2ACZB

Complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
pubmed doi rcsb
molecule keywords Succinate dehydrogenase flavoprotein subunit
source organism Escherichia coli
molecule tags Oxidoreductase/electron transport
total genus 58
structure length 238
sequence length 238
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2aczB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2aczB01
2E3TA 3W5VB 4ZHPA 1E9MA 1DGJA 1E10A 1JRPA 1ZOYB 2W55A 2H88B 1PFDA 5G5GA 1VJKA 5GXGB 3BIID 1FMAD 1RM6C 1UWMA 2G1EA 1IUEA 2M56B 3NVZA 1CJEA 2BT6A 4JX1C 3AE4B 1L6UA 2PVOD 1CZPA 4WWMA 1FFVA 3NVWA 3P1MA 3W5UB 2BS2B 3B2GA 3VRAB 1ROEA 3RPFC 4C7ZA 3AEGB 1DOYA 3SR6A 1N60A 4C80A 2QJLA 3P4QB 1FIQA 2M19A 3AE7B 5G5HA 1TJEA 3P4PB 1WRIA 3AV8A 4FXCA 2WDQB 2MJ3A 2N0SB 3NS1A 3NVYA 2AX5A 2DBYA 5H8YE 4JWUC 4HRSA 2WP9B 1RFKA 3FAHA 1TKGA 5AUIA 1V97A 3NRZA 1B9RA 2PVGC 1VDVA 3AE2B 4KX6B 1FO4A 1FXIA 4YTMB 3AE1B 1YJIA 2WU2B 2QIEB 1WWTA 1AYFA 1TYGB 2WLBA 3DWMA 3P4RB 4ZHOA 1QF6A 4P6VF 1NENB 1XLNA 3WCQA 3VR8B 1V8CA 1OQRA 3DWGC 3KWLA 1N63A 3HUIA 1YQ4B 4N58A 1J7CA 1H7XA 3AE8B 1FFUA 1N5WA 4WQMA 1QOBA 1EWYC 3CIRB 3W9CB 2PIAA 2WQYB 1J7BA 1T3QA 4IDIA 5EE1A 2W3SA 1YQ3B 1WXQA 2K5PA 2KMMA 1SF0A 1L0VB 1QT9A 3LB8C 1AWDA 1GAQB 1PDXA 1GTEA 1SIJA 1ZUD2 1A70A 3L4PA 2KAJA 3AH7A 2LEKA 5EE3A 3PO0A 3AEAB 4YT0B 1FM0D 4US9A 2CJNA 1NVID 1E0ZA 1DOIA 3CWIA 4ITKA 1OQQA 2EKIA 1DOXA 1ZXIA 1XLQA 3SFEB 2W54A 3AE5B 2K22A 2WDRB 3AEFB 1JW9D 4N59A 1FXAA 2BS3B 2OHFA 1L6VA 5C3JB 4ZOHC 3HVZA 3AECB 2B76B 2CU3A 3AB5A 4YTPB 1TKEA 1YJJA 4C7YA 1JQ4A 5H92C 1GT8A 1E6EB 2FBWB 2ACZB 4YSYB 1JWBD 1L5PA 1PUTA 4YSZB 2L83A 3VR9B 4LTUA 3AMZA 3ABVB 3AEBB 3AE3B 1N61A 1TKYA 2JX5A 2K9XA 1FRRA 2L52A 1GPXA 1NI3A 3P4SB 5C2TB 1SB3C 1XLOA 1XO3A 2WS3B 2MH7A 4US8A 1FRDA 1KF6B 4N6EB 4A9AA 3ZYYX 3AN1A 2HTME 3AEEB 4HROA 3CF4A 3B2FA 3AEDB 3HRDD 4USAA 1JROA 1E7PB 4YXDB 1WGKA 5AUKA 3VRBB 2CJOA 1I7HA 3LXFA 2WU5B 1NYRA 3FC4A 1KRHA 1RWSA 2JQRB 1H7WA 1GTHA 4YTNB 3P63A 2MJEA 3ETRA 3EUB2 2MJDA 3B9JA 1RYJA 1QOGA 1WYGA 1VLBA 1OFFA 3AM9A 4YSXB 2PKOA 2Y5CA 1N62A 2DWQA 2W3RA 3SFDB 3AE9B 2Q5WD 1QOAA 2WDVB 2H89B 3NVVA 1JWAD 4JWSC 5EE0A 1ZP0B 1KFYB 5EE9A 1NEKB 1R7SA 5MPOA 1QOFA 1J7AA 1NYQA 1QLBB 1N5XA 3AE6B 1JALA 1F0ZA 2BS4B 1XLPA
chains in the Genus database with same CATH superfamily
5IKCM 1FEHA 1DGJA 1XXGA 1UWMA 2N1VA 4B0MA 1F77A 4ICVA 2LRUA 2LVQA 4GDKA 3BYYB 3NJTA 4KVGB 1E8XA 3U8ZA 4W9EA 2MJ3A 4GU2A 4B95A 4JWUC 2N9KA 3QWZB 1HZ5A 3NRZA 2K25A 3DPDA 1FO4A 3MJWA 1P3QU 1F0ZA 1AYFA 5I4DA 1WXMA 1V49A 5JXVA 2WHIA 3QAQA 1FFUA 3IHPC 1WJUA 1GC6A 5LNK1 5EE1A 2W3SA 1KLVA 3L0WB 1WR6E 3NOBA 2JPHA 1YN3A 2C7HA 3KH0A 3VTWA 2KO3A 2J0JA 1OQQA 2C5LC 2PPHA 2NMQA 4WJQA 2IYDB 5C3JB 3HVZA 3NHEB 4K7UA 1JQ4A 2FIFA 1LGRA 5DCNA 3PV1A 2FBWB 3EFCA 1ZDVA 3V61A 1N61A 2RDGA 1MFWA 4GSWA 1WGRA 4W9LA 5G2NA 1M94A 3AN1A 4IM0A 2UWQA 1WI0A 1WGKA 2PLPA 4GB9A 1UGMA 2ICIA 4BBNF 4TQ1A 3J9CA 1K51A 3Q8EA 2KANA 1I4RA 3RT3B 2IO0B 1QZEA 1D4BA 4M8NA 3B08A 3EA6A 3Q3NC 1IYFA 4PYUA 4RMAA 4KSKC 4NAMA 3BIID 2KVRA 2WX1A 3AE4B 1RAXA 5J17A 2K8HA 4M02A 3APFA 3X0WA 2L0FA 4MGIE 4F1SA 1D5MC 1T5XD 3HVDA 1TS2A 2EMSA 2FUG1 2LHDA 3ZTDA 4ZHOA 1HEZE 3GZNI 3BK1A 4X57B 1NENB 3WCQA 4PS8A 2I2YA 2ASQA 2LUMA 1UH6A 4K7WA 5LLIA 3RCZA 1KLUD 1CMXB 2KMMA 5BMGA 1IBXA 2RD0A 3KYDD 2FCMA 2CJNA 4LNFA 3BYTB 2JZZA 4B0EA 2G9HD 2LJ5A 2LFIA 4MSQB 1V80A 3QK0A 2MBQA 1YJJA 3QIJA 3BZDB 2WXQA 1PUTA 2N7JA 3SHQA 4LTUA 5D2MB 3VR9B 3AMZA 1EU4A 2KTRA 2KLGA 4FLHA 3VUWA 3X23A 1WH3A 1XCTL 3QA8A 3B2FA 4OZBA 2ON8A 3ZXVA 1P98A 4BKTA 1F2RC 2K6QA 3JSVB 3ZRCA 4HJGE 3RNBC 3FC4A 2J52A 4EZLA 1GTHA 1K52A 3D32A 1SJED 4DWFA 1VLBA 2M4NA 4GXBA 2Z59B 2FIDA 2PKOA 1N62A 1T0YA 1FNVA 4WJPA 4XC2A 2E3TA 2KJHB 2QCZA 3SU8X 1D6EC 3SD5A 4ZYNA 2XN9C 3VFKA 4N9F4 3VUYA 3RUIB 1DOYA 1WF9A 1JWSD 4URKA 1V81A 3CF6E 2G3QB 3P4QB 3I5JC 4PS7A 2KQ7A 1J8CA 5H8YE 2WP9B 2G45B 1TKGA 2HJ8A 2V4IB 2JWZA 4ZYSA 3N1ZC 1NDDA 1UD7A 2WXGA 1VRAB 2LD9A 2WXOA 1E8WA 1F1HA 4MH8A 3ZRFA 1J7CA 3A9KA 1L7YA 1V1OA 2GBNA 2MSED 4XWTA 2J0KA 3O13A 3M95A 2D2QA 4US9A 4W9FA 1KM7A 2JWUA 4DBGA 1OGWA 3RNAC 4TMAB 2LGIA 3V6CB 3VTVA 2QILA 1JWBD 1L5PA 3PZDA 2KACA 1WMHB 3ABVB 2CHWA 5CHFA 4GOCA 4DHZE 1WE6A 3W2DA 4LCDE 2SAKA 5CTRC 1YX6B 4C00A 2INNE 5DPWA 1MG4A 2KQ4X 3DBRB 1S1QB 1QOGA 2V3SA 2KFJA 2KTFA 1AARA 4UDUC 5MPOA 2O2VB 3NUHB 2HDEA 3L10B 2GBJA 2L1AA 3LJ3A 2E6XA 2M1MA 4ZRKA 2H88B 2LXAA 1I4PA 3T3NA 2J42A 2OJRA 3DBLI 1SE4A 2Y3AA 4M0WA 4HCPB 1JMLA 1I4GA 3P4PB 2NBWB 1ZW7A 2PEAA 3R7QA 4A6QA 4A55A 1RFKA 2LZ6A 4HKQA 3A9JA 1GJZA 2D3BA 4BVUC 4K3BA 4AQ7A 4RM9A 1J0GA 4LJOB 2I1JA 2PIAA 4XYCA 3WALA 2BWFA 2WXKA 3C19A 1SF0A 4E3CA 2AEHA 3LB8C 2A4ZA 1PDXA 2JZPA 2C7NB 5BYSA 2LEKA 4EKUA 4CQNA 2KFKB 1WXVA 4PYZA 1ZPSA 5LXHA 2W54A 3KQ4A 4ZRPA 1MG8A 4WJOA 2BS3B 2IY0B 2KFKA 5BYQA 3EC8A 5BMHA 1KOTA 2DZKA 3PRMB 5IO9A 4AJWA 2KWCA 2OJWA 4E71A 1C77A 3L13A 1OEYA 2ONQA 1E7PB 3FKYA 3DHIC 3TEWA 5TSSA 2MJEA 3M63B 3IT6B 3ZDMC 3HM6X 2WYQA 1J19A 1C4AA 3RFZB 3AI5A 4RF1A 5HKHA 1NYQA 2WXNA 2N9EB 4HDQA 4RNAA 4MM3A 1LXDA 1ZOYB 4OVZA 3QX1A 5G5GA 1P7EA 2BQQA 2BWES 4HPPA 1MPEA 3RNEC 1VZ6A 3KUCB 1I35A 3P1MA 3PHWB 3N3KB 4P7IA 2L05A 3TIXA 5E6PA 4I6PA 2L00B 3DQVA 2D10A 3RN9C 3N32A 2WX0A 4B9KA 1FCCC 1LO5D 1Z5SB 1TS5A 2BW2A 3Q69A 3L17A 1L4ZB 4BKGA 2KD0A 3S2AA 4LNOA 4AS1A 2MWSB 1OQYA 1OEYJ 1YMHE 2L3ZA 4MJSB 2EKEC 2DNFA 4EZKA 5IA7A 4WH4A 2D07B 2KX0A 1PGXA 4NAWB 4DHJB 1AWDA 1GTEA 1JCKB 3ZIMA 2KMCA 2BB6A 2KMAA 1ZGUB 2KJRA 1E0ZA 4ITKA 2INCC 2EKIA 2RDHA 1SE9A 3R2IA 3PSEB 1EM7A 1GT8A 4YSYB 2IO1B 1T6BX 3V3XA 3ZTCA 4OZAA 3PVLA 2PJHA 3DHHC 2K1FA 4WAAA 4DXAB 3HRDD 1ISNA 3L16A 3U30A 5T8IA 4JL9A 3K9OB 4EUTA 2GBKA 3EUB2 3DBSA 3UF8A 3AM9A 4LNKA 2BYTA 4MGKE 3VH4B 3T3OA 3EGRA 4F8CB 4QAYA 3PRZA 1R4NI 3LYYA 2K0PA 2KKCA 3ZNHB 4AJYB 4G50A 2QC8A 2RR9A 3GE3C 3PZ8A 3VAWA 1S3SG 2BB5A 2I1KA 2M19A 5G5HA 3H7PA 3RMKC 1PGBA 4FXCA 3B1LX 5BYRA 2FNJB 4WJNA 4GDKB 2KVZA 2NBVB 3FAHA 5AUIA 2NTSA 4S0RA 5JHAA 1FXIA 2IDYA 5JH5C 2KC1A 3VR8B 1AN8A 3KWLA 2L7RA 3HUIA 4LDTD 2CS4A 3V60A 3VQIA 3DBHI 1KLGD 2YVCA 3GZNB 4FJZA 1YQ3B 2KDFB 4MSMB 4KDLB 4LJPB 1GAQB 2IJ0A 1ZKHA 2O6VD 1WSPA 1ZXIA 2MBBB 4W9GA 3H1UA 4LK0M 2XNAC 3ZNID 1X1MA 4NPNA 1TKEA 4FBJB 4YSZB 1TKYA 3E56A 4JIOU 3UI3A 4W9HA 1FRDA 3RD2A 4NQLB 2LJIA 2HTME 1GB1A 5AUKA 1UF0A 4FN2A 2AQ2B 2HD5B 2C9WB 4II3B 2N1WA 3DVGY 3IAM1 3V6EB 2V0GA 1WYGA 4L23A 4TV3A 1QQRA 4MELA 3ECIA 4XDDA 3SFDB 3VDZA 3AE9B 2BYVE 1R7SA 3ZKJC 3RYTA 4WWNA 5GXGB 1VJKA 3U2SC 3W1SA 4KDIC 2G1EA 5AZGA 2KXJA 4HEA1 2M8SA 1L6UA 1UWXA 2FAZA 4P16A 4WWMA 2R2QA 3AEGB 3OJ4B 1UBIA 1T0RC 3OJ3A 1ET9A 3ZXRA 3I9V1 3AE1B 4DDGD 1ZE3D 2BYEA 4W9DA 2VZKD 3M3JA 3FILA 1WJ6A 1H7XA 3AE8B 3A1QA 1N5WA 5L95C 4JPSA 5AEKB 2LWPA 4K81A 1EF1A 4ANUA 4GIVA 3UQBA 2ZW1A 3ALBA 2DYOA 2O6VA 1FD6A 3AH7A 4IM3A 3AEAB 2GLSA 4WQOB 1F52A 1XLQA 2LRWA 2GRIA 3AEFB 1WR1A 2J4XA 2IGHA 1XF5L 3EFUA 1IBXB 1L6VA 2WGSA 1Q10A 2C60A 4R3DA 4ZRQA 2HJ1A 1WGYA 4P1BC 2BPSA 1YN5A 2ACZB 3RI7C 2GI9A 3AE3B 2JX5A 2L52A 4XE0A 2NS5A 3BVMA 2DHZA 2MH7A 4MGZE 4ZRJA 1MHHE 4RH6A 4EE2A 3EECA 5CX3A 1SIFA 3VUXA 2KTRB 3LXFA 1SE3A 1E8YA 4RFBA 4DK5A 2JXXA 1DYQA 3OWEB 1V86A 5L83A 1PGAA 1D5XC 2ZCCA 1LM8B 1QOAA 5J2RA 1H4RA 1NEKB 4C4VA 2N4FA 1JALA 1JRUA 3A4SC 2Y5PA 3AU5A 2M56B 2OEDA 2PTLA 2LVPA 1TBEA 1CZPA 3Q6BA 1FFVA 4XGAB 2BS2B 2FE8A 2LUEA 2D3GA 4C80A 3H6NA 3APCA 2D3CA 2MRPA 3BINA 3DBLB 1OTRB 2KWDA 2ZNVB 5D94A 4EOYA 1ZXHA 1VDVA 3AE2B 4O1NA 4AWJA 4MEMA 2KX3A 4P6VF 1MI0A 1OQRA 3GB1A 2GMIC 2LASA 3RZFA 2Y5BB 5C1ZA 3ENEA 1WXQA 1L0VB 3A9KB 2WXMA 3IBEA 4D2KA 2KT7A 2JSVX 3ZNGC 3ONSA 4XWWA 2PMVA 2WDRB 4PT5A 1C1YB 1V1PA 1T0SC 3PT2B 2IGGA 1I42A 2CR5A 4AP4C 1FRRA 1CQVA 4FJYA 3W1SC 2QEJC 1YJ1A 4IC7B 4LNIA 4BOSC 2X38A 4YTNB 2DX5B 4RCOA 2ZJDA 3K9PB 4FULA 2W9NA 3HK0A 2PW9A 3R8BA 2ZW0A 1E7UA 3H8HA 3URYA 1M4VA 2BS4B 4GMVA 2ZEQA 4ZHPA 4TUUA 2PE6B 1PFDA 3AULA 2WXRA 1CJEA 2FUHB 3RULA 3NVWA 3W5UB 4LNNA 5LXIB 3VRAB 1ESFA 1WE7A 1G6JA 2V3NA 3Q3OC 4A8XC 2V4LA 3IXSA 3NY5A 2AX5A 2MBEA 2V3PA 4M0WB 5FR6A 2KN5A 1ACCA 2JRIB 4HDOA 4IWPA 4ANXA 3ZVVA 3AXCA 1YQ4B 1EF5A 3A9JB 2RMMA 3U52E 3V05A 1C9FA 2WQYB 2JYEA 1T3QA 2KHWB 1HTOA 2JF5A 3TL5A 5D3IB 2AL6A 3L4PA 1KJTA 3KLSX 4NJ7A 2AYOB 2NVUI 1R4MI 2TSSA 4EEWA 1L0XB 1VD2A 1QKZA 4ZOHC 5CHWA 4RF0A 2J0MA 3Q3MC 2INPE 1WFYA 4WURA 4K3CA 1P7FA 1WY8A 1HZ6A 3HM3A 1I4XA 4KGSA 3MC8A 4HWIB 4WAFA 2IGDA 1TTNA 2XK5A 1GNUA 2RPVA 1SJHD 4BKSD 3I3TB 3KYCD 1JWAD 3ZUNA 1IP9A 1QLBB 3WAOA 4H2AA 3HHMA 3KW5B 3W5VB 4NNJB 1E10A 2ZNVC 2FCSA 2BT6A 4JX1C 1R4NB 4HLEA 4KIKA 1P0RA 4HJKA 4MM3B 2K39A 2DZJA 2N9PC 2NPTA 5FKAC 1FIQA 2DYBA 3AE7B 4DXFA 3ZJTA 2ZPNA 1GOZA 2N0SB 3NVYA 4EFOA 2KYWA 2KDMA 2RPQA 3TEXA 3NZSA 2WXHA 5AZHA 3QARA 4NZLB 2WU2B 1XLNA 2LGDA 2ZVNA 1Y8RC 1Q1OA 1SXTA 3ML8A 1L2NA 3MC9A 5FK9C 3L08A 3QJZA 4DDID 1C4CA 5FR3A 1GC7A 4GDLA 4HPLB 3Q8CA 4J6IA 3DBHB 2ZVOA 4IM2A 3L54A 2WXIA 1NVID 5E6NA 4K7SA 1Q5WB 1LFDA 1B1ZA 1Y56A 3AECB 2B76B 3Q14C 3AB5A 4YTPB 3HIZA 4LLGM 4JGHB 4DXGA 2JY6A 1UGJA 5TR5A 2KDEB 3T8MA 2QSDA 1XLOA 3CSFA 4BZAA 1KF6B 4N6EB 3Q2AC 2GBRA 3PPAA 4ANVA 3GE8C 1TIFA 3U7DA 2BYFA 1PYWD 2LGXA 2HE7A 1H8CA 1H7WA 3P63A 1BT0A 3B9JA 3IAS1 4BKSA 4XX5A 2V1YA 2H89B 1VCBA 5AZFA 1KFYB 1QOFA 2KWUB 5KHQA 4OVVA 3C8YA 2R2OA 2YEPF 5EDSA 2X8XX 4AOFA 4BAXA 1FMAD 1RM6C 2MA9B 3N20C 5D6JB 4HCNB 3VH3B 1F9JA 2K8CA 5BMIA 4WIPA 4NJCA 2KN4A 3BVGA 2LI5A 4ANWA 4HRSA 3A33B 3KWVA 1QILA 4M01A 4HK2A 2GBMA 3BY4B 4OW0A 1YQBA 2WXJA 4S17A 3IVFA 3C0RB 3DOWA 3H7PB 2KDIA 1TY2A 2Z8LA 2NCNA 3JVZX 3DWGC 1IGCA 4TKNA 1HE8A 3BWUD 2KWVB 1UBQA 2G4DB 4W9IA 1SSNA 3PRPB 3DCGA 4FHJA 3TJPA 1YX5B 1SE2A 2MP2A 1DOXA 2MCNB 5IAAC 1EU3A 4N59A 4YL8A 2N7DA 2OHFA 3QHTA 1XT9B 4TSSA 3TMPB 1YNTE 3QCAA 5H92C 2IBIB 1P9DU 3AEBB 2KOXA 1WIAA 1ET6A 2PE9A 2LXCA 1D5ZC 4ARCA 4IWQA 3AEDB 3OG5A 3BVZA 1V5OA 3PLUA 2CJOA 3Q3JA 3TEZA 1KRHA 2MBOA 3GS2A 3W1YA 2JU6X 4RGMA 4ZRIA 5C23A 5J18A 1T0QC 1TGZB 4XDCA 4CHKA 3TEYA 1ZP0B 2DAFA 2J7QB 4Q2JA 3VXWA 4KZ0A 2VRRB 1AW7A 2JRHA 5D3DA 1GB4A 2M17A 2FCNA 1UNSA 3NVZA 3JW0X 3ZW3A 4ASWC 3JYUA 3B2GA 4C7ZA 3RPFC 2M0AA 5IP4D 2I38A 4MH0E 4JLCA 3VHTC 1EWCA 1C4PA 2AWTA 1FCLA 2K3UA 2IY1B 3NS8A 3DWMA 3M62B 3O65B 1QF6A 3OAWA 1TS4A 2QMTA 1TS3A 1RLFA 1C79A 4G0NB 4WQMA 5E6OA 1GG3A 3MHSD 4LDTB 1I4QA 3FILB 2C7MB 2DZIA 4MT5A 1SIJA 3A1QB 5DPSA 2K6DB 3U7ZA 4NQKE 1V5TA 3CWIA 2KLCA 4KKIA 4II2B 1E90A 1FXTB 2O6VB 4I6NB 2B3AA 4RGNA 3TBLD 4M00A 2KNBA 2N9XA 2L83A 1Z2MA 2ZPYA 3GP7A 3PS6A 1N6ZA 4L2YA 4HPMB 4RGOS 1NI3A 1XO3A 2JVCA 3AU4A 2UYZB 1WGHA 5HG2A 1BUIC 2K8BA 3UQAA 3MHZA 4USAA 4RM8A 2L0TA 3MJ5A 3GOEA 2MJDA 1F2RI 3MP9A 1KH0A 3WAMA 4YSXB 1WXAA 1K8RB 4A3PA 2MW5A 1JWUD 2EMTA 1RFAA 1YIWA 1N5XA 2Z0EB 1XLPA 2W55A 3I63C 3RNGC 2MHJA 3EHVA 2KC2A 3RZWC 4IG7B 4KKJA 1PQSA 4C4VB 2CHZA 1WXSA 5GMVA 3PLVA 5BO4B 5D7GA 1JWMD 1TJEA 1WM3A 2RSUA 1SGHA 1CK1A 4DQOC 2GOWA 4KX6B 3H9DA 4WWPA 3ZJUA 2YLMA 1WZ3A 2JYTA 1WWTA 2HTHA 3PGEA 1V8CA 2RDBC 3RNFC 2CHXA 4N58A 1FNWA 3ZGZA 1WYWB 2AQ3B 2VZKB 2JUOA 2LMCA 3QQ8B 3I57A 2MLBA 4BOZB 3PZ7A 2JZ3B 1Q0WB 1ZUD2 2BBCA 2D11A 1SBBB 2V9HA 1FNUA 4YT0B 1FM0D 2INDC 5IN7A 4F7ZA 3U4EG 2LVOA 1XQQA 2WWZA 1FXAA 3N9YC 1UZXB 2KJ6A 4W9JA 3WANA 1BMLC 1MHXA 3DDCB 3DVNU 1R4MB 4IW0A 3Q8AA 1STEA 3JSVA 1EUVB 4YWGG 3R7RA 3WA0A 3IFWB 4FA6A 1GPXA 4PK1A 1V1PB 2WS3B 2L76A 2LGYA 2WXLA 1NBFC 4IUMB 4IOIE 4P1CC 1P1AA 1NI2A 2G4SA 3WAPA 4A90A 1I7HA 1V6EA 3ZNZB 2JQRB 2BF8B 3R66C 4CYEA 1KTKA 3Q8BA 1E8ZA 2W3RA 4ZDVA 2Q5WD 2WDVB 2BKRB 4C56C 1WJNA 3R2TA 2DZMA 4CO7A 2VH2A 5HI1A 1ZDXA 1WRDB 1E9MA 2ZZPB 2Z0DB 3APDA 1IUEA 2M0XA 2IO2B 4L1BA 3TUOA 2PVOD 2D3AA 4OVUA 5KHOA 4W9CA 2AL3A 1MJDA 3MC0B 3DHGC 2W82A 2NTTA 3IG3A 3Q8FA 3KUDB 3ZO5B 4JE3B 1SEBD 2VH1A 1B9RA 3WIMA 3N30A 4YTMB 3P4RB 3CSTA 1L0YB 1N63A 2WXFA 4GN1A 2RGFA 1K50A 1QOBA 3LDZE 3CIRB 1C78A 1J7BA 2NBUA 2KQSA 2N9LA 2UU7A 2KAJA 1I4HA 5EE3A 3PO0A 4ICUA 3BK2A 3QC8B 1HA5A 1DOIA 4IKGA 4B6WA 2AQ1B 1FPYA 4FHKA 3AE5B 1WMHA 2K22A 4EZJA 3PHXB 1D3ZA 2LGSA 3NZUA 4KSLC 4BBNC 1IGDA 1E6EB 1YN4A 4IWOA 2QDFA 5JZEB 3P4SB 5HHDG 4A9AA 3AEEB 3SDLC 1MVKA 3NZ3A 1JROA 4YXDB 3KUZA 4A3OA 1LQBA 3CMMB 1VZ8A 2IO3B 2FCQA 4ARIA 1UELA 2O2VA 1C76A 4AUQC 1OFFA 2SEBD 4JQWC 2BVCA 4E74A 4FJVB 1TZOA 4XZ4A 2KK8A 2MEKA 1U4AA 3P2BA 4MACA 4WWOA 1IPGA 4MGYE 1VZ7A 1BXTA 3ZJVA 2XK5B 1WJ4A 2R61A 5JHBA 1JRPA 3V62A 3DVGX 2WXPA 3SEBA 2WDTB 4NJ6A 3DVNV 5DPTA 1N60A 1WM2A 3UINB 3PTFC 1HTQA 1WGGA 2WDQB 3NS1A 4KIKB 4J3OD 1XEEA 1V9JA 2BKFA 1XCQL 2MQJA 1V97A 2N7EA 3KVFB 2NPTB 1L4DB 3UIPB 1YJIA 1ENFA 2QIEB 1V2YA 3ML9A 1VR9A 1HQRD 4NY0A 4HKZE 2DYMA 4DHJD 3W9CB 3TSSA 4IDIA 4TQ0A 5E6JA 1WX9A 4OZCA 4ACFA 1QT9A 3ZLZA 1A70A 1E5WA 4KGRA 1WGDA 2XBBC 4I6LB 1TY0A 3MFGA 3E9SA 3SFEB 1JW9D 2EELA 4GDLB 2CU3A 3TCAA 1WX7A 2XEWA 4C7YA 3VTUA 3P42A 3ZDTA 4HXDA 2QHOA 2K9XA 2CU1A 2OOBB 3RNCC 3T9LA 2JT4B 2DLBA 2J53A 3DBRI 4HROA 4KGTA 4PS3A 4HVBA 2KDBA 1EO6A 3PREA 3VRBB 4G3XB 4BFRA 2WU5B 1XD3B 1RWSA 5HFYA 1UUPA 2L32A 3ETRA 3Q3FA 4M8MA 3UIOB 1C3TA 4W9KA 4FADA 2IPKD 4MDKE 2DWQA 2GB1A 1WZ0A 3R3MA 3NVVA 1TT5B 1J7AA 2JXTA 2MX2A 4KV2A 2ZCBA 2DAJA 2CKHB 3IT4B 1ROEA 4A20A 3SR6A 4OHJA 2QJLA 3H7SA 1A5RA 4KZCA 1WRIA 3AV8A 3NG0A 5IOIA 2DBYA 4MJSA 2PVGC 2IZVB 2WLBA 4GLSC 1TYGB 4NAWA 4RGTA 1RRBA 2L8JA 1EWYC 2KZRA 1HXYD 4K1RB 2K5PA 1YOVB 3N1XC 3B0AA 2LHEA 2DENB 1TZ1A 3N1YC 3OLMD 2WNMA 2NR2A 2MP2B 3A4RA 2YEPB 2REXA 5CHVC 1YD8U 1SB3C 5C2TB 2MBHA 4US8A 5G55A 4DHZB 3ZYYX 1E7VA 4REZA 3CF4A 4G11A 1WX8A 2BTEA 1NYRA 3VVWB 2A5UA 1RYJA 2D5GA 1GUAB 3UGBB 3ZQ4A 2Y5CA 4GGQA 5DPRA 5EE0A 4JWSC 5EE9A 2BGFA 3AE6B 1K53A 3MTNB
chains in the Genus database with same CATH topology
1FEHA 4ZHPA 1DGJA 1ZOYB 4OVZA 2W55A 1PFDA 5G5GA 1P7EA 1XXGA 1UWMA 2WXRA 4B0MA 1CJEA 1F77A 4KKJA 1MPEA 1VZ6A 3NVWA 3P1MA 3BYYB 3W5UB 3VRAB 1ESFA 2V3NA 5D7GA 4A8XC 1JWMD 3IXSA 1TJEA 1CK1A 2MJ3A 2AX5A 4JWUC 2N9KA 4DQOC 2V3PA 1HZ5A 3NRZA 1FCCC 1LO5D 2BW2A 1TS5A 4KX6B 1FO4A 3Q69A 3ZJUA 1L4ZB 2JYTA 1F0ZA 1WWTA 1AYFA 5I4DA 1ACCA 5JXVA 4AS1A 1V8CA 1YMHE 4N58A 1YQ4B 1FFUA 1FNWA 3ZGZA 2RMMA 3U52E 3V05A 5LNK1 1C9FA 2AQ3B 2WQYB 2JYEA 1T3QA 2VZKB 4WH4A 5EE1A 1PGXA 2W3SA 4NAWB 2LMCA 3I57A 3PZ7A 5D3IB 1AWDA 1ZUD2 1GTEA 1YN3A 2BBCA 3L4PA 3KLSX 1JCKB 1SBBB 1FNUA 4YT0B 1FM0D 2BB6A 1E0ZA 4ITKA 1OQQA 2TSSA 2EKIA 3U4EG 2NMQA 1L0XB 1FXAA 3N9YC 1QKZA 2RDHA 4ZOHC 5C3JB 3HVZA 1BMLC 1MHXA 3R2IA 1JQ4A 1EM7A 1GT8A 4RF0A 2FBWB 4YSYB 3Q8AA 1T6BX 3V3XA 1ZDVA 2INPE 4OZAA 4WURA 1N61A 1STEA 2RDGA 1P7FA 4YWGG 1GPXA 1V1PB 2WS3B 2WXLA 3AN1A 4IOIE 1HZ6A 3HRDD 1WGKA 4A90A 1I4XA 4KGSA 1I7HA 5T8IA 2JQRB 4WAFA 2IGDA 2PLPA 3EUB2 2ICIA 1KTKA 3AM9A 3Q8BA 2RPVA 4TQ1A 2BYTA 3T3OA 1SJHD 2W3RA 3J9CA 2Q5WD 3EGRA 2WDVB 1K51A 3Q8EA 1JWAD 4C56C 3R2TA 3LYYA 2K0PA 1I4RA 1QLBB 5HI1A 4H2AA 1ZDXA 3W5VB 1D4BA 1E10A 1E9MA 3EA6A 4NAMA 3BIID 1IUEA 2BT6A 4JX1C 3AE4B 4L1BA 3TUOA 3PZ8A 2PVOD 4MM3B 2BB5A 5FKAC 1FIQA 2M19A 3AE7B 1D5MC 3MC0B 5G5HA 1T5XD 4DXFA 3ZJTA 1PGBA 3HVDA 2W82A 4FXCA 2NTTA 1TS2A 1GOZA 2N0SB 3NVYA 5BYRA 2KDMA 3Q8FA 4GDKB 3TEXA 3FAHA 2WXHA 5AUIA 4JE3B 1SEBD 2NTSA 1B9RA 2FUG1 2LHDA 1FXIA 4YTMB 2IDYA 2WU2B 4NZLB 1HEZE 4ZHOA 3P4RB 3BK1A 1L0YB 1NENB 1XLNA 3WCQA 3VR8B 1AN8A 3KWLA 1N63A 3HUIA 2WXFA 2I2YA 1SXTA 2LUMA 1K50A 1QOBA 3VQIA 3CIRB 1C78A 5FK9C 1J7BA 1KLGD 1YQ3B 1KLUD 1C4CA 2KMMA 5FR3A 5BMGA 1GAQB 2IJ0A 2N9LA 1IBXA 2KAJA 1I4HA 3Q8CA 3PO0A 5EE3A 3BK2A 2WXIA 2CJNA 1HA5A 1NVID 1DOIA 3BYTB 1WSPA 4B0EA 4IKGA 2G9HD 1ZXIA 2AQ1B 3AE5B 2LFIA 2K22A 2XNAC 4LK0M 1B1ZA 1Y56A 3AECB 2B76B 3AB5A 4YTPB 1TKEA 1YJJA 3BZDB 4LLGM 4DXGA 2WXQA 1IGDA 1E6EB 1PUTA 2N7JA 1YN4A 4LTUA 4YSZB 3VR9B 3AMZA 1TKYA 1UGJA 3E56A 1EU4A 3P4SB 2QSDA 1XLOA 3UI3A 5HHDG 1FRDA 1KF6B 4N6EB 2LJIA 4A9AA 2HTME 3AEEB 1XCTL 1GB1A 3B2FA 4OZBA 2ON8A 1MVKA 5AUKA 1JROA 1F2RC 4YXDB 3NZ3A 2AQ2B 1VZ8A 1PYWD 4HJGE 3FC4A 2J52A 1H7WA 1GTHA 1K52A 3P63A 4ARIA 3IAM1 3B9JA 1C76A 1SJED 2V0GA 1WYGA 4L23A 1QQRA 1OFFA 1VLBA 2SEBD 3IAS1 2PKOA 1TZOA 4XDDA 1N62A 2MEKA 3SFDB 4MACA 3AE9B 2H89B 1KFYB 1VZ7A 1R7SA 1FNVA 1QOFA 1BXTA 3ZJVA 2E3TA 2R61A 3C8YA 1JRPA 2YEPF 1D6EC 5GXGB 1VJKA 3U2SC 3W1SA 1FMAD 1RM6C 2G1EA 2WXPA 2XN9C 3SEBA 4HEA1 1L6UA 1UWXA 4P16A 4WWMA 1DOYA 1JWSD 3AEGB 5BMIA 4WIPA 4NJCA 1N60A 3P4QB 2KN4A 3BVGA 2WDQB 3NS1A 5H8YE 4J3OD 1XEEA 4HRSA 2WP9B 1ET9A 1TKGA 1XCQL 1QILA 1V97A 3KWVA 2V4IB 4OW0A 2WXJA 1L4DB 3I9V1 4ZYSA 3AE1B 1YJIA 1ZE3D 1ENFA 2QIEB 2WXGA 1TY2A 1VRAB 1VR9A 1HQRD 2Z8LA 2WXOA 2VZKD 3DWGC 1IGCA 3FILA 4HKZE 4MH8A 1J7CA 1H7XA 2DYMA 3AE8B 1N5WA 3BWUD 3W9CB 4JPSA 3TSSA 4IDIA 1V1OA 4TQ0A 5E6JA 4OZCA 1SSNA 4XWTA 1QT9A 2ZW1A 1A70A 2DYOA 3O13A 3AH7A 1FD6A 4KGRA 1SE2A 3AEAB 4US9A 1TY0A 3MFGA 3E9SA 1DOXA 1XLQA 2JWUA 3SFEB 2GRIA 1EU3A 3AEFB 1JW9D 2EELA 4N59A 4GDLB 2J4XA 2IGHA 2OHFA 1XF5L 4TMAB 2LGIA 1IBXB 1L6VA 4TSSA 1Q10A 2CU3A 1YNTE 4R3DA 4ZRQA 4C7YA 3P42A 5H92C 2QILA 1YN5A 2ACZB 1JWBD 1L5PA 2KACA 2GI9A 3ABVB 3AEBB 3AE3B 2JX5A 2K9XA 2L52A 4XE0A 1ET6A 3BVMA 2MH7A 2DLBA 2J53A 3W2DA 1D5ZC 1MHHE 4HROA 4KGTA 4RH6A 4EE2A 2SAKA 4ARCA 3AEDB 3BVZA 3VRBB 2CJOA 3LXFA 2WU5B 1SE3A 3TEZA 1KRHA 1RWSA 2INNE 3GS2A 2JU6X 5HFYA 1UUPA 2L32A 2KQ4X 3ETRA 4RGMA 4RFBA 1QOGA 1DYQA 2IPKD 4XDCA 2DWQA 2GB1A 3OWEB 1PGAA 1D5XC 4UDUC 1QOAA 3NVVA 3TEYA 1ZP0B 1NEKB 5MPOA 1J7AA 3NUHB 4Q2JA 2HDEA 1JALA 2JXTA 1AW7A 2L1AA 2Y5PA 5D3DA 2E6XA 1GB4A 2H88B 1I4PA 3T3NA 2J42A 1UNSA 2M56B 2OEDA 2PTLA 3NVZA 1CZPA 1FFVA 3IT4B 2BS2B 2FE8A 3B2GA 1ROEA 3RPFC 4C7ZA 1SE4A 2Y3AA 4M0WA 3SR6A 2M0AA 1JMLA 2I38A 4OHJA 2QJLA 4C80A 1EWCA 1C4PA 1I4GA 3P4PB 1WRIA 3AV8A 1FCLA 2DBYA 2K3UA 4A6QA 2KWDA 4A55A 1RFKA 4HKQA 2PVGC 1ZXHA 1VDVA 3AE2B 4O1NA 3DWMA 2WLBA 4GLSC 1TYGB 1QF6A 4P6VF 1MI0A 1TS4A 4AQ7A 2QMTA 1TS3A 1OQRA 1C79A 3GB1A 4RGTA 4WQMA 1EWYC 2PIAA 2WXKA 1HXYD 1I4QA 1WXQA 2K5PA 1SF0A 3FILB 1L0VB 4MT5A 3LB8C 1SIJA 1PDXA 2JZPA 2WXMA 5BYSA 3U7ZA 4D2KA 2LEKA 4CQNA 2JSVX 4XWWA 1ZPSA 3CWIA 2LHEA 2PMVA 2W54A 4KKIA 3KQ4A 2WDRB 4ZRPA 4PT5A 2BS3B 4RGNA 1V1PA 2WNMA 2IGGA 5BYQA 2L83A 2YEPB 5BMHA 3GP7A 1FRRA 1CQVA 4L2YA 4RGOS 1NI3A 1SB3C 5C2TB 1XO3A 4US8A 5HG2A 1BUIC 3ZYYX 4REZA 1C77A 2QEJC 3CF4A 2ONQA 3MHZA 4USAA 1E7PB 2BTEA 2X38A 1NYRA 3TEWA 4YTNB 3MJ5A 4RCOA 2MJEA 5TSSA 3IT6B 2MJDA 1F2RI 1RYJA 3MP9A 1KH0A 2D5GA 4YSXB 3ZQ4A 2Y5CA 2PW9A 3R8BA 2ZW0A 1JWUD 1C4AA 3H8HA 4JWSC 5EE0A 5EE9A 3URYA 3RFZB 4RF1A 1NYQA 1N5XA 3AE6B 1K53A 1M4VA 2BS4B 2WXNA 4RNAA 1XLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3T A;  3W5V B;  4ZHP A;  1E9M A;  1DGJ A;  1E10 A;  1JRP A;  1ZOY B;  2W55 A;  2H88 B;  1PFD A;  5G5G A;  1VJK A;  5GXG B;  3BII D;  1FMA D;  1RM6 C;  1UWM A;  2G1E A;  1IUE A;  2M56 B;  3NVZ A;  1CJE A;  2BT6 A;  4JX1 C;  3AE4 B;  1L6U A;  2PVO D;  1CZP A;  4WWM A;  1FFV A;  3NVW A;  3P1M A;  3W5U B;  2BS2 B;  3B2G A;  3VRA B;  1ROE A;  3RPF C;  4C7Z A;  3AEG B;  1DOY A;  3SR6 A;  1N60 A;  4C80 A;  2QJL A;  3P4Q B;  1FIQ A;  2M19 A;  3AE7 B;  5G5H A;  1TJE A;  3P4P B;  1WRI A;  3AV8 A;  4FXC A;  2WDQ B;  2MJ3 A;  2N0S B;  3NS1 A;  3NVY A;  2AX5 A;  2DBY A;  5H8Y E;  4JWU C;  4HRS A;  2WP9 B;  1RFK A;  3FAH A;  1TKG A;  5AUI A;  1V97 A;  3NRZ A;  1B9R A;  2PVG C;  1VDV A;  3AE2 B;  4KX6 B;  1FO4 A;  1FXI A;  4YTM B;  3AE1 B;  1YJI A;  2WU2 B;  2QIE B;  1WWT A;  1AYF A;  1TYG B;  2WLB A;  3DWM A;  3P4R B;  4ZHO A;  1QF6 A;  4P6V F;  1NEN B;  1XLN A;  3WCQ A;  3VR8 B;  1V8C A;  1OQR A;  3DWG C;  3KWL A;  1N63 A;  3HUI A;  1YQ4 B;  4N58 A;  1J7C A;  1H7X A;  3AE8 B;  1FFU A;  1N5W A;  4WQM A;  1QOB A;  1EWY C;  3CIR B;  3W9C B;  2PIA A;  2WQY B;  1J7B A;  1T3Q A;  4IDI A;  5EE1 A;  2W3S A;  1YQ3 B;  1WXQ A;  2K5P A;  2KMM A;  1SF0 A;  1L0V B;  1QT9 A;  3LB8 C;  1AWD A;  1GAQ B;  1PDX A;  1GTE A;  1SIJ A;  1ZUD 2;  1A70 A;  3L4P A;  2KAJ A;  3AH7 A;  2LEK A;  5EE3 A;  3PO0 A;  3AEA B;  4YT0 B;  1FM0 D;  4US9 A;  2CJN A;  1NVI D;  1E0Z A;  1DOI A;  3CWI A;  4ITK A;  1OQQ A;  2EKI A;  1DOX A;  1ZXI A;  1XLQ A;  3SFE B;  2W54 A;  3AE5 B;  2K22 A;  2WDR B;  3AEF B;  1JW9 D;  4N59 A;  1FXA A;  2BS3 B;  2OHF A;  1L6V A;  5C3J B;  4ZOH C;  3HVZ A;  3AEC B;  2B76 B;  2CU3 A;  3AB5 A;  4YTP B;  1TKE A;  1YJJ A;  4C7Y A;  1JQ4 A;  5H92 C;  1GT8 A;  1E6E B;  2FBW B;  2ACZ B;  4YSY B;  1JWB D;  1L5P A;  1PUT A;  4YSZ B;  2L83 A;  3VR9 B;  4LTU A;  3AMZ A;  3ABV B;  3AEB B;  3AE3 B;  1N61 A;  1TKY A;  2JX5 A;  2K9X A;  1FRR A;  2L52 A;  1GPX A;  1NI3 A;  3P4S B;  5C2T B;  1SB3 C;  1XLO A;  1XO3 A;  2WS3 B;  2MH7 A;  4US8 A;  1FRD A;  1KF6 B;  4N6E B;  4A9A A;  3ZYY X;  3AN1 A;  2HTM E;  3AEE B;  4HRO A;  3CF4 A;  3B2F A;  3AED B;  3HRD D;  4USA A;  1JRO A;  1E7P B;  4YXD B;  1WGK A;  5AUK A;  3VRB B;  2CJO A;  1I7H A;  3LXF A;  2WU5 B;  1NYR A;  3FC4 A;  1KRH A;  1RWS A;  2JQR B;  1H7W A;  1GTH A;  4YTN B;  3P63 A;  2MJE A;  3ETR A;  3EUB 2;  2MJD A;  3B9J A;  1RYJ A;  1QOG A;  1WYG A;  1VLB A;  1OFF A;  3AM9 A;  4YSX B;  2PKO A;  2Y5C A;  1N62 A;  2DWQ A;  2W3R A;  3SFD B;  3AE9 B;  2Q5W D;  1QOA A;  2WDV B;  2H89 B;  3NVV A;  1JWA D;  4JWS C;  5EE0 A;  1ZP0 B;  1KFY B;  5EE9 A;  1NEK B;  1R7S A;  5MPO A;  1QOF A;  1J7A A;  1NYQ A;  1QLB B;  1N5X A;  3AE6 B;  1JAL A;  1F0Z A;  2BS4 B;  1XLP A; 
#chains in the Genus database with same CATH topology
 5IKC M;  1FEH A;  1DGJ A;  1XXG A;  1UWM A;  2N1V A;  4B0M A;  1F77 A;  4ICV A;  2LRU A;  2LVQ A;  4GDK A;  3BYY B;  3NJT A;  4KVG B;  1E8X A;  3U8Z A;  4W9E A;  2MJ3 A;  4GU2 A;  4B95 A;  4JWU C;  2N9K A;  3QWZ B;  1HZ5 A;  3NRZ A;  2K25 A;  3DPD A;  1FO4 A;  3MJW A;  1P3Q U;  1F0Z A;  1AYF A;  5I4D A;  1WXM A;  1V49 A;  5JXV A;  2WHI A;  3QAQ A;  1FFU A;  3IHP C;  1WJU A;  1GC6 A;  5LNK 1;  5EE1 A;  2W3S A;  1KLV A;  3L0W B;  1WR6 E;  3NOB A;  2JPH A;  1YN3 A;  2C7H A;  3KH0 A;  3VTW A;  2KO3 A;  2J0J A;  1OQQ A;  2C5L C;  2PPH A;  2NMQ A;  4WJQ A;  2IYD B;  5C3J B;  3HVZ A;  3NHE B;  4K7U A;  1JQ4 A;  2FIF A;  1LGR A;  5DCN A;  3PV1 A;  2FBW B;  3EFC A;  1ZDV A;  3V61 A;  1N61 A;  2RDG A;  1MFW A;  4GSW A;  1WGR A;  4W9L A;  5G2N A;  1M94 A;  3AN1 A;  4IM0 A;  2UWQ A;  1WI0 A;  1WGK A;  2PLP A;  4GB9 A;  1UGM A;  2ICI A;  4BBN F;  4TQ1 A;  3J9C A;  1K51 A;  3Q8E A;  2KAN A;  1I4R A;  3RT3 B;  2IO0 B;  1QZE A;  1D4B A;  4M8N A;  3B08 A;  3EA6 A;  3Q3N C;  1IYF A;  4PYU A;  4RMA A;  4KSK C;  4NAM A;  3BII D;  2KVR A;  2WX1 A;  3AE4 B;  1RAX A;  5J17 A;  2K8H A;  4M02 A;  3APF A;  3X0W A;  2L0F A;  4MGI E;  4F1S A;  1D5M C;  1T5X D;  3HVD A;  1TS2 A;  2EMS A;  2FUG 1;  2LHD A;  3ZTD A;  4ZHO A;  1HEZ E;  3GZN I;  3BK1 A;  4X57 B;  1NEN B;  3WCQ A;  4PS8 A;  2I2Y A;  2ASQ A;  2LUM A;  1UH6 A;  4K7W A;  5LLI A;  3RCZ A;  1KLU D;  1CMX B;  2KMM A;  5BMG A;  1IBX A;  2RD0 A;  3KYD D;  2FCM A;  2CJN A;  4LNF A;  3BYT B;  2JZZ A;  4B0E A;  2G9H D;  2LJ5 A;  2LFI A;  4MSQ B;  1V80 A;  3QK0 A;  2MBQ A;  1YJJ A;  3QIJ A;  3BZD B;  2WXQ A;  1PUT A;  2N7J A;  3SHQ A;  4LTU A;  5D2M B;  3VR9 B;  3AMZ A;  1EU4 A;  2KTR A;  2KLG A;  4FLH A;  3VUW A;  3X23 A;  1WH3 A;  1XCT L;  3QA8 A;  3B2F A;  4OZB A;  2ON8 A;  3ZXV A;  1P98 A;  4BKT A;  1F2R C;  2K6Q A;  3JSV B;  3ZRC A;  4HJG E;  3RNB C;  3FC4 A;  2J52 A;  4EZL A;  1GTH A;  1K52 A;  3D32 A;  1SJE D;  4DWF A;  1VLB A;  2M4N A;  4GXB A;  2Z59 B;  2FID A;  2PKO A;  1N62 A;  1T0Y A;  1FNV A;  4WJP A;  4XC2 A;  2E3T A;  2KJH B;  2QCZ A;  3SU8 X;  1D6E C;  3SD5 A;  4ZYN A;  2XN9 C;  3VFK A;  4N9F 4;  3VUY A;  3RUI B;  1DOY A;  1WF9 A;  1JWS D;  4URK A;  1V81 A;  3CF6 E;  2G3Q B;  3P4Q B;  3I5J C;  4PS7 A;  2KQ7 A;  1J8C A;  5H8Y E;  2WP9 B;  2G45 B;  1TKG A;  2HJ8 A;  2V4I B;  2JWZ A;  4ZYS A;  3N1Z C;  1NDD A;  1UD7 A;  2WXG A;  1VRA B;  2LD9 A;  2WXO A;  1E8W A;  1F1H A;  4MH8 A;  3ZRF A;  1J7C A;  3A9K A;  1L7Y A;  1V1O A;  2GBN A;  2MSE D;  4XWT A;  2J0K A;  3O13 A;  3M95 A;  2D2Q A;  4US9 A;  4W9F A;  1KM7 A;  2JWU A;  4DBG A;  1OGW A;  3RNA C;  4TMA B;  2LGI A;  3V6C B;  3VTV A;  2QIL A;  1JWB D;  1L5P A;  3PZD A;  2KAC A;  1WMH B;  3ABV B;  2CHW A;  5CHF A;  4GOC A;  4DHZ E;  1WE6 A;  3W2D A;  4LCD E;  2SAK A;  5CTR C;  1YX6 B;  4C00 A;  2INN E;  5DPW A;  1MG4 A;  2KQ4 X;  3DBR B;  1S1Q B;  1QOG A;  2V3S A;  2KFJ A;  2KTF A;  1AAR A;  4UDU C;  5MPO A;  2O2V B;  3NUH B;  2HDE A;  3L10 B;  2GBJ A;  2L1A A;  3LJ3 A;  2E6X A;  2M1M A;  4ZRK A;  2H88 B;  2LXA A;  1I4P A;  3T3N A;  2J42 A;  2OJR A;  3DBL I;  1SE4 A;  2Y3A A;  4M0W A;  4HCP B;  1JML A;  1I4G A;  3P4P B;  2NBW B;  1ZW7 A;  2PEA A;  3R7Q A;  4A6Q A;  4A55 A;  1RFK A;  2LZ6 A;  4HKQ A;  3A9J A;  1GJZ A;  2D3B A;  4BVU C;  4K3B A;  4AQ7 A;  4RM9 A;  1J0G A;  4LJO B;  2I1J A;  2PIA A;  4XYC A;  3WAL A;  2BWF A;  2WXK A;  3C19 A;  1SF0 A;  4E3C A;  2AEH A;  3LB8 C;  2A4Z A;  1PDX A;  2JZP A;  2C7N B;  5BYS A;  2LEK A;  4EKU A;  4CQN A;  2KFK B;  1WXV A;  4PYZ A;  1ZPS A;  5LXH A;  2W54 A;  3KQ4 A;  4ZRP A;  1MG8 A;  4WJO A;  2BS3 B;  2IY0 B;  2KFK A;  5BYQ A;  3EC8 A;  5BMH A;  1KOT A;  2DZK A;  3PRM B;  5IO9 A;  4AJW A;  2KWC A;  2OJW A;  4E71 A;  1C77 A;  3L13 A;  1OEY A;  2ONQ A;  1E7P B;  3FKY A;  3DHI C;  3TEW A;  5TSS A;  2MJE A;  3M63 B;  3IT6 B;  3ZDM C;  3HM6 X;  2WYQ A;  1J19 A;  1C4A A;  3RFZ B;  3AI5 A;  4RF1 A;  5HKH A;  1NYQ A;  2WXN A;  2N9E B;  4HDQ A;  4RNA A;  4MM3 A;  1LXD A;  1ZOY B;  4OVZ A;  3QX1 A;  5G5G A;  1P7E A;  2BQQ A;  2BWE S;  4HPP A;  1MPE A;  3RNE C;  1VZ6 A;  3KUC B;  1I35 A;  3P1M A;  3PHW B;  3N3K B;  4P7I A;  2L05 A;  3TIX A;  5E6P A;  4I6P A;  2L00 B;  3DQV A;  2D10 A;  3RN9 C;  3N32 A;  2WX0 A;  4B9K A;  1FCC C;  1LO5 D;  1Z5S B;  1TS5 A;  2BW2 A;  3Q69 A;  3L17 A;  1L4Z B;  4BKG A;  2KD0 A;  3S2A A;  4LNO A;  4AS1 A;  2MWS B;  1OQY A;  1OEY J;  1YMH E;  2L3Z A;  4MJS B;  2EKE C;  2DNF A;  4EZK A;  5IA7 A;  4WH4 A;  2D07 B;  2KX0 A;  1PGX A;  4NAW B;  4DHJ B;  1AWD A;  1GTE A;  1JCK B;  3ZIM A;  2KMC A;  2BB6 A;  2KMA A;  1ZGU B;  2KJR A;  1E0Z A;  4ITK A;  2INC C;  2EKI A;  2RDH A;  1SE9 A;  3R2I A;  3PSE B;  1EM7 A;  1GT8 A;  4YSY B;  2IO1 B;  1T6B X;  3V3X A;  3ZTC A;  4OZA A;  3PVL A;  2PJH A;  3DHH C;  2K1F A;  4WAA A;  4DXA B;  3HRD D;  1ISN A;  3L16 A;  3U30 A;  5T8I A;  4JL9 A;  3K9O B;  4EUT A;  2GBK A;  3EUB 2;  3DBS A;  3UF8 A;  3AM9 A;  4LNK A;  2BYT A;  4MGK E;  3VH4 B;  3T3O A;  3EGR A;  4F8C B;  4QAY A;  3PRZ A;  1R4N I;  3LYY A;  2K0P A;  2KKC A;  3ZNH B;  4AJY B;  4G50 A;  2QC8 A;  2RR9 A;  3GE3 C;  3PZ8 A;  3VAW A;  1S3S G;  2BB5 A;  2I1K A;  2M19 A;  5G5H A;  3H7P A;  3RMK C;  1PGB A;  4FXC A;  3B1L X;  5BYR A;  2FNJ B;  4WJN A;  4GDK B;  2KVZ A;  2NBV B;  3FAH A;  5AUI A;  2NTS A;  4S0R A;  5JHA A;  1FXI A;  2IDY A;  5JH5 C;  2KC1 A;  3VR8 B;  1AN8 A;  3KWL A;  2L7R A;  3HUI A;  4LDT D;  2CS4 A;  3V60 A;  3VQI A;  3DBH I;  1KLG D;  2YVC A;  3GZN B;  4FJZ A;  1YQ3 B;  2KDF B;  4MSM B;  4KDL B;  4LJP B;  1GAQ B;  2IJ0 A;  1ZKH A;  2O6V D;  1WSP A;  1ZXI A;  2MBB B;  4W9G A;  3H1U A;  4LK0 M;  2XNA C;  3ZNI D;  1X1M A;  4NPN A;  1TKE A;  4FBJ B;  4YSZ B;  1TKY A;  3E56 A;  4JIO U;  3UI3 A;  4W9H A;  1FRD A;  3RD2 A;  4NQL B;  2LJI A;  2HTM E;  1GB1 A;  5AUK A;  1UF0 A;  4FN2 A;  2AQ2 B;  2HD5 B;  2C9W B;  4II3 B;  2N1W A;  3DVG Y;  3IAM 1;  3V6E B;  2V0G A;  1WYG A;  4L23 A;  4TV3 A;  1QQR A;  4MEL A;  3ECI A;  4XDD A;  3SFD B;  3VDZ A;  3AE9 B;  2BYV E;  1R7S A;  3ZKJ C;  3RYT A;  4WWN A;  5GXG B;  1VJK A;  3U2S C;  3W1S A;  4KDI C;  2G1E A;  5AZG A;  2KXJ A;  4HEA 1;  2M8S A;  1L6U A;  1UWX A;  2FAZ A;  4P16 A;  4WWM A;  2R2Q A;  3AEG B;  3OJ4 B;  1UBI A;  1T0R C;  3OJ3 A;  1ET9 A;  3ZXR A;  3I9V 1;  3AE1 B;  4DDG D;  1ZE3 D;  2BYE A;  4W9D A;  2VZK D;  3M3J A;  3FIL A;  1WJ6 A;  1H7X A;  3AE8 B;  3A1Q A;  1N5W A;  5L95 C;  4JPS A;  5AEK B;  2LWP A;  4K81 A;  1EF1 A;  4ANU A;  4GIV A;  3UQB A;  2ZW1 A;  3ALB A;  2DYO A;  2O6V A;  1FD6 A;  3AH7 A;  4IM3 A;  3AEA B;  2GLS A;  4WQO B;  1F52 A;  1XLQ A;  2LRW A;  2GRI A;  3AEF B;  1WR1 A;  2J4X A;  2IGH A;  1XF5 L;  3EFU A;  1IBX B;  1L6V A;  2WGS A;  1Q10 A;  2C60 A;  4R3D A;  4ZRQ A;  2HJ1 A;  1WGY A;  4P1B C;  2BPS A;  1YN5 A;  2ACZ B;  3RI7 C;  2GI9 A;  3AE3 B;  2JX5 A;  2L52 A;  4XE0 A;  2NS5 A;  3BVM A;  2DHZ A;  2MH7 A;  4MGZ E;  4ZRJ A;  1MHH E;  4RH6 A;  4EE2 A;  3EEC A;  5CX3 A;  1SIF A;  3VUX A;  2KTR B;  3LXF A;  1SE3 A;  1E8Y A;  4RFB A;  4DK5 A;  2JXX A;  1DYQ A;  3OWE B;  1V86 A;  5L83 A;  1PGA A;  1D5X C;  2ZCC A;  1LM8 B;  1QOA A;  5J2R A;  1H4R A;  1NEK B;  4C4V A;  2N4F A;  1JAL A;  1JRU A;  3A4S C;  2Y5P A;  3AU5 A;  2M56 B;  2OED A;  2PTL A;  2LVP A;  1TBE A;  1CZP A;  3Q6B A;  1FFV A;  4XGA B;  2BS2 B;  2FE8 A;  2LUE A;  2D3G A;  4C80 A;  3H6N A;  3APC A;  2D3C A;  2MRP A;  3BIN A;  3DBL B;  1OTR B;  2KWD A;  2ZNV B;  5D94 A;  4EOY A;  1ZXH A;  1VDV A;  3AE2 B;  4O1N A;  4AWJ A;  4MEM A;  2KX3 A;  4P6V F;  1MI0 A;  1OQR A;  3GB1 A;  2GMI C;  2LAS A;  3RZF A;  2Y5B B;  5C1Z A;  3ENE A;  1WXQ A;  1L0V B;  3A9K B;  2WXM A;  3IBE A;  4D2K A;  2KT7 A;  2JSV X;  3ZNG C;  3ONS A;  4XWW A;  2PMV A;  2WDR B;  4PT5 A;  1C1Y B;  1V1P A;  1T0S C;  3PT2 B;  2IGG A;  1I42 A;  2CR5 A;  4AP4 C;  1FRR A;  1CQV A;  4FJY A;  3W1S C;  2QEJ C;  1YJ1 A;  4IC7 B;  4LNI A;  4BOS C;  2X38 A;  4YTN B;  2DX5 B;  4RCO A;  2ZJD A;  3K9P B;  4FUL A;  2W9N A;  3HK0 A;  2PW9 A;  3R8B A;  2ZW0 A;  1E7U A;  3H8H A;  3URY A;  1M4V A;  2BS4 B;  4GMV A;  2ZEQ A;  4ZHP A;  4TUU A;  2PE6 B;  1PFD A;  3AUL A;  2WXR A;  1CJE A;  2FUH B;  3RUL A;  3NVW A;  3W5U B;  4LNN A;  5LXI B;  3VRA B;  1ESF A;  1WE7 A;  1G6J A;  2V3N A;  3Q3O C;  4A8X C;  2V4L A;  3IXS A;  3NY5 A;  2AX5 A;  2MBE A;  2V3P A;  4M0W B;  5FR6 A;  2KN5 A;  1ACC A;  2JRI B;  4HDO A;  4IWP A;  4ANX A;  3ZVV A;  3AXC A;  1YQ4 B;  1EF5 A;  3A9J B;  2RMM A;  3U52 E;  3V05 A;  1C9F A;  2WQY B;  2JYE A;  1T3Q A;  2KHW B;  1HTO A;  2JF5 A;  3TL5 A;  5D3I B;  2AL6 A;  3L4P A;  1KJT A;  3KLS X;  4NJ7 A;  2AYO B;  2NVU I;  1R4M I;  2TSS A;  4EEW A;  1L0X B;  1VD2 A;  1QKZ A;  4ZOH C;  5CHW A;  4RF0 A;  2J0M A;  3Q3M C;  2INP E;  1WFY A;  4WUR A;  4K3C A;  1P7F A;  1WY8 A;  1HZ6 A;  3HM3 A;  1I4X A;  4KGS A;  3MC8 A;  4HWI B;  4WAF A;  2IGD A;  1TTN A;  2XK5 A;  1GNU A;  2RPV A;  1SJH D;  4BKS D;  3I3T B;  3KYC D;  1JWA D;  3ZUN A;  1IP9 A;  1QLB B;  3WAO A;  4H2A A;  3HHM A;  3KW5 B;  3W5V B;  4NNJ B;  1E10 A;  2ZNV C;  2FCS A;  2BT6 A;  4JX1 C;  1R4N B;  4HLE A;  4KIK A;  1P0R A;  4HJK A;  4MM3 B;  2K39 A;  2DZJ A;  2N9P C;  2NPT A;  5FKA C;  1FIQ A;  2DYB A;  3AE7 B;  4DXF A;  3ZJT A;  2ZPN A;  1GOZ A;  2N0S B;  3NVY A;  4EFO A;  2KYW A;  2KDM A;  2RPQ A;  3TEX A;  3NZS A;  2WXH A;  5AZH A;  3QAR A;  4NZL B;  2WU2 B;  1XLN A;  2LGD A;  2ZVN A;  1Y8R C;  1Q1O A;  1SXT A;  3ML8 A;  1L2N A;  3MC9 A;  5FK9 C;  3L08 A;  3QJZ A;  4DDI D;  1C4C A;  5FR3 A;  1GC7 A;  4GDL A;  4HPL B;  3Q8C A;  4J6I A;  3DBH B;  2ZVO A;  4IM2 A;  3L54 A;  2WXI A;  1NVI D;  5E6N A;  4K7S A;  1Q5W B;  1LFD A;  1B1Z A;  1Y56 A;  3AEC B;  2B76 B;  3Q14 C;  3AB5 A;  4YTP B;  3HIZ A;  4LLG M;  4JGH B;  4DXG A;  2JY6 A;  1UGJ A;  5TR5 A;  2KDE B;  3T8M A;  2QSD A;  1XLO A;  3CSF A;  4BZA A;  1KF6 B;  4N6E B;  3Q2A C;  2GBR A;  3PPA A;  4ANV A;  3GE8 C;  1TIF A;  3U7D A;  2BYF A;  1PYW D;  2LGX A;  2HE7 A;  1H8C A;  1H7W A;  3P63 A;  1BT0 A;  3B9J A;  3IAS 1;  4BKS A;  4XX5 A;  2V1Y A;  2H89 B;  1VCB A;  5AZF A;  1KFY B;  1QOF A;  2KWU B;  5KHQ A;  4OVV A;  3C8Y A;  2R2O A;  2YEP F;  5EDS A;  2X8X X;  4AOF A;  4BAX A;  1FMA D;  1RM6 C;  2MA9 B;  3N20 C;  5D6J B;  4HCN B;  3VH3 B;  1F9J A;  2K8C A;  5BMI A;  4WIP A;  4NJC A;  2KN4 A;  3BVG A;  2LI5 A;  4ANW A;  4HRS A;  3A33 B;  3KWV A;  1QIL A;  4M01 A;  4HK2 A;  2GBM A;  3BY4 B;  4OW0 A;  1YQB A;  2WXJ A;  4S17 A;  3IVF A;  3C0R B;  3DOW A;  3H7P B;  2KDI A;  1TY2 A;  2Z8L A;  2NCN A;  3JVZ X;  3DWG C;  1IGC A;  4TKN A;  1HE8 A;  3BWU D;  2KWV B;  1UBQ A;  2G4D B;  4W9I A;  1SSN A;  3PRP B;  3DCG A;  4FHJ A;  3TJP A;  1YX5 B;  1SE2 A;  2MP2 A;  1DOX A;  2MCN B;  5IAA C;  1EU3 A;  4N59 A;  4YL8 A;  2N7D A;  2OHF A;  3QHT A;  1XT9 B;  4TSS A;  3TMP B;  1YNT E;  3QCA A;  5H92 C;  2IBI B;  1P9D U;  3AEB B;  2KOX A;  1WIA A;  1ET6 A;  2PE9 A;  2LXC A;  1D5Z C;  4ARC A;  4IWQ A;  3AED B;  3OG5 A;  3BVZ A;  1V5O A;  3PLU A;  2CJO A;  3Q3J A;  3TEZ A;  1KRH A;  2MBO A;  3GS2 A;  3W1Y A;  2JU6 X;  4RGM A;  4ZRI A;  5C23 A;  5J18 A;  1T0Q C;  1TGZ B;  4XDC A;  4CHK A;  3TEY A;  1ZP0 B;  2DAF A;  2J7Q B;  4Q2J A;  3VXW A;  4KZ0 A;  2VRR B;  1AW7 A;  2JRH A;  5D3D A;  1GB4 A;  2M17 A;  2FCN A;  1UNS A;  3NVZ A;  3JW0 X;  3ZW3 A;  4ASW C;  3JYU A;  3B2G A;  4C7Z A;  3RPF C;  2M0A A;  5IP4 D;  2I38 A;  4MH0 E;  4JLC A;  3VHT C;  1EWC A;  1C4P A;  2AWT A;  1FCL A;  2K3U A;  2IY1 B;  3NS8 A;  3DWM A;  3M62 B;  3O65 B;  1QF6 A;  3OAW A;  1TS4 A;  2QMT A;  1TS3 A;  1RLF A;  1C79 A;  4G0N B;  4WQM A;  5E6O A;  1GG3 A;  3MHS D;  4LDT B;  1I4Q A;  3FIL B;  2C7M B;  2DZI A;  4MT5 A;  1SIJ A;  3A1Q B;  5DPS A;  2K6D B;  3U7Z A;  4NQK E;  1V5T A;  3CWI A;  2KLC A;  4KKI A;  4II2 B;  1E90 A;  1FXT B;  2O6V B;  4I6N B;  2B3A A;  4RGN A;  3TBL D;  4M00 A;  2KNB A;  2N9X A;  2L83 A;  1Z2M A;  2ZPY A;  3GP7 A;  3PS6 A;  1N6Z A;  4L2Y A;  4HPM B;  4RGO S;  1NI3 A;  1XO3 A;  2JVC A;  3AU4 A;  2UYZ B;  1WGH A;  5HG2 A;  1BUI C;  2K8B A;  3UQA A;  3MHZ A;  4USA A;  4RM8 A;  2L0T A;  3MJ5 A;  3GOE A;  2MJD A;  1F2R I;  3MP9 A;  1KH0 A;  3WAM A;  4YSX B;  1WXA A;  1K8R B;  4A3P A;  2MW5 A;  1JWU D;  2EMT A;  1RFA A;  1YIW A;  1N5X A;  2Z0E B;  1XLP A;  2W55 A;  3I63 C;  3RNG C;  2MHJ A;  3EHV A;  2KC2 A;  3RZW C;  4IG7 B;  4KKJ A;  1PQS A;  4C4V B;  2CHZ A;  1WXS A;  5GMV A;  3PLV A;  5BO4 B;  5D7G A;  1JWM D;  1TJE A;  1WM3 A;  2RSU A;  1SGH A;  1CK1 A;  4DQO C;  2GOW A;  4KX6 B;  3H9D A;  4WWP A;  3ZJU A;  2YLM A;  1WZ3 A;  2JYT A;  1WWT A;  2HTH A;  3PGE A;  1V8C A;  2RDB C;  3RNF C;  2CHX A;  4N58 A;  1FNW A;  3ZGZ A;  1WYW B;  2AQ3 B;  2VZK B;  2JUO A;  2LMC A;  3QQ8 B;  3I57 A;  2MLB A;  4BOZ B;  3PZ7 A;  2JZ3 B;  1Q0W B;  1ZUD 2;  2BBC A;  2D11 A;  1SBB B;  2V9H A;  1FNU A;  4YT0 B;  1FM0 D;  2IND C;  5IN7 A;  4F7Z A;  3U4E G;  2LVO A;  1XQQ A;  2WWZ A;  1FXA A;  3N9Y C;  1UZX B;  2KJ6 A;  4W9J A;  3WAN A;  1BML C;  1MHX A;  3DDC B;  3DVN U;  1R4M B;  4IW0 A;  3Q8A A;  1STE A;  3JSV A;  1EUV B;  4YWG G;  3R7R A;  3WA0 A;  3IFW B;  4FA6 A;  1GPX A;  4PK1 A;  1V1P B;  2WS3 B;  2L76 A;  2LGY A;  2WXL A;  1NBF C;  4IUM B;  4IOI E;  4P1C C;  1P1A A;  1NI2 A;  2G4S A;  3WAP A;  4A90 A;  1I7H A;  1V6E A;  3ZNZ B;  2JQR B;  2BF8 B;  3R66 C;  4CYE A;  1KTK A;  3Q8B A;  1E8Z A;  2W3R A;  4ZDV A;  2Q5W D;  2WDV B;  2BKR B;  4C56 C;  1WJN A;  3R2T A;  2DZM A;  4CO7 A;  2VH2 A;  5HI1 A;  1ZDX A;  1WRD B;  1E9M A;  2ZZP B;  2Z0D B;  3APD A;  1IUE A;  2M0X A;  2IO2 B;  4L1B A;  3TUO A;  2PVO D;  2D3A A;  4OVU A;  5KHO A;  4W9C A;  2AL3 A;  1MJD A;  3MC0 B;  3DHG C;  2W82 A;  2NTT A;  3IG3 A;  3Q8F A;  3KUD B;  3ZO5 B;  4JE3 B;  1SEB D;  2VH1 A;  1B9R A;  3WIM A;  3N30 A;  4YTM B;  3P4R B;  3CST A;  1L0Y B;  1N63 A;  2WXF A;  4GN1 A;  2RGF A;  1K50 A;  1QOB A;  3LDZ E;  3CIR B;  1C78 A;  1J7B A;  2NBU A;  2KQS A;  2N9L A;  2UU7 A;  2KAJ A;  1I4H A;  5EE3 A;  3PO0 A;  4ICU A;  3BK2 A;  3QC8 B;  1HA5 A;  1DOI A;  4IKG A;  4B6W A;  2AQ1 B;  1FPY A;  4FHK A;  3AE5 B;  1WMH A;  2K22 A;  4EZJ A;  3PHX B;  1D3Z A;  2LGS A;  3NZU A;  4KSL C;  4BBN C;  1IGD A;  1E6E B;  1YN4 A;  4IWO A;  2QDF A;  5JZE B;  3P4S B;  5HHD G;  4A9A A;  3AEE B;  3SDL C;  1MVK A;  3NZ3 A;  1JRO A;  4YXD B;  3KUZ A;  4A3O A;  1LQB A;  3CMM B;  1VZ8 A;  2IO3 B;  2FCQ A;  4ARI A;  1UEL A;  2O2V A;  1C76 A;  4AUQ C;  1OFF A;  2SEB D;  4JQW C;  2BVC A;  4E74 A;  4FJV B;  1TZO A;  4XZ4 A;  2KK8 A;  2MEK A;  1U4A A;  3P2B A;  4MAC A;  4WWO A;  1IPG A;  4MGY E;  1VZ7 A;  1BXT A;  3ZJV A;  2XK5 B;  1WJ4 A;  2R61 A;  5JHB A;  1JRP A;  3V62 A;  3DVG X;  2WXP A;  3SEB A;  2WDT B;  4NJ6 A;  3DVN V;  5DPT A;  1N60 A;  1WM2 A;  3UIN B;  3PTF C;  1HTQ A;  1WGG A;  2WDQ B;  3NS1 A;  4KIK B;  4J3O D;  1XEE A;  1V9J A;  2BKF A;  1XCQ L;  2MQJ A;  1V97 A;  2N7E A;  3KVF B;  2NPT B;  1L4D B;  3UIP B;  1YJI A;  1ENF A;  2QIE B;  1V2Y A;  3ML9 A;  1VR9 A;  1HQR D;  4NY0 A;  4HKZ E;  2DYM A;  4DHJ D;  3W9C B;  3TSS A;  4IDI A;  4TQ0 A;  5E6J A;  1WX9 A;  4OZC A;  4ACF A;  1QT9 A;  3ZLZ A;  1A70 A;  1E5W A;  4KGR A;  1WGD A;  2XBB C;  4I6L B;  1TY0 A;  3MFG A;  3E9S A;  3SFE B;  1JW9 D;  2EEL A;  4GDL B;  2CU3 A;  3TCA A;  1WX7 A;  2XEW A;  4C7Y A;  3VTU A;  3P42 A;  3ZDT A;  4HXD A;  2QHO A;  2K9X A;  2CU1 A;  2OOB B;  3RNC C;  3T9L A;  2JT4 B;  2DLB A;  2J53 A;  3DBR I;  4HRO A;  4KGT A;  4PS3 A;  4HVB A;  2KDB A;  1EO6 A;  3PRE A;  3VRB B;  4G3X B;  4BFR A;  2WU5 B;  1XD3 B;  1RWS A;  5HFY A;  1UUP A;  2L32 A;  3ETR A;  3Q3F A;  4M8M A;  3UIO B;  1C3T A;  4W9K A;  4FAD A;  2IPK D;  4MDK E;  2DWQ A;  2GB1 A;  1WZ0 A;  3R3M A;  3NVV A;  1TT5 B;  1J7A A;  2JXT A;  2MX2 A;  4KV2 A;  2ZCB A;  2DAJ A;  2CKH B;  3IT4 B;  1ROE A;  4A20 A;  3SR6 A;  4OHJ A;  2QJL A;  3H7S A;  1A5R A;  4KZC A;  1WRI A;  3AV8 A;  3NG0 A;  5IOI A;  2DBY A;  4MJS A;  2PVG C;  2IZV B;  2WLB A;  4GLS C;  1TYG B;  4NAW A;  4RGT A;  1RRB A;  2L8J A;  1EWY C;  2KZR A;  1HXY D;  4K1R B;  2K5P A;  1YOV B;  3N1X C;  3B0A A;  2LHE A;  2DEN B;  1TZ1 A;  3N1Y C;  3OLM D;  2WNM A;  2NR2 A;  2MP2 B;  3A4R A;  2YEP B;  2REX A;  5CHV C;  1YD8 U;  1SB3 C;  5C2T B;  2MBH A;  4US8 A;  5G55 A;  4DHZ B;  3ZYY X;  1E7V A;  4REZ A;  3CF4 A;  4G11 A;  1WX8 A;  2BTE A;  1NYR A;  3VVW B;  2A5U A;  1RYJ A;  2D5G A;  1GUA B;  3UGB B;  3ZQ4 A;  2Y5C A;  4GGQ A;  5DPR A;  5EE0 A;  4JWS C;  5EE9 A;  2BGF A;  3AE6 B;  1K53 A;  3MTN B; 
#chains in the Genus database with same CATH homology
 1FEH A;  4ZHP A;  1DGJ A;  1ZOY B;  4OVZ A;  2W55 A;  1PFD A;  5G5G A;  1P7E A;  1XXG A;  1UWM A;  2WXR A;  4B0M A;  1CJE A;  1F77 A;  4KKJ A;  1MPE A;  1VZ6 A;  3NVW A;  3P1M A;  3BYY B;  3W5U B;  3VRA B;  1ESF A;  2V3N A;  5D7G A;  4A8X C;  1JWM D;  3IXS A;  1TJE A;  1CK1 A;  2MJ3 A;  2AX5 A;  4JWU C;  2N9K A;  4DQO C;  2V3P A;  1HZ5 A;  3NRZ A;  1FCC C;  1LO5 D;  2BW2 A;  1TS5 A;  4KX6 B;  1FO4 A;  3Q69 A;  3ZJU A;  1L4Z B;  2JYT A;  1F0Z A;  1WWT A;  1AYF A;  5I4D A;  1ACC A;  5JXV A;  4AS1 A;  1V8C A;  1YMH E;  4N58 A;  1YQ4 B;  1FFU A;  1FNW A;  3ZGZ A;  2RMM A;  3U52 E;  3V05 A;  5LNK 1;  1C9F A;  2AQ3 B;  2WQY B;  2JYE A;  1T3Q A;  2VZK B;  4WH4 A;  5EE1 A;  1PGX A;  2W3S A;  4NAW B;  2LMC A;  3I57 A;  3PZ7 A;  5D3I B;  1AWD A;  1ZUD 2;  1GTE A;  1YN3 A;  2BBC A;  3L4P A;  3KLS X;  1JCK B;  1SBB B;  1FNU A;  4YT0 B;  1FM0 D;  2BB6 A;  1E0Z A;  4ITK A;  1OQQ A;  2TSS A;  2EKI A;  3U4E G;  2NMQ A;  1L0X B;  1FXA A;  3N9Y C;  1QKZ A;  2RDH A;  4ZOH C;  5C3J B;  3HVZ A;  1BML C;  1MHX A;  3R2I A;  1JQ4 A;  1EM7 A;  1GT8 A;  4RF0 A;  2FBW B;  4YSY B;  3Q8A A;  1T6B X;  3V3X A;  1ZDV A;  2INP E;  4OZA A;  4WUR A;  1N61 A;  1STE A;  2RDG A;  1P7F A;  4YWG G;  1GPX A;  1V1P B;  2WS3 B;  2WXL A;  3AN1 A;  4IOI E;  1HZ6 A;  3HRD D;  1WGK A;  4A90 A;  1I4X A;  4KGS A;  1I7H A;  5T8I A;  2JQR B;  4WAF A;  2IGD A;  2PLP A;  3EUB 2;  2ICI A;  1KTK A;  3AM9 A;  3Q8B A;  2RPV A;  4TQ1 A;  2BYT A;  3T3O A;  1SJH D;  2W3R A;  3J9C A;  2Q5W D;  3EGR A;  2WDV B;  1K51 A;  3Q8E A;  1JWA D;  4C56 C;  3R2T A;  3LYY A;  2K0P A;  1I4R A;  1QLB B;  5HI1 A;  4H2A A;  1ZDX A;  3W5V B;  1D4B A;  1E10 A;  1E9M A;  3EA6 A;  4NAM A;  3BII D;  1IUE A;  2BT6 A;  4JX1 C;  3AE4 B;  4L1B A;  3TUO A;  3PZ8 A;  2PVO D;  4MM3 B;  2BB5 A;  5FKA C;  1FIQ A;  2M19 A;  3AE7 B;  1D5M C;  3MC0 B;  5G5H A;  1T5X D;  4DXF A;  3ZJT A;  1PGB A;  3HVD A;  2W82 A;  4FXC A;  2NTT A;  1TS2 A;  1GOZ A;  2N0S B;  3NVY A;  5BYR A;  2KDM A;  3Q8F A;  4GDK B;  3TEX A;  3FAH A;  2WXH A;  5AUI A;  4JE3 B;  1SEB D;  2NTS A;  1B9R A;  2FUG 1;  2LHD A;  1FXI A;  4YTM B;  2IDY A;  2WU2 B;  4NZL B;  1HEZ E;  4ZHO A;  3P4R B;  3BK1 A;  1L0Y B;  1NEN B;  1XLN A;  3WCQ A;  3VR8 B;  1AN8 A;  3KWL A;  1N63 A;  3HUI A;  2WXF A;  2I2Y A;  1SXT A;  2LUM A;  1K50 A;  1QOB A;  3VQI A;  3CIR B;  1C78 A;  5FK9 C;  1J7B A;  1KLG D;  1YQ3 B;  1KLU D;  1C4C A;  2KMM A;  5FR3 A;  5BMG A;  1GAQ B;  2IJ0 A;  2N9L A;  1IBX A;  2KAJ A;  1I4H A;  3Q8C A;  3PO0 A;  5EE3 A;  3BK2 A;  2WXI A;  2CJN A;  1HA5 A;  1NVI D;  1DOI A;  3BYT B;  1WSP A;  4B0E A;  4IKG A;  2G9H D;  1ZXI A;  2AQ1 B;  3AE5 B;  2LFI A;  2K22 A;  2XNA C;  4LK0 M;  1B1Z A;  1Y56 A;  3AEC B;  2B76 B;  3AB5 A;  4YTP B;  1TKE A;  1YJJ A;  3BZD B;  4LLG M;  4DXG A;  2WXQ A;  1IGD A;  1E6E B;  1PUT A;  2N7J A;  1YN4 A;  4LTU A;  4YSZ B;  3VR9 B;  3AMZ A;  1TKY A;  1UGJ A;  3E56 A;  1EU4 A;  3P4S B;  2QSD A;  1XLO A;  3UI3 A;  5HHD G;  1FRD A;  1KF6 B;  4N6E B;  2LJI A;  4A9A A;  2HTM E;  3AEE B;  1XCT L;  1GB1 A;  3B2F A;  4OZB A;  2ON8 A;  1MVK A;  5AUK A;  1JRO A;  1F2R C;  4YXD B;  3NZ3 A;  2AQ2 B;  1VZ8 A;  1PYW D;  4HJG E;  3FC4 A;  2J52 A;  1H7W A;  1GTH A;  1K52 A;  3P63 A;  4ARI A;  3IAM 1;  3B9J A;  1C76 A;  1SJE D;  2V0G A;  1WYG A;  4L23 A;  1QQR A;  1OFF A;  1VLB A;  2SEB D;  3IAS 1;  2PKO A;  1TZO A;  4XDD A;  1N62 A;  2MEK A;  3SFD B;  4MAC A;  3AE9 B;  2H89 B;  1KFY B;  1VZ7 A;  1R7S A;  1FNV A;  1QOF A;  1BXT A;  3ZJV A;  2E3T A;  2R61 A;  3C8Y A;  1JRP A;  2YEP F;  1D6E C;  5GXG B;  1VJK A;  3U2S C;  3W1S A;  1FMA D;  1RM6 C;  2G1E A;  2WXP A;  2XN9 C;  3SEB A;  4HEA 1;  1L6U A;  1UWX A;  4P16 A;  4WWM A;  1DOY A;  1JWS D;  3AEG B;  5BMI A;  4WIP A;  4NJC A;  1N60 A;  3P4Q B;  2KN4 A;  3BVG A;  2WDQ B;  3NS1 A;  5H8Y E;  4J3O D;  1XEE A;  4HRS A;  2WP9 B;  1ET9 A;  1TKG A;  1XCQ L;  1QIL A;  1V97 A;  3KWV A;  2V4I B;  4OW0 A;  2WXJ A;  1L4D B;  3I9V 1;  4ZYS A;  3AE1 B;  1YJI A;  1ZE3 D;  1ENF A;  2QIE B;  2WXG A;  1TY2 A;  1VRA B;  1VR9 A;  1HQR D;  2Z8L A;  2WXO A;  2VZK D;  3DWG C;  1IGC A;  3FIL A;  4HKZ E;  4MH8 A;  1J7C A;  1H7X A;  2DYM A;  3AE8 B;  1N5W A;  3BWU D;  3W9C B;  4JPS A;  3TSS A;  4IDI A;  1V1O A;  4TQ0 A;  5E6J A;  4OZC A;  1SSN A;  4XWT A;  1QT9 A;  2ZW1 A;  1A70 A;  2DYO A;  3O13 A;  3AH7 A;  1FD6 A;  4KGR A;  1SE2 A;  3AEA B;  4US9 A;  1TY0 A;  3MFG A;  3E9S A;  1DOX A;  1XLQ A;  2JWU A;  3SFE B;  2GRI A;  1EU3 A;  3AEF B;  1JW9 D;  2EEL A;  4N59 A;  4GDL B;  2J4X A;  2IGH A;  2OHF A;  1XF5 L;  4TMA B;  2LGI A;  1IBX B;  1L6V A;  4TSS A;  1Q10 A;  2CU3 A;  1YNT E;  4R3D A;  4ZRQ A;  4C7Y A;  3P42 A;  5H92 C;  2QIL A;  1YN5 A;  2ACZ B;  1JWB D;  1L5P A;  2KAC A;  2GI9 A;  3ABV B;  3AEB B;  3AE3 B;  2JX5 A;  2K9X A;  2L52 A;  4XE0 A;  1ET6 A;  3BVM A;  2MH7 A;  2DLB A;  2J53 A;  3W2D A;  1D5Z C;  1MHH E;  4HRO A;  4KGT A;  4RH6 A;  4EE2 A;  2SAK A;  4ARC A;  3AED B;  3BVZ A;  3VRB B;  2CJO A;  3LXF A;  2WU5 B;  1SE3 A;  3TEZ A;  1KRH A;  1RWS A;  2INN E;  3GS2 A;  2JU6 X;  5HFY A;  1UUP A;  2L32 A;  2KQ4 X;  3ETR A;  4RGM A;  4RFB A;  1QOG A;  1DYQ A;  2IPK D;  4XDC A;  2DWQ A;  2GB1 A;  3OWE B;  1PGA A;  1D5X C;  4UDU C;  1QOA A;  3NVV A;  3TEY A;  1ZP0 B;  1NEK B;  5MPO A;  1J7A A;  3NUH B;  4Q2J A;  2HDE A;  1JAL A;  2JXT A;  1AW7 A;  2L1A A;  2Y5P A;  5D3D A;  2E6X A;  1GB4 A;  2H88 B;  1I4P A;  3T3N A;  2J42 A;  1UNS A;  2M56 B;  2OED A;  2PTL A;  3NVZ A;  1CZP A;  1FFV A;  3IT4 B;  2BS2 B;  2FE8 A;  3B2G A;  1ROE A;  3RPF C;  4C7Z A;  1SE4 A;  2Y3A A;  4M0W A;  3SR6 A;  2M0A A;  1JML A;  2I38 A;  4OHJ A;  2QJL A;  4C80 A;  1EWC A;  1C4P A;  1I4G A;  3P4P B;  1WRI A;  3AV8 A;  1FCL A;  2DBY A;  2K3U A;  4A6Q A;  2KWD A;  4A55 A;  1RFK A;  4HKQ A;  2PVG C;  1ZXH A;  1VDV A;  3AE2 B;  4O1N A;  3DWM A;  2WLB A;  4GLS C;  1TYG B;  1QF6 A;  4P6V F;  1MI0 A;  1TS4 A;  4AQ7 A;  2QMT A;  1TS3 A;  1OQR A;  1C79 A;  3GB1 A;  4RGT A;  4WQM A;  1EWY C;  2PIA A;  2WXK A;  1HXY D;  1I4Q A;  1WXQ A;  2K5P A;  1SF0 A;  3FIL B;  1L0V B;  4MT5 A;  3LB8 C;  1SIJ A;  1PDX A;  2JZP A;  2WXM A;  5BYS A;  3U7Z A;  4D2K A;  2LEK A;  4CQN A;  2JSV X;  4XWW A;  1ZPS A;  3CWI A;  2LHE A;  2PMV A;  2W54 A;  4KKI A;  3KQ4 A;  2WDR B;  4ZRP A;  4PT5 A;  2BS3 B;  4RGN A;  1V1P A;  2WNM A;  2IGG A;  5BYQ A;  2L83 A;  2YEP B;  5BMH A;  3GP7 A;  1FRR A;  1CQV A;  4L2Y A;  4RGO S;  1NI3 A;  1SB3 C;  5C2T B;  1XO3 A;  4US8 A;  5HG2 A;  1BUI C;  3ZYY X;  4REZ A;  1C77 A;  2QEJ C;  3CF4 A;  2ONQ A;  3MHZ A;  4USA A;  1E7P B;  2BTE A;  2X38 A;  1NYR A;  3TEW A;  4YTN B;  3MJ5 A;  4RCO A;  2MJE A;  5TSS A;  3IT6 B;  2MJD A;  1F2R I;  1RYJ A;  3MP9 A;  1KH0 A;  2D5G A;  4YSX B;  3ZQ4 A;  2Y5C A;  2PW9 A;  3R8B A;  2ZW0 A;  1JWU D;  1C4A A;  3H8H A;  4JWS C;  5EE0 A;  5EE9 A;  3URY A;  3RFZ B;  4RF1 A;  1NYQ A;  1N5X A;  3AE6 B;  1K53 A;  1M4V A;  2BS4 B;  2WXN A;  4RNA A;  1XLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...