3W1SA 1DOXA 4XWWA 1DOYA 2AYOB 1GUAB 4G50A 4TQ1A 4M8MA 3SDLC 3K9PB 3EGRA 1SE4A 3AECB 4EZKA 2LHEA 3QCAA 1JROA 2AX5A 3LJ3A 4HEA1 3C0RB 2MBHA 2KMCA 3A9KB 1PGAA 2MBOA 1Q5WB 3GP7A 3MC0B 2RPVA 4EZLA 3W1YA 3I5JC 2MQJA 5LLIA 4WJQA 2NS5A 2XK5A 4GDLA 4KGRA 4IOIE 5JHAA 4MH8A 4RNAA 3AM9A 4A3PA 3DHHC 2LFIA 1L0XB 1GT8A 3DPDA 3T3NA 1HTQA 5AEKB 4WQOB 3B08A 3AEGB 4NJCA 3U52E 3ZUNA 2MP2A 2WU2B 2B3AA 3UQBA 2C9WB 1FCLA 2CHXA 1IP9A 1T6BX 3H7PA 2WDVB 2MEKA 1QF6A 2N7DA 2INNE 2VZKD 4N59A 4W9IA 2QSDA 5FR3A 4C00A 4NAMA 1N60A 5JHBA 2AWTA 4NZLB 3A1QA 3KVFB 3QIJA 1VZ7A 2V4IB 2H89B 2NMQA 1R4NI 4HJGE 3KUZA 4PS8A 4TMAB 2IBIB 2L3ZA 1FFVA 3M95A 4RM9A 5D6JB 4MJSA 2BKFA 1YN5A 4YXDB 3LXFA 1QOGA 2JXXA 1HZ6A 2ZJDA 3KYDD 1KH0A 1I4GA 4JIOU 4DXFA 2PW9A 3RN9C 3IAS1 3R3MA 1KLGD 4MDKE 4HDOA 4IKGA 2OJRA 2V3SA 4XWTA 3UF8A 3FKYA 5IA7A 3MFGA 2FCMA 4E74A 5HI1A 1FNUA 1OFFA 2KDBA 4LNNA 4RMAA 4BKSD 1JMLA 3Q3NC 3DHIC 2W3SA 4HWIB 4WURA 3TSSA 1WM3A 3PRMB 3BY4B 1TYGB 4K7SA 3R7RA 3NZ3A 4RGMA 3RNBC 2UYZB 4MGIE 3MC9A 3UGBB 1V80A 4HDQA 1WRDB 4ZOHC 1ZPSA 2J0KA 1I4RA 5CHWA 4IDIA 4MSMB 4A8XC 1EUVB 2I2YA 1H7XA 2HE7A 1L0VB 2JRHA 4NQKE 5H8YE 1BUIC 4P7IA 3RZWC 2MRPA 3ZRFA 3B0AA 3APCA 2KMAA 2DZIA 1TZOA 3TL5A 4IM3A 1EU3A 2BYTA 3NG0A 5BMHA 2N9XA 3DDCB 3RD2A 5G5HA
chains in the Genus database with same CATH topology
2JX5A 1FXIA 2XNAC 4HRSA 3AEFB 4EE2A 1D4BA 1CK1A 3BZDB 1C76A 2WXPA 1WXQA 5FK9C 1C78A 1ZOYB 3AE9B 1VDVA 1L6UA 3URYA 1TKGA 4A9AA 3TEYA 2IPKD 3P4RB 1XLQA 2E3TA 4GDLB 2AQ1B 2L83A 3HVDA 3TEWA 5D3IB 1E6EB 3W5UB 1YQ4B 3VRBB 1ET9A 1K51A 2Q5WD 2JQRB 5HFYA 1K52A 2E6XA 4A6QA 4DQOC 3SFDB 3AE2B 1XXGA 2K3UA 1FO4A 3AEBB 1ZDVA 1QOAA 1TS5A 4L23A 2IGHA 4HROA 5LNK1 3J9CA 3ZJUA 2WXGA 1FIQA 1QKZA 1FMAD 2J52A 2WXNA 3MJ5A 4RF0A 1AWDA 3OWEB 3P4SB 2HTME 1VLBA 1E0ZA 4RCOA 3R8BA 2BW2A 3LB8C 3PZ7A 5I4DA 2W82A 2WXLA 2QMTA 2WP9B 2DYMA 3P63A 1AW7A 2ONQA 1R7SA 4YWGG 4JPSA 1C4PA 4RFBA 3TUOA 4AQ7A 4AS1A 4P6VF 3U2SC 3B2FA 4US8A 1ZXIA 2GRIA 1UNSA 1FRDA 4D2KA 1LO5D 3FILA 1IGCA 5HHDG 1IBXB 1I4HA 2BB6A 1N5XA 4ZHOA 3SFEB 3ZQ4A 1SB3C 1V8CA 2MJ3A 2WLBA 3AN1A 2Y5PA 4RF1A 4YT0B 1V1PA 1A70A 3ZJVA 2K22A 2BS4B 3N9YC 1GPXA 2KAJA 1SSNA 2CJNA 1T3QA 2CJOA 2WXJA 2GI9A 2LMCA 1E9MA 2BT6A 3HVZA 3C8YA 1SF0A 1GTEA 3MP9A 5H92C 1CQVA 1OQRA 3IT6B 2MH7A 1N62A 3AE7B 4YTMB 4UDUC 1ZDXA 5GXGB 1YN4A 1YJJA 2TSSA 2B76B 2YEPB 1K50A 1XO3A 2BS2B 2LHDA 1J7AA 2AQ2B 4USAA 3Q8EA 2G9HD 3BYTB 3GS2A 5EE0A 2V3NA 2WXHA 1FM0D 3Q69A 4L1BA 3FAHA 2QEJC 5TSSA 3B2GA 3P1MA 3BYYB 3WCQA 2JWUA 3BVMA 4N58A 2NTTA 1NENB 2IDYA 2V0GA 1ZE3D 4C80A 1GAQB 1STEA 2JU6X 3CWIA 3Q8FA 2FBWB 2JXTA 3ZGZA 2CU3A 3KLSX 1PGXA 3DWMA 2XN9C 4WH4A 3KWVA 4KGSA 3B9JA 1I4PA 3TEXA 1PGBA 2WXKA 5C3JB 5EE1A 1IGDA 3I9V1 3BK1A 3EA6A 1YQ3B 1TS4A 2N7JA 5E6JA 4OVZA 1CJEA 3ZJTA 3E56A 3CIRB 1E7PB 2PMVA 4US9A 4YSXB 4A55A 1ZUD2 3AEDB 1SE2A 1SJED 3LYYA 2WS3B 1WGKA 3ETRA 5EE3A 2JZPA 4LLGM 2G1EA 4YTNB 1TS3A 5BMGA 2K9XA 2K5PA 1MHHE 3EUB2 1KTKA 1D6EC 1XCQL 1YMHE 2KN4A 4OHJA 2M0AA 1SBBB 5FKAC 1OQQA 5G5HA 3BIID 4XDCA 2N0SB 3ZYYX 1C79A 3T3OA 4WQMA 2ZW1A 1UGJA 2J53A 1JRPA 1VZ6A 2KQ4X 5D3DA 2HDEA 4KKJA 2EELA 1N61A 2JYTA 1NI3A 4OZBA 2ACZB 4ARCA 1QQRA 4JWUC 2H88B 2AQ3B 3AMZA 1KF6B 2YEPF 1F77A 4KX6B 1C9FA 5AUKA 2J42A 4GDKB 2BB5A 3FC4A 3NRZA 4JWSC 3NVVA 1IBXA 2QILA 2PVGC 3U4EG 2IJ0A 2N9LA 4YSZB 3R2IA 1XLPA 1ET6A 2KMMA 4O1NA 4WWMA 2MJEA 1FD6A 3AE6B 1WSPA 2R61A 3SEBA 1QLBB 2PTLA 1I7HA 1F2RI 2L1AA 1KRHA 2OHFA 3GB1A 2BBCA 1ENFA 1HA5A 2SEBD 1L5PA 1EWYC 3BK2A 1MVKA 2INPE 3Q8BA 3P4QB 3NVWA 4HKZE 2FE8A 2NTSA 2WXIA 2RDGA 4WIPA 1QOBA 1XF5L 2ICIA 5HG2A 1ESFA 3W9CB 1VZ8A 1TY2A 2L52A 2X38A 2WXQA 5BYSA 4JX1C 1DGJA 1ZP0B 3U7ZA 1SEBD 2OEDA 2PLPA 2WQYB 1JW9D 1MHXA 5BYQA 3RPFC 1NYRA 3IT4B 2WDRB 1TKEA 4DXGA 3Q8CA 1SXTA 2WDQB 2QJLA 1FCCC 3VRAB 1TKYA 1L6VA 1D5MC 3NVYA 4OZAA 4HKQA 1JQ4A 3AEEB 1WWTA 1JWMD 3W1SA 2WXMA 3HRDD 1DOXA 2WXOA 4XWWA 1UUPA 1DOYA 4RH6A 1PFDA 4TQ1A 2Y3AA 5G5GA 4KKIA 3AE4B 3EGRA 1SE4A 3AECB 2FUG1 3BVZA 1RYJA 1J7CA 2LJIA 2ZW0A 1L4ZB 2W3RA 2LHEA 1HEZE 1JROA 2AX5A 1WYGA 3KQ4A 4N6EB 4HEA1 3IAM1 4OW0A 2WNMA 3W5VB 1RM6C 3FILB 1IUEA 1PYWD 3VR9B 3V3XA 1DYQA 1PGAA 4XE0A 4MT5A 3GP7A 2K0PA 3O13A 1I4QA 3MC0B 3TEZA 1WRIA 2V3PA 2RPVA 4ZHPA 1TS2A 4TSSA 1C4AA 3R2TA 5MPOA 1AN8A 2RDHA 4M0WA 2DBYA 2SAKA 4KGRA 1D5ZC 2PVOD 4IOIE 4MH8A 4RNAA 5AUIA 3AM9A 3Q8AA 4NAWB 4C7ZA 1E10A 1J7BA 1MI0A 2LFIA 1L0XB 1JCKB 2IGDA 1JALA 1GT8A 3T3NA 4REZA 2W54A 1GTHA 1L4DB 1YJIA 3AEGB 1XEEA 4NJCA 3U52E 2L32A 1JWAD 4PT5A 1I4XA 1B1ZA 4OZCA 2WU2B 4ZRPA 1NEKB 1SIJA 1FXAA 1N63A 1N5WA 4WAFA 1FCLA 1XCTL 1Q10A 1V1OA 3L4PA 1ROEA 1QILA 1T6BX 3H8HA 5JXVA 4Q2JA 2WDVB 1XLNA 2MEKA 3AB5A 1QF6A 1PDXA 2INNE 2GB1A 2VZKD 1EM7A 4N59A 2QSDA 3AE3B 4C56C 5FR3A 4JE3B 1NYQA 4NAMA 1HQRD 1QOFA 1N60A 3NUHB 4NZLB 2WU5B 2QIEB 1VZ7A 2V4IB 1P7FA 2H89B 2J4XA 2NMQA 3HUIA 4HJGE 1BXTA 1UWMA 2KWDA 4TMAB 1K53A 3V05A 1BMLC 1MPEA 1QT9A 2KACA 5C2TB 1FFVA 2M56B 2W55A 1FNVA 2ON8A 1HZ5A 3BVGA 4H2AA 4ITKA 1YN5A 1PUTA 4YXDB 3LXFA 1QOGA 2M19A 2PIAA 1JWSD 4B0MA 2IGGA 1HZ6A 4C7YA 3AEAB 2LEKA 4ARIA 1KH0A 1I4GA 3RFZB 1TJEA 5T8IA 4FXCA 4DXFA 1FEHA 1GB1A 2RMMA 1GOZA 2PW9A 4KGTA 2Y5CA 3IAS1 5BYRA 4A90A 1KLGD 3I57A 3UI3A 2EKIA 4LK0M 1KLUD 1FFUA 1SJHD 3PZ8A 4IKGA 1HXYD 1VR9A 4XWTA 1Y56A 1C4CA 3DWGC 3MFGA 2DYOA 4YTPB 4R3DA 3KWLA 2JYEA 4MM3B 1GB4A 3SR6A 2DWQA 4MACA 4XDDA 2PKOA 5HI1A 3IXSA 4TQ0A 1V97A 1F0ZA 1FNUA 1OFFA 4CQNA 5BMIA 4J3OD 1DOIA 1M4VA 2WXFA 3ABVB 3AV8A 1JMLA 1F2RC 2W3SA 1D5XC 2VZKB 2LUMA 3AE5B 1XLOA 1C77A 2KDMA 1H7WA 1JWUD 3NS1A 4WURA 3TSSA 1VRAB 1FRRA 1T5XD 1TYGB 2WXRA 2BTEA 3MHZA 3NZ3A 2Z8LA 4RGMA 1UWXA 2LGIA 4RGNA 4LTUA 2DLBA 1YNTE 1AYFA 1RWSA 3P42A 3P4PB 3CF4A 5EE9A 4P16A 1B9RA 4ZOHC 1ZPSA 1I4RA 1V1PB 3BWUD 1ZXHA 4IDIA 4ZRQA 4A8XC 1NVID 4RGOS 1TY0A 3W2DA 3NVZA 1H7XA 2I2YA 5D7GA 2N9KA 1KFYB 4ZYSA 4B0EA 3VR8B 1L0VB 4L2YA 4RGTA 4GLSC 2JSVX 1VJKA 1FNWA 5H8YE 1BUIC 3E9SA 1ACCA 3VQIA 1L0YB 1YN3A 2D5GA 3AH7A 1TZOA 1EU4A 1EWCA 1EU3A 2BYTA 3AE8B 1CZPA 1SE3A 1JWBD 1P7EA 3AE1B 3PO0A 5BMHA 2BS3B 4YSYB 1RFKA 2MJDA 2I38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXF A;  3P1M A;  1QOG A;  2JX5 A;  1FXI A;  2M19 A;  2WQY B;  3AEF B;  1JW9 D;  4HRS A;  4N58 A;  3WCQ A;  2PIA A;  3RPF C;  1NYR A;  1WXQ A;  4C7Y A;  2WDR B;  1NEN B;  1TKE A;  3AEA B;  2LEK A;  4C80 A;  1GAQ B;  3CWI A;  1ZOY B;  2WDQ B;  2FBW B;  3AE9 B;  1VDV A;  3VRA B;  1L6U A;  1TKG A;  2CU3 A;  1TJE A;  1TKY A;  1L6V A;  4A9A A;  3NVY A;  4FXC A;  1JQ4 A;  3AEE B;  3P4R B;  1WWT A;  1XLQ A;  2E3T A;  3DWM A;  2Y5C A;  3HRD D;  1DOX A;  1DOY A;  1PFD A;  3B9J A;  2L83 A;  5EE1 A;  5C3J B;  5G5G A;  1YQ3 B;  3AE4 B;  2EKI A;  1E6E B;  3AEC B;  3W5U B;  1YQ4 B;  3VRB B;  1J7C A;  1FFU A;  1RYJ A;  2Q5W D;  1CJE A;  2W3R A;  3CIR B;  1E7P B;  2JQR B;  3FAH A;  4US9 A;  1JRO A;  2AX5 A;  1WYG A;  3DWG C;  4N6E B;  3SFD B;  4YSX B;  3AE2 B;  4YTP B;  3W5V B;  3KWL A;  1FO4 A;  3AEB B;  1ZUD 2;  3AED B;  1RM6 C;  2DWQ A;  3SR6 A;  1IUE A;  3VR9 B;  1QOA A;  2WS3 B;  2PKO A;  4HRO A;  1WGK A;  3ETR A;  1V97 A;  1F0Z A;  1OFF A;  1WRI A;  4ZHP A;  5EE3 A;  1FIQ A;  1DOI A;  3ABV B;  3AV8 A;  2G1E A;  4YTN B;  1FMA D;  1AWD A;  2K9X A;  2K5P A;  3P4S B;  2W3S A;  2HTM E;  3EUB 2;  1VLB A;  1E0Z A;  5MPO A;  3AE5 B;  1XLO A;  2DBY A;  1H7W A;  3NS1 A;  3LB8 C;  2PVO D;  2WP9 B;  1FRR A;  3P63 A;  5AUI A;  1OQQ A;  5G5H A;  3BII D;  1TYG B;  1R7S A;  2N0S B;  3AM9 A;  3ZYY X;  4WQM A;  4C7Z A;  1E10 A;  1J7B A;  1JRP A;  4P6V F;  3B2F A;  4US8 A;  1JAL A;  1ZXI A;  1GT8 A;  1N61 A;  4LTU A;  2W54 A;  1GTH A;  1AYF A;  1NI3 A;  1RWS A;  1FRD A;  1YJI A;  3AEG B;  3P4P B;  3CF4 A;  1JWA D;  5EE9 A;  1B9R A;  2ACZ B;  4ZOH C;  1GPX A;  4JWU C;  2H88 B;  2WU2 B;  1N5X A;  4ZHO A;  3SFE B;  3AMZ A;  1SB3 C;  1V8C A;  1KF6 B;  1NEK B;  1SIJ A;  4KX6 B;  4IDI A;  5AUK A;  2MJ3 A;  1FXA A;  1NVI D;  2WLB A;  1N63 A;  1N5W A;  3FC4 A;  3AN1 A;  3NRZ A;  3NVV A;  4JWS C;  2PVG C;  4YT0 B;  3NVZ A;  1H7X A;  1A70 A;  3L4P A;  4YSZ B;  1ROE A;  2K22 A;  1XLP A;  2BS4 B;  1KFY B;  2KMM A;  3VR8 B;  1L0V B;  2MJE A;  2WDV B;  3AE6 B;  1XLN A;  2KAJ A;  3AB5 A;  4WWM A;  1QF6 A;  1PDX A;  1VJK A;  1T3Q A;  2CJN A;  2CJO A;  5H8Y E;  4N59 A;  1QLB B;  1I7H A;  3AE3 B;  1NYQ A;  1QOF A;  3HVZ A;  1E9M A;  1N60 A;  1KRH A;  2BT6 A;  2QJL A;  1SF0 A;  1GTE A;  2OHF A;  3AH7 A;  1OQR A;  5H92 C;  2MH7 A;  2WU5 B;  3AE7 B;  4YTM B;  1L5P A;  1EWY C;  1N62 A;  2QIE B;  5GXG B;  3P4Q B;  2H89 B;  3NVW A;  1YJJ A;  3HUI A;  2B76 B;  1UWM A;  1QOB A;  3AE8 B;  1CZP A;  1XO3 A;  3W9C B;  2BS2 B;  4USA A;  1J7A A;  1QT9 A;  5C2T B;  1FFV A;  1JWB D;  3AE1 B;  2L52 A;  3PO0 A;  2BS3 B;  2M56 B;  2W55 A;  4JX1 C;  1DGJ A;  5EE0 A;  1ZP0 B;  1FM0 D;  4ITK A;  4YSY B;  1RFK A;  2MJD A;  1PUT A;  4YXD B;  3B2G A; 
#chains in the Genus database with same CATH topology
 1WZ0 A;  4EE2 A;  1CK1 A;  1C76 A;  3EFC A;  4MEL A;  1TKG A;  4M02 A;  1TT5 B;  3JYU A;  4BFR A;  2KTF A;  2RPQ A;  3TEW A;  3UIO B;  4MEM A;  4ICV A;  1SIF A;  3DBH I;  3MC8 A;  2K3U A;  2J7Q B;  4AJW A;  4HRO A;  2CHW A;  2WXG A;  1FIQ A;  3RZF A;  2DEN B;  3VAW A;  1TZ1 A;  2V9H A;  2J52 A;  3KUD B;  3L08 A;  3R8B A;  3PZ7 A;  2QMT A;  4W9K A;  2DYM A;  4LNK A;  1AW7 A;  4II3 B;  2IO0 B;  4YWG G;  5IOI A;  4JPS A;  3TUO A;  2AEH A;  3PT2 B;  1LFD A;  2D07 B;  3N1Y C;  4KZ0 A;  4W9L A;  2GRI A;  2NPT B;  1UNS A;  1FRD A;  4N9F 4;  1LO5 D;  1ZGU B;  2KXJ A;  2N9E B;  2K25 A;  2LVO A;  2BB6 A;  4ZHO A;  4LJO B;  4RF1 A;  3ZTC A;  1WR6 E;  2KHW B;  1WYW B;  2KAJ A;  3ZNZ B;  2LVP A;  1SSN A;  2N7E A;  1T3Q A;  2GI9 A;  4IC7 B;  2L8J A;  3A9J B;  3C8Y A;  3L0W B;  1GTE A;  2LWP A;  4A3O A;  3IT6 B;  4YTM B;  1V5T A;  2UU7 A;  1WMH A;  3L16 A;  2TSS A;  1T0R C;  2B76 B;  2JUO A;  1WXV A;  5D2M B;  2LGD A;  4W9C A;  2PE6 B;  2WXH A;  3ZNH B;  2LRU A;  4KSK C;  2M4N A;  2QEJ C;  1ZW7 A;  2KFJ A;  4N58 A;  1STE A;  3RT3 B;  2GOW A;  2HJ1 A;  3KLS X;  3B9J A;  1FPY A;  1I4P A;  3BK1 A;  3EA6 A;  3WAP A;  3ZJT A;  1L7Y A;  3EEC A;  2GBR A;  2KX3 A;  4EOY A;  4A55 A;  3AED B;  1S1Q B;  3LYY A;  4AUQ C;  1WGK A;  3N32 A;  1U4A A;  2JZP A;  2G1E A;  4YTN B;  5BMG A;  5LXI B;  1KTK A;  3ONS A;  4KIK B;  1YMH E;  2KN4 A;  2ZNV C;  4IW0 A;  4B95 A;  2M0A A;  1SBB B;  2WX1 A;  1VZ6 A;  2IND C;  1V5O A;  4ANW A;  4W9G A;  2L0T A;  3PTF C;  5CHV C;  2VH2 A;  2FID A;  1WM2 A;  4F1S A;  4G0N B;  1QQR A;  2QDF A;  2H88 B;  3TMP B;  4NJ6 A;  2Z0E B;  5AUK A;  2MBQ A;  4GDK B;  2BB5 A;  3NRZ A;  3NVV A;  2QIL A;  5HKH A;  5AZH A;  2JZZ A;  1WJN A;  1ET6 A;  3PLV A;  4NY0 A;  3AE6 B;  2R61 A;  3SEB A;  4E71 A;  1R4M I;  4OVV A;  2FCS A;  1HA5 A;  1L5P A;  1MVK A;  3Q8B A;  3NVW A;  2FE8 A;  5FR6 A;  4P1B C;  1QOB A;  2ICI A;  3W9C B;  4EKU A;  2WX0 A;  2GLS A;  2L52 A;  2KJH B;  1DGJ A;  3RCZ A;  3U7Z A;  3HHM A;  4K3B A;  1MHX A;  3ZRC A;  3DBL B;  3SD5 A;  4I6N B;  3IT4 B;  1TKE A;  1FCC C;  5TR5 A;  1EF5 A;  2WXM A;  1E5W A;  3HRD D;  2WXO A;  3QHT A;  2KDE B;  3VH4 B;  2KTR A;  1PFD A;  2Y3A A;  3AE4 B;  3N20 C;  1RYJ A;  4WJP A;  5JH5 C;  3Q3M C;  4N6E B;  1WYG A;  3L10 B;  2ZVO A;  3QAQ A;  1RM6 C;  3FIL B;  3H6N A;  1IUE A;  3V3X A;  1DYQ A;  4BKS A;  4LDT B;  4MT5 A;  2BF8 B;  1I4Q A;  2V3P A;  3V62 A;  4ZHP A;  5L95 C;  1UEL A;  3Q14 C;  2FAZ A;  3R2T A;  1AN8 A;  2LD9 A;  4M0W A;  2SAK A;  2EMS A;  2V4L A;  2PVO D;  5AUI A;  3RNE C;  3WA0 A;  1E10 A;  4G11 A;  2VH1 A;  5BO4 B;  4BAX A;  3CSF A;  1YJI A;  2L32 A;  1B1Z A;  2D10 A;  2A4Z A;  2YVC A;  1N5W A;  1WGD A;  1XCT L;  1V1O A;  1WXA A;  4GDK A;  1XLN A;  2KAN A;  2GB1 A;  3X0W A;  3AE3 B;  4JE3 B;  1NYQ A;  1HQR D;  1WXS A;  2BGF A;  2BWF A;  2QIE B;  1P7F A;  3HUI A;  1UWM A;  3V05 A;  3ZVV A;  3VFK A;  3ZNI D;  2G3Q B;  4H2A A;  4ITK A;  2MHJ A;  4XX5 A;  3L54 A;  2ZCC A;  4B0M A;  1TJE A;  4WAA A;  5T8I A;  3QWZ B;  4FXC A;  1C3T A;  4LNI A;  1GB1 A;  4FAD A;  4LK0 M;  4TUU A;  1KLU D;  5D94 A;  3NJT A;  2JWZ A;  4GMV A;  2HD5 B;  4YTP B;  4R3D A;  3KWL A;  4IM2 A;  1IPG A;  4XDD A;  2PKO A;  2KC1 A;  4GB9 A;  4TQ0 A;  1E8X A;  4J3O D;  1DOI A;  2WXF A;  3ABV B;  1D5X C;  2V1Y A;  1H7W A;  1YD8 U;  1VRA B;  1FRR A;  3RUL A;  2KK8 A;  2DAF A;  2BTE A;  3WAN A;  3O65 B;  3H9D A;  4ZRJ A;  1YNT E;  4GXB A;  1N6Z A;  1E7U A;  5EDS A;  2D2Q A;  2AL3 A;  1NVI D;  4RGO S;  5IN7 A;  2L7R A;  5D7G A;  4XYC A;  3VR8 B;  4L2Y A;  2JSV X;  2NBW B;  3VQI A;  1YN3 A;  2XEW A;  3AH7 A;  3ECI A;  5IKC M;  5L83 A;  3DBS A;  1T0S C;  3QQ8 B;  2VRR B;  4CO7 A;  1P7E A;  3V6E B;  1CMX B;  4YSY B;  1RFK A;  2MJD A;  5E6N A;  4GSW A;  4TKN A;  1D4B A;  3AEF B;  3ML8 A;  1C78 A;  3W1S C;  1ZOY B;  1L6U A;  1V9J A;  4ANX A;  2GBN A;  2IYD B;  4A9A A;  3TEY A;  3N30 A;  1XLQ A;  4OVU A;  4BOS C;  4BZA A;  3S2A A;  4FA6 A;  2L83 A;  5D3I B;  1E6E B;  3VRB B;  4K7W A;  4EFO A;  1LM8 B;  2CU1 A;  5HFY A;  1K52 A;  3IHP C;  3SFD B;  3H1U A;  2WDT B;  1ZDV A;  1QOA A;  4L23 A;  3K9O B;  3SHQ A;  3ZJU A;  1YIW A;  4HCP B;  2G45 B;  1SE9 A;  1FMA D;  2C7N B;  2WXN A;  3WIM A;  1AWD A;  3P4S B;  1GC6 A;  1VLB A;  4DDG D;  2LGY A;  4PS7 A;  2BW2 A;  5I4D A;  2W82 A;  2WXL A;  3P63 A;  3DCG A;  2OOB B;  1H4R A;  1C1Y B;  4AQ7 A;  3U2S C;  3B2F A;  4US8 A;  2D11 A;  2MBE A;  1F52 A;  4D2K A;  1UD7 A;  3ZDT A;  2YLM A;  3A9K A;  1IGC A;  3GE3 C;  2KC2 A;  2BVC A;  5CHF A;  3SU8 X;  1SB3 C;  1IYF A;  1OEY J;  2Y5P A;  3ZJV A;  2J0M A;  4DBG A;  3VTW A;  3VUY A;  4DHJ B;  2CJN A;  2CJO A;  2WXJ A;  1Q1O A;  2GBK A;  2LMC A;  1EO6 A;  1SF0 A;  2RSU A;  1CQV A;  2O2V B;  2MH7 A;  4KSL C;  1ZDX A;  3QX1 A;  1YN4 A;  4ZRI A;  1YJJ A;  1OTR B;  3DVG X;  1WGR A;  2YEP B;  1K50 A;  2IZV B;  4JQW C;  1XO3 A;  1I42 A;  2AQ2 B;  3PRP B;  3VTV A;  2CKH B;  3ZXV A;  1GC7 A;  3BYT B;  5EE0 A;  1NDD A;  5TSS A;  1TIF A;  3WCQ A;  3NY5 A;  2MLB A;  3BVM A;  2O6V B;  4JGH B;  2OJW A;  1NEN B;  4IG7 B;  1T0Q C;  1GAQ B;  3CWI A;  3QJZ A;  2XN9 C;  3T8M A;  3KWV A;  4XGA B;  2WXK A;  3KH0 A;  2HJ8 A;  2KQ7 A;  1WX7 A;  5E6J A;  2JRI B;  4OVZ A;  3E56 A;  2CR5 A;  4US9 A;  3U8Z A;  2NBV B;  2G4S A;  3OJ3 A;  3Q6B A;  4LLG M;  4BBN C;  1WGY A;  1E90 A;  1TS3 A;  4NJ7 A;  2K9X A;  2KQS A;  5AZF A;  1MHH E;  1XCQ L;  2N9P C;  2KKC A;  2N1V A;  4OHJ A;  2GBJ A;  3BII D;  2N0S B;  1C79 A;  4WQM A;  2LJ5 A;  1UGJ A;  2J53 A;  5D3D A;  5J17 A;  2HDE A;  4KKJ A;  1JRU A;  1WI0 A;  2RR9 A;  2PEA A;  2NR2 A;  4JWU C;  2AQ3 B;  3AMZ A;  1KF6 B;  1F77 A;  4ZDV A;  3FC4 A;  2K39 A;  3U4E G;  1XLP A;  1FXT B;  4WWM A;  1FD6 A;  1WSP A;  1P3Q U;  1V2Y A;  2DZM A;  1WH3 A;  1QLB B;  3ZLZ A;  1I7H A;  3OLM D;  4M8N A;  1KRH A;  4WJO A;  1ENF A;  4LCD E;  4IWO A;  1YJ1 A;  3R66 C;  2QCZ A;  4HKZ E;  4DWF A;  2WXI A;  2RDG A;  1XF5 L;  2O2V A;  1VZ8 A;  2IO3 B;  2K6D B;  3ALB A;  4LNF A;  5KHQ A;  3IBE A;  5BYS A;  1SEB D;  4KZC A;  2PLP A;  2M1M A;  2Z0D B;  2HTH A;  1M94 A;  2DHZ A;  3RI7 C;  2WDQ B;  1TKY A;  2G4D B;  3AEE B;  1F1H A;  4W9H A;  3WAL A;  1UUP A;  3BVZ A;  5DCN A;  3X23 A;  2ZEQ A;  1LGR A;  2BQQ A;  3IAM 1;  2WNM A;  4XE0 A;  2K0P A;  1ISN A;  4BKT A;  2GBM A;  3PV1 A;  1E8Y A;  4F7Z A;  1C4A A;  2DBY A;  2KVZ A;  1D5Z C;  4A20 A;  3Q8A A;  4NAW B;  4YL8 A;  1UH6 A;  1JCK B;  4REZ A;  3A4S C;  3DBR I;  4PK1 A;  2W54 A;  1GTH A;  1XEE A;  4PT5 A;  1JWA D;  4OZC A;  1NI2 A;  5J18 A;  4AP4 C;  1EF1 A;  1N63 A;  2JT4 B;  2KWC A;  4S17 A;  3L17 A;  2C7H A;  3Q3F A;  1Q10 A;  3L4P A;  4AJY B;  1H8C A;  3H8H A;  5JXV A;  2FNJ B;  3AB5 A;  3OJ4 B;  2BYV E;  2KYW A;  1EM7 A;  2KJR A;  4FBJ B;  3PSE B;  5JZE B;  2N4F A;  3I3T B;  2KFK B;  4C4V B;  4PS3 A;  3HM6 X;  4FUL A;  3R7Q A;  1BXT A;  2NPT A;  2KWD A;  1J0G A;  4HJK A;  2L05 A;  2LGS A;  1BML C;  1MPE A;  1QT9 A;  2KAC A;  4IUM B;  4XC2 A;  3HIZ A;  1HZ5 A;  3PS6 A;  3BVG A;  5C23 A;  1WJ6 A;  1PUT A;  1WZ3 A;  2M19 A;  4C7Y A;  4ARI A;  4DXA B;  3RFZ B;  2R2Q A;  2RMM A;  1GOZ A;  2FIF A;  1R4M B;  5BYR A;  3A9J A;  3I57 A;  2X8X X;  3UI3 A;  2EKI A;  1MFW A;  1FFU A;  3PZ8 A;  5DPS A;  1HXY D;  2BYE A;  1C4C A;  1LXD A;  3TIX A;  2DYO A;  4S0R A;  1Z5S B;  2JYE A;  3ZDM C;  1TGZ B;  4KDL B;  4MM3 B;  3SR6 A;  2DWQ A;  1GB4 A;  2KT7 A;  3GZN I;  3T9L A;  4I6L B;  4CQN A;  5BMI A;  2KNB A;  4II2 B;  1KOT A;  4BKG A;  2KWU B;  3AV8 A;  3IG3 A;  4FLH A;  4LJP B;  3UIN B;  2ZPN A;  1WX9 A;  3AE5 B;  1XLO A;  4F8C B;  2KDM A;  3DBL I;  3NS1 A;  1MG8 A;  3ZIM A;  3GOE A;  3MHZ A;  5C1Z A;  4XZ4 A;  2A5U A;  4LTU A;  4NAW A;  1AYF A;  1RWS A;  3P42 A;  3TJP A;  3P4P B;  3PGE A;  5EE9 A;  4M00 A;  1V1P B;  1WY8 A;  4ZRQ A;  2JVC A;  1HTO A;  3AU4 A;  1WXM A;  3W2D A;  2KZR A;  3PPA A;  2N9K A;  4KIK A;  4ZYS A;  4B0E A;  1J19 A;  4RGT A;  4IM0 A;  2EMT A;  1VJK A;  1FNW A;  2KDI A;  3E9S A;  4X57 B;  2DAJ A;  2I1K A;  2D5G A;  1VCB A;  3M3J A;  2CS4 A;  1BT0 A;  1HE8 A;  1RLF A;  2DZJ A;  3MJW A;  3ZNG C;  3AE8 B;  1J8C A;  3VTU A;  1JWB D;  3IFW B;  1P98 A;  4B6W A;  1WJ4 A;  2K1F A;  3OG5 A;  2I38 A;  2JX5 A;  2XNA C;  4HRS A;  3BZD B;  1UBQ A;  2FCQ A;  3AE9 B;  1Z2M A;  1VDV A;  4QAY A;  2BYF A;  2XK5 B;  4JLC A;  4GDL B;  1LQB A;  2K8C A;  2NVU I;  4DHJ D;  3DOW A;  3W5U B;  1YQ4 B;  2Q5W D;  4GGQ A;  1WIA A;  3EHV A;  2JQR B;  3UQA A;  2E6X A;  4A6Q A;  4DQO C;  4WWN A;  3AE2 B;  2L0F A;  3AEB B;  2KOX A;  2L00 B;  1P9D U;  2MP2 B;  4GN1 A;  3DVN U;  1TS5 A;  1L2N A;  1RFA A;  3J9C A;  2ASQ A;  5IO9 A;  1OQY A;  2WYQ A;  1QKZ A;  1F9J A;  3MJ5 A;  1KM7 A;  3OWE B;  4W9F A;  2HTM E;  2O6V D;  1E0Z A;  4RCO A;  4PYZ A;  3H7P B;  3LB8 C;  4MGY E;  2ONQ A;  1R7S A;  4RFB A;  3A1Q B;  4P6V F;  3RNA C;  2REX A;  3PRE A;  4JL9 A;  1A5R A;  4J6I A;  3D32 A;  3FIL A;  3M62 B;  1N5X A;  3SFE B;  3JVZ X;  1V8C A;  1UZX B;  2D3B A;  3AN1 A;  3QC8 B;  4YT0 B;  1V1P A;  3N9Y C;  4FJV B;  1OGW A;  1GPX A;  1OEY A;  4EZJ A;  2IO1 B;  2JZ3 B;  2BT6 A;  2LRW A;  3DVG Y;  5H92 C;  1OQR A;  1N62 A;  4UDU C;  5GXG B;  2FUH B;  4USA A;  2LHD A;  1J7A A;  3QAR A;  1GG3 A;  2D3C A;  3C19 A;  3GS2 A;  2V3N A;  1FM0 D;  2M17 A;  3KYC D;  4L1B A;  1ZKH A;  3FAH A;  3NOB A;  3BYY B;  2JWU A;  3ZW3 A;  2D3A A;  3CF6 E;  4C80 A;  2JU6 X;  3VXW A;  4IWP A;  2FBW B;  3VDZ A;  4DHZ E;  1G6J A;  4FHK A;  1K8R B;  4WH4 A;  4ANU A;  3PLU A;  2D3G A;  4GIV A;  1D3Z A;  5EE1 A;  5C3J B;  1YQ3 B;  2GMI C;  1TS4 A;  3DHG C;  1UBI A;  3CIR B;  1E7P B;  3Q2A C;  2KX0 A;  4YSX B;  1VD2 A;  4ANV A;  4K3C A;  1MJD A;  1XQQ A;  3H7S A;  3ETR A;  2QHO A;  5AZG A;  2WWZ A;  3EUB 2;  3VH3 B;  1D6E C;  2PPH A;  4HPP A;  3DQV A;  1R4N B;  1V49 A;  5DPW A;  4XDC A;  3ZYY X;  4AWJ A;  4CHK A;  1JRP A;  5DPR A;  1PQS A;  2EEL A;  1N61 A;  1E8W A;  1NI3 A;  5CX3 A;  1RAX A;  4OZB A;  3VUW A;  1WGG A;  2ACZ B;  1Y8R C;  2K6Q A;  2YEP F;  4NNJ B;  2W9N A;  1Q0W B;  2N9L A;  3HK0 A;  1TBE A;  4O1N A;  2MJE A;  5E6P A;  2LAS A;  1KJT A;  1F2R I;  2L1A A;  5GMV A;  2OHF A;  3GB1 A;  2BBC A;  2XBB C;  3BK2 A;  1TTN A;  2KWV B;  3RNG C;  3U7D A;  4AOF A;  5HG2 A;  4M01 A;  3JW0 X;  2WXQ A;  3ZO5 B;  2OED A;  2WHI A;  4WJN A;  1JW9 D;  3RNC C;  3NS8 A;  2R2O A;  1SXT A;  3ZXR A;  4B9K A;  3VRA B;  1L6V A;  2RGF A;  3V6C B;  1D5M C;  4HLE A;  1JQ4 A;  1JWM D;  4RH6 A;  1MG4 A;  4E3C A;  5G5G A;  4KKI A;  2FUG 1;  1J7C A;  2LJI A;  2ZW0 A;  1SGH A;  4TV3 A;  1L4Z B;  2W3R A;  2BWE S;  1HEZ E;  3KQ4 A;  5G2N A;  4OW0 A;  3AU5 A;  3W5V B;  4BOZ B;  3PZD A;  1PYW D;  3VR9 B;  4DK5 A;  1WF9 A;  3O13 A;  3TEZ A;  4HVB A;  1WRI A;  5CTR C;  1TS2 A;  4P1C C;  3EC8 A;  2L76 A;  3APF A;  4TSS A;  3MHS D;  3PHW B;  5MPO A;  3WAM A;  2RDH A;  2ZNV B;  4MH0 E;  4ASW C;  3JSV B;  2UWQ A;  4KV2 A;  3B1L X;  4C7Z A;  1J7B A;  1MI0 A;  1WMH B;  2DZK A;  2IGD A;  1JAL A;  2LXC A;  1WFY A;  4K7U A;  1L4D B;  1AAR A;  2DYB A;  5LXH A;  4WWO A;  1I4X A;  4ZRP A;  4K1R B;  1NEK B;  1SIJ A;  1FXA A;  4WAF A;  2ZVN A;  1ROE A;  1QIL A;  4Q2J A;  1PDX A;  1WE6 A;  3BIN A;  4C56 C;  3DBH B;  4FJY A;  1QOF A;  4ACF A;  3NUH B;  2WU5 B;  2MSE D;  2J4X A;  5G55 A;  4CYE A;  4GOC A;  1K53 A;  3LDZ E;  5C2T B;  2M56 B;  2W55 A;  3NZU A;  1FNV A;  2IY0 B;  2ON8 A;  4K81 A;  4LDT D;  5IP4 D;  3Q3O C;  2PIA A;  1JWS D;  4FN2 A;  2IGG A;  3AEA B;  2LEK A;  3PVL A;  1FEH A;  4KGT A;  2BKR B;  2Y5C A;  2MWS B;  2ZPY A;  2RD0 A;  4A90 A;  2MBB B;  4ZYN A;  1SJH D;  4PYU A;  1UF0 A;  1VR9 A;  1X1M A;  1Y56 A;  3DWG C;  1YX6 B;  2Z59 B;  1YOV B;  1V81 A;  4MAC A;  3WAO A;  5E6O A;  3IXS A;  1V97 A;  2KDF B;  1F0Z A;  2WGS A;  2O6V A;  3ZKJ C;  3VUX A;  2M0X A;  1M4V A;  1F2R C;  3CMM B;  2K8B A;  2KLC A;  2VZK B;  2LGX A;  2LUM A;  1C77 A;  1JWU D;  1T5X D;  3RNF C;  4RM8 A;  4WWP A;  2WXR A;  3IVF A;  2Z8L A;  3AXC A;  1UWX A;  3JSV A;  2LGI A;  4RGN A;  4EUT A;  2MCN B;  1RRB A;  2JF5 A;  2DLB A;  1T0Y A;  3AI5 A;  3CF4 A;  4P16 A;  1B9R A;  2IY1 B;  3BWU D;  1ZXH A;  3A4R A;  2ZZP B;  1TY0 A;  3ZTD A;  3A33 B;  3NVZ A;  2LVQ A;  3ENE A;  1KFY B;  3AUL A;  1UGM A;  3GE8 C;  4GLS C;  1WJU A;  3V60 A;  1ACC A;  2JY6 A;  1L0Y B;  2KTR B;  2LI5 A;  1EU4 A;  1EWC A;  3DBR B;  3DVN V;  2CHZ A;  2K8H A;  1CZP A;  5KHO A;  1SE3 A;  3AE1 B;  1E8Z A;  3PO0 A;  2BS3 B;  3HM3 A;  1I35 A;  3TBL D;  1YQB A;  3APD A;  2KN5 A;  1FXI A;  4NQL B;  3M63 B;  2MW5 A;  4HPL B;  2WXP A;  1WXQ A;  5FK9 C;  2C5L C;  5J2R A;  1V6E A;  2J0J A;  2BPS A;  4KDI C;  3URY A;  2IPK D;  4M0W B;  3P4R B;  2E3T A;  1XT9 B;  2AQ1 B;  3HVD A;  3N1Z C;  2LUE A;  1QZE A;  1ET9 A;  1K51 A;  3QK0 A;  1WX8 A;  4HPM B;  1XXG A;  2RDB C;  1FO4 A;  2KD0 A;  2KJ6 A;  2IGH A;  4EEW A;  5LNK 1;  4HXD A;  4MGZ E;  5DPT A;  4RF0 A;  3RYT A;  4W9E A;  3KW5 B;  4W9J A;  2WP9 B;  2KVR A;  1E7V A;  1C4P A;  4AS1 A;  1ZXI A;  2NCN A;  4ICU A;  4MGK E;  3VHT C;  3GZN B;  5HHD G;  4HK2 A;  1IBX B;  1I4H A;  3ZQ4 A;  1WGH A;  2MJ3 A;  3UIP B;  2WLB A;  3VVW B;  2MX2 A;  3OAW A;  1A70 A;  2K22 A;  2BS4 B;  3NZS A;  5IAA C;  4ZRK A;  2N1W A;  3HVZ A;  1E9M A;  2INC C;  3MP9 A;  3AE7 B;  2NBU A;  1NBF C;  2MA9 B;  3KUC B;  2BS2 B;  2LZ6 A;  2DX5 B;  3Q8E A;  2G9H D;  4FJZ A;  3NHE B;  3Q69 A;  4W9D A;  3PRZ A;  3B2G A;  3P1M A;  2IO2 B;  2NTT A;  2IDY A;  2V0G A;  1ZE3 D;  3Q8F A;  4IWQ A;  2JXT A;  3ZGZ A;  2CU3 A;  1PGX A;  3RMK C;  3DWM A;  2Y5B B;  4GU2 A;  2FCN A;  4KGS A;  1XD3 B;  4DHZ B;  3TEX A;  1PGB A;  1IGD A;  3I9V 1;  2KFK A;  4C4V A;  4G3X B;  2N7J A;  4DDI D;  1CJE A;  2PMV A;  1WR1 A;  1GNU A;  2PJH A;  4MSQ B;  2AL6 A;  1GJZ A;  1ZUD 2;  1SE2 A;  1SJE D;  2WS3 B;  3U30 A;  4KVG B;  5EE3 A;  1YX5 B;  4I6P A;  2C7M B;  2K5P A;  2EKE C;  3RUI B;  3CST A;  3N1X C;  2QC8 A;  5FKA C;  1OQQ A;  3I63 C;  3T3O A;  3L13 A;  2ZW1 A;  2KQ4 X;  4FHJ A;  4HCN B;  3MTN B;  1KLV A;  2JYT A;  3N3K B;  4MM3 A;  4LNO A;  4ARC A;  2KO3 A;  1C9F A;  4KX6 B;  2J42 A;  3ML9 A;  4JWS C;  1IBX A;  2PVG C;  2IJ0 A;  2PE9 A;  4YSZ B;  3R2I A;  2ZCB A;  2KMM A;  2KLG A;  2PTL A;  2C60 A;  3P2B A;  3PHX B;  2SEB D;  1EWY C;  2INP E;  3P4Q B;  1V86 A;  4BBN F;  3TCA A;  2NTS A;  1WE7 A;  4WIP A;  4BVU C;  2DNF A;  1ESF A;  2M8S A;  4MJS B;  4NPN A;  3EFU A;  3Q3J A;  4URK A;  1TY2 A;  2X38 A;  4JX1 C;  1ZP0 B;  1P0R A;  2I1J A;  2LXA A;  3QA8 A;  2WQY B;  2JPH A;  5BYQ A;  3RPF C;  1NYR A;  1S3S G;  2WDR B;  4DXG A;  1P1A A;  3Q8C A;  2QJL A;  3V61 A;  3NVY A;  4OZA A;  4HKQ A;  1WWT A;  3W1S A;  1DOX A;  4XWW A;  1DOY A;  2AYO B;  1GUA B;  4G50 A;  4TQ1 A;  4M8M A;  3SDL C;  3K9P B;  3EGR A;  1SE4 A;  3AEC B;  4EZK A;  2LHE A;  3QCA A;  1JRO A;  2AX5 A;  3LJ3 A;  4HEA 1;  3C0R B;  2MBH A;  2KMC A;  3A9K B;  1PGA A;  2MBO A;  1Q5W B;  3GP7 A;  3MC0 B;  2RPV A;  4EZL A;  3W1Y A;  3I5J C;  2MQJ A;  5LLI A;  4WJQ A;  2NS5 A;  2XK5 A;  4GDL A;  4KGR A;  4IOI E;  5JHA A;  4MH8 A;  4RNA A;  3AM9 A;  4A3P A;  3DHH C;  2LFI A;  1L0X B;  1GT8 A;  3DPD A;  3T3N A;  1HTQ A;  5AEK B;  4WQO B;  3B08 A;  3AEG B;  4NJC A;  3U52 E;  3ZUN A;  2MP2 A;  2WU2 B;  2B3A A;  3UQB A;  2C9W B;  1FCL A;  2CHX A;  1IP9 A;  1T6B X;  3H7P A;  2WDV B;  2MEK A;  1QF6 A;  2N7D A;  2INN E;  2VZK D;  4N59 A;  4W9I A;  2QSD A;  5FR3 A;  4C00 A;  4NAM A;  1N60 A;  5JHB A;  2AWT A;  4NZL B;  3A1Q A;  3KVF B;  3QIJ A;  1VZ7 A;  2V4I B;  2H89 B;  2NMQ A;  1R4N I;  4HJG E;  3KUZ A;  4PS8 A;  4TMA B;  2IBI B;  2L3Z A;  1FFV A;  3M95 A;  4RM9 A;  5D6J B;  4MJS A;  2BKF A;  1YN5 A;  4YXD B;  3LXF A;  1QOG A;  2JXX A;  1HZ6 A;  2ZJD A;  3KYD D;  1KH0 A;  1I4G A;  4JIO U;  4DXF A;  2PW9 A;  3RN9 C;  3IAS 1;  3R3M A;  1KLG D;  4MDK E;  4HDO A;  4IKG A;  2OJR A;  2V3S A;  4XWT A;  3UF8 A;  3FKY A;  5IA7 A;  3MFG A;  2FCM A;  4E74 A;  5HI1 A;  1FNU A;  1OFF A;  2KDB A;  4LNN A;  4RMA A;  4BKS D;  1JML A;  3Q3N C;  3DHI C;  2W3S A;  4HWI B;  4WUR A;  3TSS A;  1WM3 A;  3PRM B;  3BY4 B;  1TYG B;  4K7S A;  3R7R A;  3NZ3 A;  4RGM A;  3RNB C;  2UYZ B;  4MGI E;  3MC9 A;  3UGB B;  1V80 A;  4HDQ A;  1WRD B;  4ZOH C;  1ZPS A;  2J0K A;  1I4R A;  5CHW A;  4IDI A;  4MSM B;  4A8X C;  1EUV B;  2I2Y A;  1H7X A;  2HE7 A;  1L0V B;  2JRH A;  4NQK E;  5H8Y E;  1BUI C;  4P7I A;  3RZW C;  2MRP A;  3ZRF A;  3B0A A;  3APC A;  2KMA A;  2DZI A;  1TZO A;  3TL5 A;  4IM3 A;  1EU3 A;  2BYT A;  3NG0 A;  5BMH A;  2N9X A;  3DDC B;  3RD2 A;  5G5H A; 
#chains in the Genus database with same CATH homology
 2JX5 A;  1FXI A;  2XNA C;  4HRS A;  3AEF B;  4EE2 A;  1D4B A;  1CK1 A;  3BZD B;  1C76 A;  2WXP A;  1WXQ A;  5FK9 C;  1C78 A;  1ZOY B;  3AE9 B;  1VDV A;  1L6U A;  3URY A;  1TKG A;  4A9A A;  3TEY A;  2IPK D;  3P4R B;  1XLQ A;  2E3T A;  4GDL B;  2AQ1 B;  2L83 A;  3HVD A;  3TEW A;  5D3I B;  1E6E B;  3W5U B;  1YQ4 B;  3VRB B;  1ET9 A;  1K51 A;  2Q5W D;  2JQR B;  5HFY A;  1K52 A;  2E6X A;  4A6Q A;  4DQO C;  3SFD B;  3AE2 B;  1XXG A;  2K3U A;  1FO4 A;  3AEB B;  1ZDV A;  1QOA A;  1TS5 A;  4L23 A;  2IGH A;  4HRO A;  5LNK 1;  3J9C A;  3ZJU A;  2WXG A;  1FIQ A;  1QKZ A;  1FMA D;  2J52 A;  2WXN A;  3MJ5 A;  4RF0 A;  1AWD A;  3OWE B;  3P4S B;  2HTM E;  1VLB A;  1E0Z A;  4RCO A;  3R8B A;  2BW2 A;  3LB8 C;  3PZ7 A;  5I4D A;  2W82 A;  2WXL A;  2QMT A;  2WP9 B;  2DYM A;  3P63 A;  1AW7 A;  2ONQ A;  1R7S A;  4YWG G;  4JPS A;  1C4P A;  4RFB A;  3TUO A;  4AQ7 A;  4AS1 A;  4P6V F;  3U2S C;  3B2F A;  4US8 A;  1ZXI A;  2GRI A;  1UNS A;  1FRD A;  4D2K A;  1LO5 D;  3FIL A;  1IGC A;  5HHD G;  1IBX B;  1I4H A;  2BB6 A;  1N5X A;  4ZHO A;  3SFE B;  3ZQ4 A;  1SB3 C;  1V8C A;  2MJ3 A;  2WLB A;  3AN1 A;  2Y5P A;  4RF1 A;  4YT0 B;  1V1P A;  1A70 A;  3ZJV A;  2K22 A;  2BS4 B;  3N9Y C;  1GPX A;  2KAJ A;  1SSN A;  2CJN A;  1T3Q A;  2CJO A;  2WXJ A;  2GI9 A;  2LMC A;  1E9M A;  2BT6 A;  3HVZ A;  3C8Y A;  1SF0 A;  1GTE A;  3MP9 A;  5H92 C;  1CQV A;  1OQR A;  3IT6 B;  2MH7 A;  1N62 A;  3AE7 B;  4YTM B;  4UDU C;  1ZDX A;  5GXG B;  1YN4 A;  1YJJ A;  2TSS A;  2B76 B;  2YEP B;  1K50 A;  1XO3 A;  2BS2 B;  2LHD A;  1J7A A;  2AQ2 B;  4USA A;  3Q8E A;  2G9H D;  3BYT B;  3GS2 A;  5EE0 A;  2V3N A;  2WXH A;  1FM0 D;  3Q69 A;  4L1B A;  3FAH A;  2QEJ C;  5TSS A;  3B2G A;  3P1M A;  3BYY B;  3WCQ A;  2JWU A;  3BVM A;  4N58 A;  2NTT A;  1NEN B;  2IDY A;  2V0G A;  1ZE3 D;  4C80 A;  1GAQ B;  1STE A;  2JU6 X;  3CWI A;  3Q8F A;  2FBW B;  2JXT A;  3ZGZ A;  2CU3 A;  3KLS X;  1PGX A;  3DWM A;  2XN9 C;  4WH4 A;  3KWV A;  4KGS A;  3B9J A;  1I4P A;  3TEX A;  1PGB A;  2WXK A;  5C3J B;  5EE1 A;  1IGD A;  3I9V 1;  3BK1 A;  3EA6 A;  1YQ3 B;  1TS4 A;  2N7J A;  5E6J A;  4OVZ A;  1CJE A;  3ZJT A;  3E56 A;  3CIR B;  1E7P B;  2PMV A;  4US9 A;  4YSX B;  4A55 A;  1ZUD 2;  3AED B;  1SE2 A;  1SJE D;  3LYY A;  2WS3 B;  1WGK A;  3ETR A;  5EE3 A;  2JZP A;  4LLG M;  2G1E A;  4YTN B;  1TS3 A;  5BMG A;  2K9X A;  2K5P A;  1MHH E;  3EUB 2;  1KTK A;  1D6E C;  1XCQ L;  1YMH E;  2KN4 A;  4OHJ A;  2M0A A;  1SBB B;  5FKA C;  1OQQ A;  5G5H A;  3BII D;  4XDC A;  2N0S B;  3ZYY X;  1C79 A;  3T3O A;  4WQM A;  2ZW1 A;  1UGJ A;  2J53 A;  1JRP A;  1VZ6 A;  2KQ4 X;  5D3D A;  2HDE A;  4KKJ A;  2EEL A;  1N61 A;  2JYT A;  1NI3 A;  4OZB A;  2ACZ B;  4ARC A;  1QQR A;  4JWU C;  2H88 B;  2AQ3 B;  3AMZ A;  1KF6 B;  2YEP F;  1F77 A;  4KX6 B;  1C9F A;  5AUK A;  2J42 A;  4GDK B;  2BB5 A;  3FC4 A;  3NRZ A;  4JWS C;  3NVV A;  1IBX A;  2QIL A;  2PVG C;  3U4E G;  2IJ0 A;  2N9L A;  4YSZ B;  3R2I A;  1XLP A;  1ET6 A;  2KMM A;  4O1N A;  4WWM A;  2MJE A;  1FD6 A;  3AE6 B;  1WSP A;  2R61 A;  3SEB A;  1QLB B;  2PTL A;  1I7H A;  1F2R I;  2L1A A;  1KRH A;  2OHF A;  3GB1 A;  2BBC A;  1ENF A;  1HA5 A;  2SEB D;  1L5P A;  1EWY C;  3BK2 A;  1MVK A;  2INP E;  3Q8B A;  3P4Q B;  3NVW A;  4HKZ E;  2FE8 A;  2NTS A;  2WXI A;  2RDG A;  4WIP A;  1QOB A;  1XF5 L;  2ICI A;  5HG2 A;  1ESF A;  3W9C B;  1VZ8 A;  1TY2 A;  2L52 A;  2X38 A;  2WXQ A;  5BYS A;  4JX1 C;  1DGJ A;  1ZP0 B;  3U7Z A;  1SEB D;  2OED A;  2PLP A;  2WQY B;  1JW9 D;  1MHX A;  5BYQ A;  3RPF C;  1NYR A;  3IT4 B;  2WDR B;  1TKE A;  4DXG A;  3Q8C A;  1SXT A;  2WDQ B;  2QJL A;  1FCC C;  3VRA B;  1TKY A;  1L6V A;  1D5M C;  3NVY A;  4OZA A;  4HKQ A;  1JQ4 A;  3AEE B;  1WWT A;  1JWM D;  3W1S A;  2WXM A;  3HRD D;  1DOX A;  2WXO A;  4XWW A;  1UUP A;  1DOY A;  4RH6 A;  1PFD A;  4TQ1 A;  2Y3A A;  5G5G A;  4KKI A;  3AE4 B;  3EGR A;  1SE4 A;  3AEC B;  2FUG 1;  3BVZ A;  1RYJ A;  1J7C A;  2LJI A;  2ZW0 A;  1L4Z B;  2W3R A;  2LHE A;  1HEZ E;  1JRO A;  2AX5 A;  1WYG A;  3KQ4 A;  4N6E B;  4HEA 1;  3IAM 1;  4OW0 A;  2WNM A;  3W5V B;  1RM6 C;  3FIL B;  1IUE A;  1PYW D;  3VR9 B;  3V3X A;  1DYQ A;  1PGA A;  4XE0 A;  4MT5 A;  3GP7 A;  2K0P A;  3O13 A;  1I4Q A;  3MC0 B;  3TEZ A;  1WRI A;  2V3P A;  2RPV A;  4ZHP A;  1TS2 A;  4TSS A;  1C4A A;  3R2T A;  5MPO A;  1AN8 A;  2RDH A;  4M0W A;  2DBY A;  2SAK A;  4KGR A;  1D5Z C;  2PVO D;  4IOI E;  4MH8 A;  4RNA A;  5AUI A;  3AM9 A;  3Q8A A;  4NAW B;  4C7Z A;  1E10 A;  1J7B A;  1MI0 A;  2LFI A;  1L0X B;  1JCK B;  2IGD A;  1JAL A;  1GT8 A;  3T3N A;  4REZ A;  2W54 A;  1GTH A;  1L4D B;  1YJI A;  3AEG B;  1XEE A;  4NJC A;  3U52 E;  2L32 A;  1JWA D;  4PT5 A;  1I4X A;  1B1Z A;  4OZC A;  2WU2 B;  4ZRP A;  1NEK B;  1SIJ A;  1FXA A;  1N63 A;  1N5W A;  4WAF A;  1FCL A;  1XCT L;  1Q10 A;  1V1O A;  3L4P A;  1ROE A;  1QIL A;  1T6B X;  3H8H A;  5JXV A;  4Q2J A;  2WDV B;  1XLN A;  2MEK A;  3AB5 A;  1QF6 A;  1PDX A;  2INN E;  2GB1 A;  2VZK D;  1EM7 A;  4N59 A;  2QSD A;  3AE3 B;  4C56 C;  5FR3 A;  4JE3 B;  1NYQ A;  4NAM A;  1HQR D;  1QOF A;  1N60 A;  3NUH B;  4NZL B;  2WU5 B;  2QIE B;  1VZ7 A;  2V4I B;  1P7F A;  2H89 B;  2J4X A;  2NMQ A;  3HUI A;  4HJG E;  1BXT A;  1UWM A;  2KWD A;  4TMA B;  1K53 A;  3V05 A;  1BML C;  1MPE A;  1QT9 A;  2KAC A;  5C2T B;  1FFV A;  2M56 B;  2W55 A;  1FNV A;  2ON8 A;  1HZ5 A;  3BVG A;  4H2A A;  4ITK A;  1YN5 A;  1PUT A;  4YXD B;  3LXF A;  1QOG A;  2M19 A;  2PIA A;  1JWS D;  4B0M A;  2IGG A;  1HZ6 A;  4C7Y A;  3AEA B;  2LEK A;  4ARI A;  1KH0 A;  1I4G A;  3RFZ B;  1TJE A;  5T8I A;  4FXC A;  4DXF A;  1FEH A;  1GB1 A;  2RMM A;  1GOZ A;  2PW9 A;  4KGT A;  2Y5C A;  3IAS 1;  5BYR A;  4A90 A;  1KLG D;  3I57 A;  3UI3 A;  2EKI A;  4LK0 M;  1KLU D;  1FFU A;  1SJH D;  3PZ8 A;  4IKG A;  1HXY D;  1VR9 A;  4XWT A;  1Y56 A;  1C4C A;  3DWG C;  3MFG A;  2DYO A;  4YTP B;  4R3D A;  3KWL A;  2JYE A;  4MM3 B;  1GB4 A;  3SR6 A;  2DWQ A;  4MAC A;  4XDD A;  2PKO A;  5HI1 A;  3IXS A;  4TQ0 A;  1V97 A;  1F0Z A;  1FNU A;  1OFF A;  4CQN A;  5BMI A;  4J3O D;  1DOI A;  1M4V A;  2WXF A;  3ABV B;  3AV8 A;  1JML A;  1F2R C;  2W3S A;  1D5X C;  2VZK B;  2LUM A;  3AE5 B;  1XLO A;  1C77 A;  2KDM A;  1H7W A;  1JWU D;  3NS1 A;  4WUR A;  3TSS A;  1VRA B;  1FRR A;  1T5X D;  1TYG B;  2WXR A;  2BTE A;  3MHZ A;  3NZ3 A;  2Z8L A;  4RGM A;  1UWX A;  2LGI A;  4RGN A;  4LTU A;  2DLB A;  1YNT E;  1AYF A;  1RWS A;  3P42 A;  3P4P B;  3CF4 A;  5EE9 A;  4P16 A;  1B9R A;  4ZOH C;  1ZPS A;  1I4R A;  1V1P B;  3BWU D;  1ZXH A;  4IDI A;  4ZRQ A;  4A8X C;  1NVI D;  4RGO S;  1TY0 A;  3W2D A;  3NVZ A;  1H7X A;  2I2Y A;  5D7G A;  2N9K A;  1KFY B;  4ZYS A;  4B0E A;  3VR8 B;  1L0V B;  4L2Y A;  4RGT A;  4GLS C;  2JSV X;  1VJK A;  1FNW A;  5H8Y E;  1BUI C;  3E9S A;  1ACC A;  3VQI A;  1L0Y B;  1YN3 A;  2D5G A;  3AH7 A;  1TZO A;  1EU4 A;  1EWC A;  1EU3 A;  2BYT A;  3AE8 B;  1CZP A;  1SE3 A;  1JWB D;  1P7E A;  3AE1 B;  3PO0 A;  5BMH A;  2BS3 B;  4YSY B;  1RFK A;  2MJD A;  2I38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...