2AD1A

Human sulfotransferase sult1c2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
287
structure length
244
Chain Sequence
TKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRFPFLEMKISGLEQAHAMPSPRILKTHLPFHLLPPSLLEKNCKIIYVARNPKDNMVSYYHFQRMNKALPAPGTWEEYFETFLAGKVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDKIVHYTVGDWKKHFTVAQNERFDEDYKKKMTDTRLTFHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and chemical profiling of the human cytosolic sulfotransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Sulfotransferase 1C2
total genus 79
structure length 244
sequence length 287
ec nomenclature ec 2.8.2.-:
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ad1A00
4DWJA 3FE2A 2FWRA 1YU9A 4HB0A 1Z63A 3DZDA 5A5GA 4NE2A 1SKQA 3A1WA 4BFUA 1U90A 4S35A 1KZ7B 1ZNXA 4H1VA 4XD7D 5EQTA 4BFZA 1Q1ZA 1SKYE 2WOOA 2KB0A 4PO1A 2WKRA 3CM0A 4YQFA 4OK3A 3FPAA 2ZJBA 3FHTA 1HE1C 3RHFA 4A2PA 1OIXA 3TSZA 1KMHB 2REOA 3ONWA 4JLMA 3RRMA 3VAAA 4B73A 4QBIA 4MKIA 1HURA 3GFTA 2HYIC 4PANA 4TT3A 4EKDA 5GADl 4CZ2A 3GP8A 2IYLD 3K0CC 3U7HB 2A9KA 4TYPA 1Z83A 5CITA 4MGKR 1Q57A 5SZKB 2HV8A 1M1YE 4QJ3A 3SJCA 2KBFA 3GFOA 2DBYA 1OFUX 3H4MA 3R7WB 4I1OA 4IEEA 3CNOA 4JLJA 2PZGA 421PA 3PFIA 1XEWX 1KKMA 4HAUA 2V3CC 1GKIA 3DDCA 3L0IB 3W6PA 4G5QA 2OFXA 1N0VC 3ECCA 3WXMA 1FX0A 3GLIE 4OI0A 2YJTD 3DPUA 2HLDD 3BB4A 3BFVA 1E69A 1KDOA 1S1CA 4C4PA 4CIDA 1AS3A 1JBKA 4PX9A 3WRYC 4V0ME 3WNBA 5BWMA 1XZQA 4L5BA 2DWPA 5J4VA 2R6AA 4R2HA 1VYTA 2V7QD 4QM6A 2AD1A 1W4CA 3KXKA 5LPNA 4JL6A 3H2YA 4C0KA 1K5DA 1OXXK 1EWQA 1RVDA 4ZCIA 1W48A 1XNJA 3K09A 4XSHA 3TSOA 2FFAA 4O25A 2IYTA 3OHMA 1E32A 4FN5A 1KY3A 3BIFA 4QGGA 4TSFA 4A0HA 4DIEA 2N1BA 4C0AC 1H8HD 1K6MA 2DFNA 1VKJA 3VKHA 2E9SA 2J0SA 5SZIA 4LV5B 2RHDA 4NCNA 1DAIA 5JZVA 2IWHA 3QIAA 2RGAA 2JAQA 3CONA 3QPUA 1IAQA 2G3YA 4OQNA 2Q9BA 1L8QA 4G1UC 1N5JA 4GL2A 1MO3A 3KUDA 2WJGA 1SVKA 1XCPA 2ZI5A 5JCPA 4NPHA 5JI3E 1O3YA 1DAEA 3FGNA 3I8XA 2YOHA 5JJIA 5EXSA 1MO5A 1G3QA 4QXAA 5DI9A 1Z6YA 1E1RD 2RGCA 2IS2A 1TQ4A 1YZLA 1IHUA 1Z0AA 2E87A 3IPXA 4Q1CA 4DUGA 2J0QA 4TYWA 2VPPA 2HDNB 2PLFA 1NI3A 1XDBA 3PCRB 3U3JA 2GAAA 5TMPA 3W8NA 1F2UA 4RZXA 4U02A 3O8RA 2P65A 1II9A 5DNYB 4B6FA 4URWR 1AM4D 4BZXA 1FUUA 2GK7A 5BQ5A 2NPIA 2ZITA 3UIEA 5ELXA 1CJTC 3ADDA 3THYA 2G1KA 4URXR 3EC2A 4YONB 4UJ5A 2F9MA 2PCJA 2ZR7A 5KSOA 2J87A 3I5YA 3LWNA 3KKQA 2YNMA 4DLVA 1L2TA 1O87A 3A1SA 4DSUA 1GITA 3M0EA 1FX0B 1M7HA 4JLBA 4KU4A 4M0LA 2NPFA 4B3XA 4DUGD 1YZGA 3UKDA 3DZ8A 1F5NA 3BBPA 5JLJA 1U94A 3CWQA 1Z5ZA 1CTQA 2WV9A 2PMKA 4YMUA 4B75A 3U4QB 4EDHA 3GFPA 5JEEA 5JECA 1RRFA 1PUIA 3TBKA 4DBLC 3KB2A 2FOLA 3AVQA 2EYQA 3KQNA 2GJ8A 3KL4A 3DMNA 3LLMA 4TTQA 4OHYA 2PEZA 4YMTA 4AWXA 1RZ3A 1P4SA 3M1IA 3AUYA 4B44A 1KTVA 2IYWA 1IXRC 3RANA 1GTVA 4F38A 3AGQA 4MRRA 1D5CA 4W9MC 1DAGA 1TEVA 3U6BA 2AL7A 4MDEA 2CVHA 4POAA 3EASA 5FTMA 4TMKA 2IXEA 5BYJA 1JPJA 2XZOA 4BE7B 2JGNA 4LHXA 4AK9A 1KI8A 2ZM5A 3VR1A 3I73A 1R4AA 1KI6A 4WZBE 3AVWA 1F3OA 1NRJB 2OV2A 3GLHB 4PAQA 2F3RA 2OBNA 4C0BA 4HUQA 4QOSA 2G88A 4OHZA 3X1YA 3ZD6A 4RZUA 2WWWA 2QMUA 3WHLA 2ZI3A 2IYRA 1RC8A 4CEHB 4QGHA 4WZAE 1BYIA 1NBMD 5J4KA 2P5TB 3BOSA 1ZCBA 2DPXA 4GI7A 4HATA 5GVRA 1JECA 1KSJA 4M9SA 1FTNA 3LBIA 4TL6A 1C4OA 2VBCA 3B1VA 3FYHA 2ZJ5A 5B30A 2DFLA 5DHFA 4G5RA 4P4SB 3VHLB 5LDDC 4EPTA 1S0UA 1COWD 3BGWA 3S1AA 1ZM9A 4JSTA 4TL7A 3LY5A 5G53C 1W36D 4ZKEA 3BE4A 1UFQA 2F9LA 5AJZA 2QORA 3MWKA 3ZVLA 5JSZA 3K70C 1E2HA 2AX4A 1I4DD 1II0A 1OV4A 2QTFA 1IY1A 4B32A 4IXMA 4B3FX 1MABA 4GNKA 3UPUA 2QGNA 1KK2A 3TVDA 1JXOA 2IS1A 1GSIA 1VHTA 2K5UA 1I4TD 1RRGA 1IN4A 2ZRHA 3NKVA 1FOEB 2ZS9A 4TYNA 4PPQA 2ZU0C 3TRFA 2BOVA 1IY2A 1Z0JA 2FFQA 3U3RA 2R65A 2EU8A 1GL9B 1SULA 4JBWA 4ASUD 2XITA 1OE0A 1GG2A 4PSVA 2QI9C 5JBQA 3TJZA 3TQFA 4F4JA 4ZCMA 1DPFA 4XD7A 1CKEA 1I2MA 2NO0A 4ZO4A 3VR3A 4Q00A 3CO5A 4P33A 2GA8A 2IYSA 4KBGA 1Q44A 3A6PC 2O8FB 3P27A 4MYTA 3SDZA 1GILA 4A2QA 4EPYA 4WW0A 2MMGA 1XCMA 5EE0A 1OHHA 3EARA 2G77B 3HYTA 1OH5A 2OZEA 4TTPA 1FPMA 3U6KA 4M1YA 1XFAA 2XAUA 2VHJA 2GXAA 5CB8A 1TU4A 5A0FA 5P21A 2QQEA 3GLFB 2CLSA 2A5DA 4ZV4A 1OLOA 1X86B 5DN6D 5GVSA 1CP2A 2QAGA 5KU1A 5JWHA 2CBZA 3TVTA 5HZKA 2JLRA 221PA 1S2MA 3DKVA 3UMSA 3ZJYA 1G9XA 2CHGA 3NBZC 1OJLA 2H5EA 1D2MA 2ZTSA 3QNUA 1QZXA 2JJ2A 1DAMA 2OT3B 2QROA 4D0NA 3FVQA 1F2TB 4TSFD 4JLVA 1OF1A 2JLVA 1T0HB 3K0FA 4IVQA 5HKKA 3U5ZB 2XSZD 2IC5A 3IIKA 1WDTA 3ZYCA 1OH7A 3ZD7A 1OB5A 1SXJE 1KIMA 2QP9X 4GZMA 4MGZR 4F93B 4IOMA 2QAJA 2W2VA 3KTAA 2A5JA 2QMHA 1V5WA 1Y63A 5J47A 1TX4B 2AN9A 3EZ7A 4UNRA 3U7FB 4HEJA 5HE9A 2OCYC 3AQ4A 4LX0A 4BLSA 4XIGS 1KZGB 3FMFA 2CE2X 4TWZA 5JSZB 2OXCA 1Y3AA 3LO5A 3HPRA 3IHLA 3EXAA 1T91A 4ACBA 2F55A 4OI1A 3PJRA 1CF4A 2C9CA 3QXXA 3KQUA 1HH4A 4J0QA 2GBLA 2CCKA 5DLQC 3GLIA 2IL1A 2PEYA 3B7GA 5DSZA 1WE2A 1E9BA 2J41A 8OHMA 5FOWA 3VR6A 4UXHA 1AA9A 2ZJYA 3K9HA 2VL7A 2QENA 2RGDA 3X1ZA 5EP4A 5JS7A 3HDTA 1EFRD 5DI3B 2ZI4A 1W0JD 3GJ4A 2OCAA 4HZUB 4Q5IA 4IDOA 1Z0FA 3JZAA 3VKWA 1UEIA 2FE4A 1NJFA 5KPDA 3AM1A 2ZE7A 3JVVA 4TT3D 2HT6A 1JALA 1LW7A 1QF9A 1A1VA 3WBKA 3BC1A 2D4HA 1NY6A 1II8A 4KCGA 3WP0A 1M7BA 3BRWD 1R7RA 2GJKA 2IXGA 3X1XA 2O8FA 1LTQA 5CLQA 1MOZA 2AR7A 1Q21A 3BD9A 5IDVA 4DDUA 3VMFA 2YYZA 5HZHA 2ZUDA 3C16C 2P67A 4Q4LA 1GP2A 5E4FA 1C9KA 1U8YA 4R7ZA 5K8LA 2EW1A 3ZVMA 1YZKA 1KK3A 4E03A 1KI7A 4QJ5A 1Q22A 2ZQ5A 2GWHA 3TAUA 3U3OA 1OIWA 5FUVA 2J7PD 4DDVA 4A6XA 3VNUA 4DCVA 1DO0A 2CK3A 4FINA 2VHTA 1JB1A 3D8BA 4FCTA 5FBVB 3F5FA 4ACAA 5J4HA 1P2TA 1P9WA 3DL0A 1IJEA 1JR3A 1W4AA 1T6NA 2FPKA 3EPKA 3VNVA 5FTKA 1FL9A 3C4JA 3MFYA 4R2IA 3WMEA 2VHUA 4FMCF 4LV8B 1QVRA 3I32A 1VCOA 1M2OB 5TV2A 2OFWA 2CNWD 1PZNA 2GXUA 2YC4C 1J2JA 3T61A 1NIJA 3HPQA 4D4LA 5D3QA 1KSGA 2V1XA 2ZRKA 1AS0A 1S96A 2BBOA 1P60A 4OQXA 2OAQ1 2JLWA 4RCYA 3WBJA 3BB1A 2O52A 4N0DA 4LGMA 3P26A 4BLQA 2ZS8A 2VYFA 4WOPA 1PVOA 3PITA 4UXIA 2LKCA 4XVRA 3RRNA 3NWJA 3SQWA 4MRVA 2HXYA 4LHWA 1MO4A 5IHPA 4AKIA 3I72A 4I81A 3G5UA 2YWGA 3OEHA 2B6HA 5CJ2A 4JKIA 2OE2A 3HJNA 4JVSB 4BPBA 4XVQA 2D7CA 5DH9A 3MCAA 3QKRA 4GRAA 4TTRA 3QY0A 2NMVA 1Z47A 3U2QA 4HZIA 4PSAA 1P6XA 4I1VA 1VTKA 3A4MA 1EFHA 1KJWA 1ZUHA 2VO1A 2V8OA 1E2NA 1NY5A 2W83A 1NLYA 4K8OA 3NHBA 1XZPA 2EFHB 2ODEA 3MAAC 3RC3A 4I99A 5FL7D 2IT1A 3C15C 3GJ7A 3OIUA 5B58C 1IOZA 3SYKA 3TE6A 1JNYA 2ZI6A 5FPKA 1W5SA 4C0HA 2KSQA 4IXNA 1E79A 4EFLA 3A8TA 1M6NA 4LHVA 3U60B 2FSFA 2QE7D 3I5XA 5TY0A 2FV8A 3TGPA 3THYB 3OF5A 1KK1A 2O8DB 1N6KA 3A58B 4RD3A 3K09C 5CK5A 4YXWA 3EIEA 3GJ8A 3FMOB 2OLKA 3IBGA 2XTNA 4Q19A 4LBZA 3LW8A 2W0SA 3GJ6A 3BFKA 1J8MF 1G7SA 1E96A 2RGGA 1XX6A 3BK7A 3IIMA 4JL5A 3EPHA 4PC2A 2R62A 2B21A 4MYCA 3M6AA 1N6HA 1W0JA 1M7GA 1SKYB 3HU1A 1EFRA 4OL0A 3THXB 5GJWC 3T5DA 3AVUA 1YKSA 4LPKA 4OK6A 2ASEA 2OBLA 2BJWA 4G3XA 1G64A 1NLFA 4Z8YA 1P7CA 3RLFA 3PENA 1OH6A 4JJZA 4RD2A 3CF2A 3VQTA 3MD0A 4RD1A 2GZDA 4A6PA 1ZC3A 2JASA 2QEQA 3GLHA 1M74A 1G3UA 3K9NA 2NO6A 2RMKA 4LJ6A 4WXRA 2B8WA 3ZH9B 4UJ3A 1XU4A 4OI2A 1NG9A 2ZIAA 2YHSA 3B8HA 3GJ3A 1GDDA 4HLUA 2H92A 4FMDF 4FCVA 1N0WA 5SZJA 2W2XA 3D3QA 1Z2AA 1XEXA 5E95A 1E9CA 2FPMA 3BS4A 4DLXA 4RD0A 1N0UA 4GMXA 1XPUA 2W6JA 3Q8XB 4N3NA 5E7MA 3S1AB 4BLTA 1GRQA 2ATXA 2XOKD 4KODA 2BBWA 4NYJR 4XTRA 2AWOA 4Q1EA 2D7DA 5KNBA 5JMTA 3LA6A 2ODWA 1VIYA 4QBGB 4RD4A 4PAMA 1LS1A 3FKSA 3OIVA 5KPJA 2JLYA 1FNNA 4WZ6A 3OESA 4PO9A 1US8A 4I1UA 4QHSA 3P4XA 4QBFA 4OJKA 3U7EB 4V02A 4AURA 1L4UA 2X19A 4H1UA 2ZRPA 1S9DA 2WICA 3NTUA 4KLZA 2ZUCA 2FMXA 1TF2A 4X8OA 1Q0UA 4G5OA 1G8FA 4NYMR 4AKGA 1TU3A 4CVNA 4L9SA 4EIWA 3AP3A 3IO5A 2GF9A 5FOTA 1KY2A 3W9YA 4ERNA 2PLRA 5FI1B 2FFBA 2LKDA 4P4SA 1P72A 3EZ9A 5ANRB 4CW7A 5CDFE 4Q4HB 1UBCA 1S1MA 4W7SA 3NHAA 5HE8A 1JJVA 3L43A 2JLSA 1VHLA 2YOGA 4NYIR 2WWXA 5KNCA 3T06B 2EFDB 1EK0A 1Z0KA 2RHMA 1OYYA 4IVPA 1K8RA 2QPTA 1VG1A 1KYIA 4QKQA 3CH5A 3GLFA 1TADA 4A2WA 2ZRNA 1CBUA 2D3WA 3W3AA 2ZXUA 1AQUA 2OM2A 4B3GA 1BMFD 3NBYC 4Z1MA 3Q85A 1YZQA 1DELA 1NNEA 1MV5A 4Q02A 3DKPA 3O8CA 3EX7C 4TYQA 4B6EA 2C9YA 1E9AA 1GL7A 4CF7A 1NF3A 2YV5A 5EP2A 5KDLA 4PXAA 3SBDA 1U8AA 2BHRA 3WHKA 2QBYB 3JVUA 1OB2A 2GF0A 2BEJA 2C5LA 3FTQA 4S2EA 1PV4A 3Q5DA 1SXJC 1Q1EA 2DWOA 2P3SA 2PH1A 1JEEA 2ATVA 2R6CA 1IQPA 1X8JA 5FTJA 3ZIAA 4PC1A 1LB1B 3I62A 3K0AB 5EZ5A 2ZR9A 1ZC4A 4MYHA 2CJWA 2VSOA 5CLLA 2FZLA 2QL6A 2BWJA 1OIVA 4KYUA 4AD8A 4QFMA 3AEZA 2FEMA 2QMEA 3W5JA 2CLCX 1JAHA 1YVDA 2C78A 2IF2A 2WJIA 4JZKA 2QQ0A 3REGA 5LD2C 2GVDC 3EA5A 3OZXA 3MMPA 4BFYA 1UKZA 1ZNZA 4DKXA 4O2LA 2C2HA 1Z08A 2OSBA 2WWGA 4CEJA 4LC1A 1CR2A 3CX6A 2RKOA 4RFSB 1XPOA 4R9UC 4XSGA 3SU8A 4IOKA 1NBME 3K70D 4P0TA 2RGNC 5C2JB 4GPTA 3A1VA 5FPYA 1JXMA 4PPNA 2GEVA 1F2TA 3QBTA 3QG1A 5FBLB 2Z4SA 4AYWA 1WCV1 1ZU5A 5E3HA 4DEXA 2YWHA 1BH2A 5J4LA 2CEAA 5F9FA 1CJMA 3GJXC 4PPGA 1QHIA 5UKDA 1R8QA 4OKSA 3TR0A 4MQBA 4EPWA 2B7BA 3RYTC 3O8DA 2BKUA 1R8SA 4GMDA 2VQSA 2ZYUX 2WJJA 1KKLA 1NSTA 4JLKA 4KFTA 1D6JA 1WRBA 3KJHA 4LJ7A 3RS2A 1KNQA 4D4JA 2O8CB 4GP7A 3CKLA 3QJYA 2O0HA 3WMFA 4TLCA 2VH5R 2Q3FA 1UKVY 2ZYVX 4F4IA 4IOLA 4RCZA 4WAUA 2BMDA 2WTUA 2R6FA 5EE9A 5GJVC 2GRJA 2W6IA 1RIFA 2GEDA 4L9WA 1TQ6A 2GVZC 4QL3A 1MR3F 1UJ2A 3FFAA 1ZM7A 2ZEJA 3EZ2A 5DGXA 1KI1A 4QGFA 3V4RA 4D2IA 3CBQA 3FB4A 3I4LA 5EXPA 4DLRA 4M53A 1E2EA 3SI7A 4Q4JA 2P0EA 1ELOA 2ZRLA 5AJVB 1TTTA 3TR5A 4A15A 3A37A 1II8B 3QBVA 3UWKA 3NEJA 4RKEA 2J59A 5EXXA 1YJ5A 4B71A 2JA1A 2QZ4A 5H70A 2ECKA 4RVCA 3FFBA 2D62A 4M1TA 1I4LD 3T1VA 2AK2A 3K0AA 5FUYA 1E0SA 5JFGA 2WWIA 3GLGB 1ESNA 5DO9A 4IHQA 1T3SA 2CLDX 4MKFA 4CEIA 1S3GA 1UBFA 1XPRA 2D2EA 4IRUB 2XZLA 1KO1A 4LJ4A 5IK2D 2F43A 3UXMA 3K0EA 4TLAA 4WVFA 5K8IA 2NIPA 2MMCA 5KHOC 1FQKA 4ZDKA 3PR1A 4RFSA 3V4FA 1MKYA 4BRUA 2PX3A 1Q12A 1H8HA 4MA4A 1YR6A 3K1JA 3LAWA 4ABYA 4A0FA 1G19A 1HY3A 4LC0A 2E1RA 3SN6A 3V9PA 3QG5A 4AIIA 1XWIA 2J9RA 1N6RA 3K0SA 2VEDA 2XB4A 4PTLA 4WXPA 2JEOA 4LPSA 2X1VA 4UNPA 1W7AA 1E9FA 2HEIA 1R0XA 5LB2A 4GOJA 1KO7A 2GCNA 1QHHB 4XVUA 4Q1AA 2JLXA 2O8CA 4QRHA 3RS5A 1KI9A 5EE1A 3OAAA 4ESHA 4JBXA 2Z6VA 5IRCD 4DCUA 2EFEB 3IUYA 1OXUA 1AIPA 4IDNA 1EWRA 3GD7A 2HLDA 2XTMA 2QUZA 3B1XA 4V0KA 5EXTA 3R8FA 5TB5A 2GZAA 4A8JC 3WRXC 4UXJA 1QG2A 3IDQA 1QVAA 2FSHA 3A4LA 2H1LA 4DSTA 5F3WB 2V55B 2F1RA 2QU8A 2ORVA 3LX8A 4TMZA 1P75A 1TQ2A 5AJWA 1GKYA 1Z6TA 4MUBA 1KJZA 2BCGY 5FL3A 5KTYA 5KSZA 5EP1A 1SXJB 4ITRC 4FCWA 3ZZ0A 1KAGA 3LD9A 3MJHA 2PBRA 3U7GA 2Q21A 2H8KA 1ZIPA 2G0NA 4TZ6A 2HCBA 3X1WA 4PHFA 4Q4JB 4DLUA 2WMNB 3SQXA 3RSOA 1OXVA 1T8UA 1E98A 1KJYA 1RKBA 4XWOA 2ZS7A 1A2BA 1XTSA 3ZZUA 3MLEA 5KSPA 1DG3A 5L3VA 4DDTA 2QT0A 5HR5A 4TYYA 3I61A 2KE5A 1EESA 1N25A 4XWAA 3QXCA 1ZIOA 2UKDA 2WPDA 2WSSA 3RRZA 1W36C 3ZZTA 4B47A 3KKMA 5FBQB 4FI3C 3X2SA 5DHAA 4UKDA 2W0MA 1N6LA 3H84A 3SFVA 3KZ1E 4B2LA 2OLJA 3R7WA 2CL7X 1KGDA 3DVLA 2WKQA 1HE8B 3W90A 2O8DA 2X2EA 4FMCB 1NVXQ 3PUYA 1XD2B 1XEWY 2QGZA 2WPDD 2WSSD 4M22A 4LHYA 5H68A 4AG6A 3KFXA 2OAP1 1NN0A 1CRQA 4FWIB 2ODBA 2R8RA 3QENA 1QHYA 1XXHE 4LCBA 2F1HA 1L4YA 2DWQA 2KBEA 1Q1QA 3W3ZB 1G8HA 3CUEF 1E1QD 5FPTA 3P32A 4B3DA 5BN5A 3SE0A 2QMOA 4W5WA 4C0QC 1G4AE 2GZHA 2XXAB 2EFCB 4HAXA 4Q21A 5G40A 3U61B 3EZFA 2QA5A 3OE7A 2D2FA 3I3SR 4LWZA 121PA 1VIAA 4NZYA 2IX3A 4QGAA 4X8LA 1KSFX 2KWIA 1XEFA 2GNOA 2FX3A 2HXSA 3PUXA 3UK6A 3RWOA 3VX4A 1YR7A 4DIDA 3GMTA 4LY6A 1D2NA 2C8VA 4KFRA 1K5GA 3U44B 2GJAA 4OK5A 3CIOA 2FA9A 1E2GA 3ZDQA 4DCSA 2J0VA 2PL3A 3QE0A 4PZZA 2ZAOA 2C9OA 3B82A 4GDFA 4B2PA 2OFOA 3OAAD 1IY0A 5HCNA 3PQCA 2J7KA 2MSDB 4URUR 1N5IA 2HYDA 3TSWA 1SXJA 1NMYA 3TIFA 1V43A 2ZRIA 4V0LA 3W34A 2OHFA 1XTKA 2Z43A 2ZU6A 1N6IA 4LJAA 2R9VA 1Q1BA 2B92A 2IF0A 3RNLA 1XEXB 4BEBA 1MRNA 1N2CE 1R0WA 4LZZA 1CJKC 5FR1A 5EJEA 3SFZA 4PPFA 4LYFA 2L0XA 1HQYE 4NYJQ 4P32A 2VSFA 1CR4A 4NCJA 3RWMB 4PZYA 2IEZA 3RAPR 4JIMA 5SZHB 1Z29A 4M2LA 3SJBA 4ZDIA 2QPOA 1ONBA 2QG6A 2PZEA 5IK2A 1W5TA 1JI0A 1SQ5A 1E2KA 3QXJA 1ZM4A 2WIAA 2OCPA 1Z28A 2VSXA 2ZRFA 1UF9A 3GPLA 3K9LA 1WQ1R 2ZROA 1FTSA 4KVGA 1KI3A 2QP3A 4MYUA 1DO2A 1D9ZA 1X1RA 4BLRA 5GJBA 2QP4A 4B48A 4P31A 4JVNA 1WA5A 1RJ9A 4NMMA 3ZQ6A 1W0KD 2JJ1A 1AS2A 4BECA 5AJYA 2J1LA 4D81A 1UAAA 2BJVA 4BFWA 1SVSA 2FEOA 3D7MA 3DMDA 1EX7A 4Q4HA 1GFIA 3E5HA 3AF3A 4YMSA 3SHFA 4MKHA 3QQ5A 4JJKA 4BFXA 4DLTA 3E70C 2XJ9A 3AKDA 4TN1A 1CU1A 4V0NA 2REXB 4BUJA 2AK3A 3SBEA 4GBMA 1ZM3A 4IEIA 1QHGA 2C03A 4PQRA 4W5JA 4B35A 2NGRA 4LJ5A 721PA 1XMJA 1Q20A 1F60A 2XNDA 2XGJA 3PUWA 3U3KA 2NO1A 2UZIR 4P4TA 4YC7A 1P2SA 1OPXA 5AK0A 4EPXA 5CIQA 3LW7A 1GNRA 2WOJA 4Q9JA 1FP6A 2QTVB 1YRAA 4DCNA 3BAFA 4HUQB 2ZRBA 2AKAB 1N5LA 4Q03A 4M1SA 4PO8A 2WBLC 2V1UA 4IKEA 4WA7A 3RVBA 2QBYA 1IXSB 4A92A 2WM9B 2VHCA 2FF7A 4B3BA 5JI2E 3A36A 4BGDA 3OFNA 2C77A 1X6VA 5JWOA 3NH6A 4KHZA 1OH8A 5TVKA 3ND8A 1DS6A 1ZJ6A 3LQQA 5CJPA 4Q9IA 1YE8A 4M9ZA 3T1OA 2NTYC 2A2ZA 1NMXA 4NHOA 2JDID 3EZ6A 4LBWA 1P5ZB 2PJRA 3UG6A 1UBEA 2ZRAA 4DHEA 1AQYA 4XWKA 1YHNA 3MG9A 3ZS8A 3WYAA 4BASA 4UNNA 1NKSA 3AF1A 4US1R 2YZ2A 3UMRA 4IDQA 1G4UR 4C0JA 4E22A 3R9XA 4M21A 1TUEA 1UPTA 2ZI9A 4Y0VA 3MGCA 2GK6A 2IUUA 3VR5A 1J99A 4DLWA 3QF4B 4URVR 4PR0A 1E3MA 2B7CA 2DB3A 5G41A 4AKHA 1E4VA 3OEEA 2GHIA 1LS6A 5JRZA 2A7QA 4DLZA 4RZ3A 2NO9A 2ZUBA 1ZNYA 2YC2C 2ZJAA 3QPVA 3W6OA 1P9RA 4QHYA 1YR9A 1YZTA 4BEJA 5C46F 2Z5FA 2P2LA 4TZ0A 1EXMA 3PXGA 5FTNA 2BCJQ 1XMIA 3IBYA 1RYHA 1ZD8A 4GOKA 4NYMQ 5D3MB 4UNQA 3IEUA 4RKFA 4JT4A 2ZSBA 4M1KA 4A8JA 4TQ9A 3CNLA 1BMFA 3GLGA 4KJZA 3VR4A 2ZJZA 4JLDA 5BN4A 4CEIB 4YMVA 2SHKA 4HAWA 1NJGA 1SVIA 4N1AA 1N3BA 1N6NA 5C18A 2BEKA 3UWOA 1PLJA 4LBYA 1IN8A 4LHZA 2GTPA 2ZAMA 4EUNA 2HF9A 4WBSA 4BZPA 2QM8A 4EPVA 1S3SA 5JEDA 1XTJA 3E2IA 4HB4A 3T35A 2OXRA 1T0JB 3QPWA 1OW3B 4PAOA 3AKEA 4JS0A 3NC0C 1YQTA 2O0KA 2ZYWX 1GAJA 2ZVPX 5A4JA 3E1SA 3W6NA 4XTCS 4LSGA 1AZTA 4JVMA 1CEEA 5G3YA 4BLOA 3VHXA 2GDJA 1ZD9A 4LYHA 1ZD1A 4TLBA 1B0UA 4KV9A 1WBBA 3L82B 1LFDB 3TW4A 3QKTA 3AVVA 2P5SA 2MSCB 4TQUS 1NVWQ 5JWRA 1VECA 4M9QA 3QVVA 1E2FA 1HEIA 5H8WA 4F92B 4MITA 4MH0R 2R2AA 2FPLA 4M8NE 5KO2A 2RH5A 2AXNA 3FKSD 3CX8A 4DRZA 1OKKA 1G8YA 1GOTA 3QKUA 5DE3A 2GETA 1J8YF 1ZUIA 1PLLA 3HU3A 2WAXA 4YDSA 1VDZA 4HDOB 4ESVA 3AKYA 1OKKD 1G20E 1NL3A 1VYVA 3HYRA 3O47A 2ANCA 1KK0A 4NKRA 3KQHA 3AVYA 2VHQA 2D74A 4Q66C 5BXQC 2EVWX 2QSZA 2ZRDA 1KO4A 3T15A 4D4MA 1A82A 4MKGA 1IONA 1P3JA 3OFND 4HZUA 4CT5A 4DCTA 3WYGA 4DDWA 2ZPTX 3A1UA 1PLKA 1SHZA 3BERA 2CHQA 3CH4B 4UQOA 3ICQB 1ZU4A 2FFHA 1RRPA 4M1OA 4L15A 2CL0X 3R9WA 4LYAA 2DYKA 3PVSA 1G8GA 4QJ4A 5HTKA 3LXXA 2WMOB 1U9IA 1ZINA 2Z83A 2ONJA 1OXTA 1SGWA 1H8ED 1EX6A 4Q01A 2WZQA 4TMWA 2DY1A 1ZNWA 4C7OB 4IOJA 2WJHA 6Q21A 1RFLA 3IGFA 2W58A 1JPNA 1WF3A 2F7SA 2XZPA 1E4YA 2XNDD 3SR0A 2R6DA 1GZSA 3P4YA 1AGRA 1AK2A 1JQLB 4URYR 2QM7A 4RY2A 1LNZA 3I92A 1IN6A 2BBSA 2REBA 2V4ZA 3SHWA 1E2DA 1QG4A 2QAGC 2F6RA 2GCOA 2OILA 3FMPB 4JYCA 4Q47A 2C98A 4BZQA 1C1YA 4R98A 4E09A 1U2RA 4FIDA 3IIJA 4AY2A 3KUCA 2FH5B 1ZUNB 1IM2A 3GLGE 4BWYA 1I2DA 3JZMA 3LNCA 4JLNA 3B6EA 5F2EA 3EIQA 2WWHA 3EWAA 2X8AA 4C0SA 1NSFA 4X8HA 1ZVQA 2BIFA 4DB4A 3HR7A 2RAPA 4DB2A 2RGXA 4Q7JB 1W2GA 3ASYA 3CZQA 3LDAA 4CYMA 2EQBA 4Y0AA 4YXWD 2CVFA 2OBMA 2C95A 5IF9A 1YRBA 5EP3A 4US0R 2H16A 1LY1A 2GCPA 1G16A 3KKOA 3OEED 3ZS9A 1W2HA 1XTQA 3U44A 5JRJA 2GXSA 4IFEA 3B9QA 4KITB 1CRPA 2NG1A 2C04A 3NEYA 2TMKA 3N2IA 4DXAA 2G9NA 3NC1C 1FFHA 1WMSA 4O2RA 3FHOA 2BMJA 4GSYA 4E07A 1E2LA 3QXSA 4JYBA 3AH8A 2JIZA 2NZJA 5FL7A 1KNXA 3QKRB 3R20A 1SVLA 4LOAA 1CIPA 3SS8A 2PMDA 5AUQA 3R8CA 3TUJC 2JCSA 2J46A 3KJIA 3QUSA 5EZ6B 1E9EA 3TAHA 4Z51A 2XTZA 4JL8A 3SJAA 4TMTA 4JBYA 1SXJD 3CF0A 4BFVA 2CHVA 4ILEA 1BKDR 3RS7A 1JAIA 1UDWA 2HT1A 4OYHA 1QRAA 1QHNA 4TMXA 4AYXA 2LWIA 1NVUQ 1ZP6A 3CRVA 3OEHD 4RJLA 2A30A 3L8YA 3MUFA 5L3QA 4Z8XA 2ZJ8A 1D2EA 3AF0A 3NH9A 1UKEA 3K70B 1Z6AA 4ZKDA 1G3MA 2BMEA 2J0UA 1XCGB 4LJ9A 4QG7A 3IO3A 5FOUA 4IW3B 1G291 2KJQA 1TQDA 1EG7A 2QRZA 4B3CA 1DEKA 2Q3HA 5FR2A 2PT7A 1U81A 1XTIA 2YINC 3K8YA 2PX0A 2GCOB 4KSCA 1W44A 1AGPA 1G21E 2A5YB 2FG5A 2BM1A 2FSGA 1S4QA 3V00A 2IWRA 3WYFA 1RJ9B 2BM0A 1LV7A 4HLUC 4DEYA 3DM5A 2CNWA 4ARZB 4HYYA 5L8VA 4GP6A 4MDFA 2B8TA 4HLCA 2IS4A 1XXHA 3ZGXA 3QF7A 3CPHA 4RSGA 1T3HA 1JR3D 1A4RA 3AVOA 4KVAA 5K8TA 3CB4A 2JJ1D 4PC7A 4PQFA 1TL7C 4HI0E 1S8FA 3WP1B 1AN0A 3VKGA 1FQJA 4Q9HA 4Q7LA 3LLUA 4PHHA 821PA 1HQCA 3F3YA 4AG5A 4C9BA 3THXA 3I8SA 3C5CA 2J7PA 3Q72A 4XOIA 5FUWA 2AD5A 3VX3A 3KXLA 621PA 5L3SB 1WXQA 3PEWA 1BIFA 1D8TA 4Q7MB 2WIBA 2XNSA 5CIWA 4D82A 3I1FA 2NQ2C 1DVRA 5BW8A 1GM5A 4G5GA 4D4KA 4NU0A 3TK1A 4F4CA 3OIWA 3AV0B 5CDFA 2CMKA 1F48A 3UANA 3BH0A 1VPLA 3KXIA 1RPZA 1OT3A 3EWSA 1FP7A 4WIAA 2IYQA 1Z6XA 5IT5A 2FN4A 3NDPA 3ZVNA 2YWEA 2IA5A 1HTWA 2OUKA 4HDQB 5FBWB 2P6NA 1E9SA 3B1WA 5AR1A 1G1MA 1WB9A 3VU9B 2QSYA 3T34A 2Q0HA 4JT2A 3KX2A 4OQLA 3KFVA 3G0HA 1NP6A 3B9PA 3AVXA 2WAYA 1CXZA 1TUIA 2QTHA 1RYFA 5CM9C 4YDHB 4MRSA 2VP4A 2IHBA 3REFA 1P9NA 2RGBA 2XB2A 1HA3A 3AGPA 2ZSAA 3IPYA 4TL9A 4V0OA 2NZ8A 1TMKA 3IKJA 4AC9A 1OYWA 5KNDA 4YMWA 3WY9A 3KQLA 2Z0MA 2VP6A 4JSYA 3KKPA 5B2ZA 2J0UB 2J5XA 1E9RA 3BORA 1Z22A 1DAHA 4TLEA 3LBNA 3LV8A 1R5OA 4M1WA 2ZI7A 4PZLA 4LRWA 2CL6X 4Q9KA 2GJSA 5J4YA 2RB4A 3GEEA 3PIRA 2WJVA 2HF8A 3EA0A 2V6IA 1X8KA 4BRWA 4NTZA 1G7CA 2G0TA 3NDBB 4A9AA 2PCLA 4OBEA 3B78A 2C99A 2HJVA 2XSZA 1BO6A 3L8ZA 2Y8EA 4C2TA 1XD9A 1CR1A 1E0JA 4Q1BA 3OE7D 3D31A 3CPEA 2JJ2D 1MH1A 3TQCA 2EFGA 5EUQB 3DHWC 3THWB 1DARA 2IUSA 1P2VA 4HB2A 4OJQA 4HSEA 4A8JB 4EQ6A 4P4UA 1DAKA 4D0GA 1UADA 1ZMXA 2ANBA 4XH9B 4AKEA 3B13B 1OFHA 3ZLJA 3GLIB 4PFSA 3C41J 4IDHA 1NG1A 5KYKA 4O3MA 2ZYTX 1U0HC 2Q6TA 1OHHD 3QF4A 2ORWA 5FTLA 3T5GA 3LX5A 2A78A 3SYNA 1M34E 1U98A 1G41A 3CF6R 5AUPB 3MRSA 4D25A 3SC3A 2FZ4A 1QDEA 3GEIA 2GBLC 2G83A 4PC6A 1NN3A 2AWNA 3AKCA 2VRWA 2OCBA 5HPYB 2QY9A 2F1JA 3CR7A 4NYIQ 1HUQA 2AFHE 3VU9A 4ASUA 2CCGA 5D3MA 4DSNA 1W1WA 2JATA 3CLVA 4NCHA 4FD2A 3L0PA 3L2OB 3PG5A 3QKSA 1QHSA 4QC2A 3SYLA 2ZANA 3KDSE 2CJWB 4DSOA 1CJVC 1FUKA 1KAOA 3KKNA 1YZNA 4I4LA 1VG8A 4LUCA 2ZSDA 2ZSEA 4QM7A 2XEXA 4YLGA 3FOZA 1OFTA 1ZYUA 5DYIA 4W5HA 2UVQA 4FMBB 5KOYA 3SNHA 4HDCA 4JLAA 1HV8A 2VP2A 2WWYA 2OO7A 4M9XA 1QBKC 2ZRJA 4P3YA 2BDTA 1IBRA 4DT1A 3FKQA 1OSNA 4OQFA 5KDDA 1G6HA 1Z0DA 1AKYA 4EAQA 3P20A 1NN1A 1MT0A 1COWA 1A2KC 2CDNA 2Q3MA 2QRNA 3LFUA 5FOSA 4IDPA 5TARA 4EPRA 2GILA 4GZLA 2D06A 2VF7A 3H1TA 1N6OA 1RE0A 3AP2A 1T3LA 4HB3A 3THOA 4DJTA 4TL8A 5CM8B 2X77A 2VP0A 4NL4H 1KOFA 4Q4AB 3F8TA 1KDPA 2GESA 3AF2A 1NBMA 5AUNB 5BYKA 2JLZA 2FDCA 5EUMA 3B85A 4PHTA 1A7JA 2IYXA 5FI0B 1CR0A 3VFDA 1RW4A 2MSEB 3SZRA 2AXPA 1KHTA 1E2IA 5C1BA 5JHGB 3TNFA 3THWA 4KXFB 5KUTA 1GUAA 2CE7A 2ZE8A 5CYOA 3W8RA 4V0MA 2O8EA 3NIBA 4EQ6B 1FNMA 4R71A 4RD6A 3UMFA 3NG1A 2JIZD 3AVTA 3RABA 5K8UA 1R0ZA 1IJFA 3ETLA 4PQYA 1ZM2A 3C5HA 3A1TA 3N2EA 3Q7PA 3CNNA 5B64A 2AFIE 2H17A 3KJGA 4LDJA 1U0JA 3ADCA 4KYIB 2A5FA 2EYUA 1XTRA 3IQXA 4Q7KA 3ADBA 1Z8FA 1A5TA 2IK8A 5JS8A 4ON9A 2BBTA 3B5JA 3GJ5A 5KDOA 4G01B 5G3ZA 2VP9A 1VG0B 3QEOA 4O0MA 3TH5A 2J3EA 1G5RA 1FMJA 2H18A 4JKYA 1NMZA 2CCJA 4LJ8A 3UG7A 1KDTA 3IEVA 1XMVA 4C30A 3B2EA 3T1QA 2PZFA 5FPHA 3QSYA 2I4IA 3NBFA 4KBFA 2V6JA 4ZIRB 4Z1MD 2BMFA 1WP9A 1NIPA 3L0SA 4C7OA 4IFBA 1W47A 1W49A 2RGEA 1E0AA 4CT4B 4C2UA 4Q1DA 1PUJA 1X8LA 3BXZA 3ICEA 3AUXA 2WVJA 2Z4RA 4B34A 2JJ8A 4BFSA 1SZPA 2ZRCA 1ZRHA 1XF9A 2W6ID 1GNQA 1GNPA 4MGYR 1XJ0A 2NOAA 4JMPA 2WJYA 1W36B 2UZ3A 1GL6A 4KLNA 4BLPA 1TF5A 1P73A 1W4BA 5HCIA 5LD2B 2G1JA 4US2R 1XP8A 2ERXA 1E1RA 4LV6A 1E2MA 1OXSC 4LJYA 1H8EA 4GFDA 1BOFA 1R10A 3EPJA 1QHXA 3TUIC 2A5GA 3F0TA 3SOPA 2ZREA 1FZQA 3K9GA 1OFIA 1VYUA 1TPZA 4HLDA 4URZR 3A4NA 4A0GA 3CW2A 2AKYA 1HYQA 4LBVA 4Q1FA 1X1SA 2KI5A 4ZI3A 1LF5A 1QHHA 1GWNA 3TLXA 1J90A 4G0NA 2YKGA 5E7IA 2O8EB 1R6BX 3IHWA 5L3QB 4OHXA 3ND9A 1Z2CA 3K53A 3MWYW 4JLOA 5JHHB 1KMQA 1L7VC 4Q48A 2DCUA 3GQBA 3IILA 4RFVA 3EW9A 4X8MA 5AJXA 4B2IA 2I1VB 3P1JA 3RS4A 4TMVA 4ZCLA 2XOKA 1ZW6A 4GT1A 2Q9CA 4C0LA 3H0KA 5LBIA 4A36A 5E7JA 3GEHA 2W6JD 1BYUA 3RS3A 2G6BA 4KSBA 3RC8A 3TUZC 2EWWA 3L0OA 1EGAA 2V7QA 3N70A 1CLUA 4HAYA 2BC9A 4FWTA 1GVNB 3QI2A 4KI0A 4G5SA 1SVMA 2V9PA 3VTKA 4DZZA 3EC1A 4IVRA 3ZIAD 1NVVR 1NKTA 4DLYA 1UEJA 2WSMA 2GXQA 2R44A 5F98A 2QNRA 3C14C 4L4UA 2DR3A 1T4GA 1DADA 4ZIRA 3B1ZA 3ZVRA 3B1YA 1R5BA 4GOXA 3PEYA 1AKEA 5J40A 1NVVQ 1P62B 3DOFA 1DBSA 3C7KA 1US8B 1GIAA 5L3SA 4MUAA 5FOVA 3J81k 4Z54A 4M4SA 2JLQA 1TEXA 1KI4A 4BFTA 2XX3A 3HU2A 1Z0IA 1UKYA 3HWSA 1XD2A 1KDRA 2IXFA 4LI0A 4Q9LA 2V54A 4F7WA 2A3RA 1M8PA 2ODNA 2ONKA 1ETUA 3DEFA 3DM9B 3FMIA 4OHWA 3RSLA 3T1TA 3AF4A 1XJQA 3GLFE 2OG2A 3AVPA 5FPSA 1UBGA 3R9IA 4DC9A 4RZ2A 1DOAA 1G17A 1HT1E 1T9HA 4ARZA 3U4QA 3Q9LA 1XMSA 2XXAA 2P6RA 2GEUA 1JQJC 4NH0A 1XXHB 4HUTA 5TXGA 5H1YA 3W5IA 4MRNA 4BQSA 3WMGA 2WHXA 5BN3A 1E6CA 5AWFC 1G8PA 5CK4A 4EFNA 1F2UB 1TF7A 4B43A 4NCIA 3CRQA 1GRNA 1CULC 4C3ZA 3LVQE 2GJ9A 3EAQA 1FW6A 3PEVA 4U5XA 1T8TA 1E2JA 4QBHA 1VCNA 1Q3TA 3QVUA 3LQRA 1U0LA 2QE7A 2F3TA 1N6PA 2HJGA 4ZPXA 3RS0A 4U7DA 1F6BA 4I1SA 5JJKA 3FDIA 2I1QA 1E79D 4PC3A 2HUPA 3G82C 2IW3A 1U8ZA 1FMLA 2BKEA 2FU5C 4H9GA 3WNCA 1VCIA 1U99A 1NLZA 2H57A 4JVLA 4FMDB 3CRW1 1PJRA 2IS6A 3CR8A 1R2QA 1XB2A 3BH6A 1HT2E 3B60A 1UM8A 2JDIA 4CDGA 4NONA 5DIFA 1LF0A 4QNMA 1EFTA 3FHCB 1ODFA 4NBSA 4EJSA 1P2UA 1E2QA 3KQKA 5CB6A 4LYJA 3LRPA 1KO8A 2VLIA 3MWLA 1G3IA 3MJRA 2FJUA 1Z6GA 2IYZA 4FXPA 2OESA 1B23P 3HP1A 2GAOA 4V03A 3HR8A 1XRJA 5B57C 2ZETA 4AYTA 4D6PA 1WBDA 3FWYA 4HLQB 1Q3HA 4K46A 2N46A 1E94E 1JEDA 1RRCA 2IYYA 3TW8B 4LK2A 4KFSA 4OHVA 1KI6B 1Z07A 1EFCA 2IUTA 4U00A 4FW9A 3Q5EA 1ZBDA 2DFKB 4CEJB 2VA8A 2IHYA 1T5IA 1VG9B 2H7VA 3PUVA 3PV0A 3GLHE 4NCKA 2WKPA 1X3SA 4CEHA 4KO8A 1G7TA 3SJZA 3BB3A 2WWFA 3D6TB 4EJSC 3RRYA 4N0EA 5JCZA 1ESMA 5CYPA 3DOEA 2LCFA 3KJEA 5FOXA 4ZDJA 5GJCA 1R5NA 3ASZA 4QHTA 2FGJA 1P61B 2BVNA 5F9HA 2ZJOA 5M04A 1G18A 2ZR0A 1ANKA 1KSHA 3CWZA 2CXXA 3DO6A 2ORIA 1G5TA 3CPJB 5L3RA 4ZDWA 1CJUC 2RCNA 2GKSA 4ZI2A 1W0KA 4B33A 3M4YA 4L8GA 2W2TA 1TNDA 1VMAA 2CK3D 5FBRB 1E2PA 4B76A 4CRWB 3N5CA 2VF8A 3NXSA 1MABB 2QPAA 3Q3JB 4KAXA 1AZSC 4PSKA 4CGZA 2YVUA 4AI6A 2QAGB 2IEYA 5C4GB 2O8BA 4DLSA 5JJLA 3QXHA 4D80A 1TAGA 1W46A 2FSIA 3EIHA 2O0JA 4DVGA 4TQAA 1IN7A 4DT1B 2QN6A 3QOFA 3SEAA 4Q18A 4D26A 2ZE5A 5AUOB 2X2FA 1CS4C 3BJIC 1Z3IX 3LXRA 3MWJA 5C4MA 1GRRA 2I3BA 2EWVA 3PEUA 4EJSB 4IJMA 4Q4AA 1E9DA 4HAVA 4HAZA 1KMHA 5DISB 2PT5A 1XD8A 2BV3A 5J5CA 1DG1G 3CX7A 3MSXA 4A0RA 1G3RA 3KTAB 2IBMA 1JJ7A 2NO7A 5TDHA 2PJZA 3GJ0A 3U3MA 3QKSB 1D9XA 1XBTA 4D0LB 1MRSA 4TLDA 1IN5A 3H86A 1KO5A 2ERYA 5EE3A 2IYUA 4M1MA 1SVOA 2F43B 5LB4A 3EPLA 1SVWA 4MGIR 3ZQJA 4A82A 4F91B 2QT1A 3PUZA 1T5LA 3RDPA 3IQWA 1R0YA 2ZSFA 4MRPA 2VIIA 3LH5A 5FUXA 1G5PA 1E99A 2O5VA 2R6GA 3CRRA 1DE0A 1KI2A 1EFUA 1G6OA 1J7KA 1GKUB 5EE5B 3QEJA 2HCJB 3LVRE 4QNRA 3WNDA 3O8BA 5FH9A 3NVAA 5KSYA 4XJXA 3LBHA 2ZJ2A 1DAFA 4OQMA 3X1DA 2ZE6A 2ZRMA 2DFTA 4UNSA 5FFMA 1W4RA 2FNAA 5DYGA 2J45A 1Z06A 2ZRGA 3K0FB 1U9IC 4JLPA 2ZVQX 3AB3A 4K81B 4OI4A 5DI3A 4EFMA 1AJEA 3C8UA 3CRMA 4A1FA 1S9HA 1YZUA 2JLUA 4L16A 2AHOA 5HKKD 1IXZA 3Q7QA 4NP6A 4E5UA 2YWFA 3ADKA 1NN5A 3TKLA 4B74A 2RGNA 1SHKA 1N5KA 3TMKA 3K0CA 2Q9AA 1UDXA 1VCMA 1MO6A 521PA 3UATA 3KB1A 3GCGA 1YR8A 1ZCAA 1J70A 2P6UA 4PHGA 1JR6A 1G7RA 2OEPA 2FGKA 2DHRA 1ZAKA 1E1QA 2VTKA 4NDZA 4A4DA 2F1IA 1XJCA 5DN6A 3CZPA 2C96A 3AP1A 3NBXX 1DTSA 2N42A 3OIYA 2W00A 3BH7A 1H65A 3BWDD 3BFXA 2YOFA 2IYVA 1E0KA 3VR2A 3EG5A 1JR3E 2XJ4A 3T12A 4KFUA 1BS1A 1LVGA 2O8BB 2VP5A 4II7A
chains in the Genus database with same CATH superfamily
3A2NA 4FW8A 3RIYA 1ZGJA 1HQDA 5L40A 2VDMB 3JY6A 3G2NA 3DZDA 1AF4A 3ZTTA 2OHVA 1FDIA 1SEVA 4XUDA 1SUWA 1NXOA 2JGMA 4H1VA 3WGGA 2V74B 4CIVA 2PXHA 4BFZA 4ETMA 1SKYE 3LC1O 2PVSA 4DLLA 1I7DA 1GN9A 1V11A 3KHSA 1TT5B 1XRLA 3KSRA 4GR5A 5CH8A 1HK7A 1YACA 2JCBA 5DWDA 2BJHA 3DVSX 3FPAA 3G02A 2P41A 1BE6A 1OIXA 2VNSA 2NW6A 3PGLA 4UOQA 5DNWA 3TSZA 4A73A 1DDIA 4B73A 1BXGB 1HURA 3O9VA 2I55A 1A9XA 3BXXA 2AB0A 3ESAA 3WLRA 2IYLD 3ETEA 1EM8A 1V35A 2WJAA 5DNVA 5CITA 1XVLA 3GEPA 3I39X 4R1NA 1EMDA 2HV8A 4IV0A 2QW8A 2DQ4A 3LRXA 4QJ3A 3MQFA 5PGMA 4BO8A 1M33A 1QRTA 3F6PA 1H1DA 2NUPB 3D2AA 4I1OA 3G5MA 1AURA 4HTFA 4JLJA 4C4XA 3P9YA 3MBIA 1CQIA 1DU4A 2ST1A 1EFVA 3UJNA 2PRJA 2BSAA 5C0OE 5TS3A 3P2MA 4RY0A 2GPBA 1F14A 3EVZA 4E11A 3AEQB 3JX9A 1XU7A 1CDDA 1Y1KE 3BILA 3DT6A 4LGCA 4B6SA 4M55A 5ESRA 5D1HA 3KPYA 3R23A 1Y8ZA 2YJTD 2H5IA 4PTYA 1SD5A 2QTNA 2BTQB 3BFVA 3EHDA 5ICFA 2C2OA 5HW0A 4QUKA 4BU0A 2WJ6A 3GH1A 1YK0A 4JU9A 1VHDA 2F2TA 1WJGA 1O95A 1GEGA 3D7SA 4F97A 4TSRA 4EFKA 3MRTA 3WICA 4L5BA 2DWPA 4JV5B 4M60A 3N6VA 1P0QA 3TLEA 3ETCA 3CLUD 4RU1A 2JB9A 1ZXLA 4JL6A 3H2YA 5EFOA 4C0KA 1K5DA 1YA6A 1OXXK 4FD3A 1FP4A 2GN2A 4MWGA 2OHHA 1IG3A 3M6IA 1FRQA 3N5KA 2FFAA 4RE5A 4ZI5A 4CCYA 2E5WA 1E32A 5IARA 2Y1WA 3VYUB 2Z8XA 3HZZA 1KY3A 4L3VA 4TSFA 4UE6A 4ZOLF 4CTKA 2TYSB 4IMIB 4U2EA 2BP7B 3CYFA 3I6BA 3NANA 4C0AC 4Q3OA 1K6MA 1YB5A 2R8XA 1GQQA 1U31A 1ZHFA 3D4BA 3HB4X 3PDUA 1EEHA 4R1UA 2E9SA 1FFCA 1X15A 4AZWA 4XW2A 5I8PA 2H5JA 4RUKA 3KHUA 5JC1A 1J06A 4NCNA 5CT6A 2IWHA 5JZVA 3DKIA 4RPIA 2OXIA 1JV2B 4EA6A 5ABPA 3KAQA 4U2KA 3TZEA 3H1PA 4A03A 1IAQA 4DS3A 4OQNA 2DFDA 1TYAE 2Q9BA 1L8QA 3MT0A 4RX1A 4CM8B 1MO3A 1SCBA 3KUDA 5I45A 2WJGA 4HNVA 2GRAA 4LOKA 1MB4A 4LJLA 5JI3E 1QPZA 1O3YA 1DAEA 1GAWA 2RONA 2W8BB 3CJRA 2TMGA 3DJYA 3P5SA 5JJIA 3JPYA 2B1RA 3IVRA 1AUXA 1JDVA 4KV7A 1UQUA 4O4IF 4YQEA 2WY2D 3V32A 5DI9A 2A9PA 4D5EA 4Z4GA 1LDYA 5JPCA 1IHUA 3FCEA 2P6PA 1ADFA 4G85A 4K9PA 3C8DA 4Q1CA 2VPPA 1NI3A 2I2XB 3RADC 5I7RA 2GAAA 3AC0A 4HVTA 5TMPA 4DNPA 3O8RA 1ZHOA 4LJRA 4QPJC 2OCXA 3DOHA 4JUAA 1AM4D 1SZJG 5J2TF 2FJ0A 4ZOLA 2NV6A 4Y1GA 5BQ5A 3G2OA 3ADDA 3DFZA 4IZIA 5AK4A 2G04A 2GBPA 2HUNA 5AHXA 1NJ5A 5K3SA 5C35A 2AFRA 2R5WA 3THYA 4P0PB 1Z39A 5HRAA 4FLFA 1HNZB 2OENG 1VLQA 3CZMA 3EC2A 4REOA 1QGZA 3QITA 2F9MA 3KE9A 5KOJB 3UW3A 5KSOA 3FUTA 3N0XA 3PE3A 2YNMA 4HEQA 5I8WA 2IHVA 1O87A 2XQJA 1JKIA 3SMQA 2ZZKA 2D8AA 3A6HA 3RAFC 1GITA 2A9JA 1FX0B 4JLBA 4M0LA 2ZBRA 2NPFA 3R7FA 1YV9A 1XYVA 3E9EA 3D8UA 3DZ8A 4M88A 3O4GA 3UKDA 1PHRA 4CKEB 1Z7BA 2OC4A 4O4JB 1XR3A 4YRIA 1CTQA 5JS2A 4PZAA 2H52A 3MPOA 3PNKA 4MQMA 2FPUA 4B75A 5IAEA 4EDHA 5JEEA 2BUAA 3U4QB 4UM5A 5AXAA 5AQEA 3KB2A 4NJMB 3WNZA 1M8JA 1J0XO 1D2HA 3LLMA 3IAAA 1RZ3A 1QQAA 1WXHA 5AKYA 3FETA 1KTVA 1NTOA 2O5RA 3CKKA 4NBWA 3LUJA 1JKMA 1WO8A 3C6YA 3K6JA 1YCFA 3M3PA 3HXLA 4FHCA 3COWA 5H83A 1SHTX 4X20B 4MRRA 4CM4A 4WASA 5J3JA 1DAGA 3OSZA 3U6BA 2AL7A 3RYFB 3FUVA 4BBZA 5FBHA 2IXEA 3KJNA 1J6UA 3ZCRA 1ZR4A 1WHSB 2I67A 2YV3A 4LHXA 4AK9A 4B0PA 2ZM5A 2B3TA 1YI8A 2I7TA 4IV5A 3K2EA 4ND6A 1UC8A 5HIIA 4BVBA 2I65A 4Z7OB 4CMGA 5IBCA 2C54A 3B1KA 4C0BA 4YPVA 3KVYA 3RTCA 4HUQA 3A0RB 3ZOZA 1JP7A 2CXRA 3U4IA 1CNMA 2WWWA 4N03A 2SNIE 1ODLA 5J2UB 5I47A 4PTZA 5JYCA 2C57A 4DRYA 4XM2A 3BWBA 1UJNA 1TZMA 2XWBF 4O4JF 4UQPA 5BR4A 1MZVA 1DHTA 2MDTA 1ZCBA 3BOSA 1HE5A 5GVRA 1JECA 4ER6A 2ZSHA 4ATNA 1KVUA 3H75A 2C58A 3SJ7A 1XL0A 1B6TA 4J4TA 3I34X 2UVDA 4I2VA 5H3LA 3AERA 2VR1A 5DGIA 5HDBB 1JKJB 4EPTA 4DUZB 1S0UA 1COWD 1N7IA 3S1AA 1N5OX 1I6MA 3EOAI 4JSTA 5FJIA 1GL3A 3LY5A 2VJBA 3ROPA 4KE9A 1KZHA 1W36D 1BAPA 4F3CA 3BE4A 3SIRA 5BSKA 3T3DA 5I9IA 5IULC 5AJZA 2QORA 3C7AA 3MWKA 2ZBQA 1OLUA 2I4OA 1GLNA 1UBNA 4B32A 3R6WA 1BQEA 1MABA 2WLTA 2YN2A 3I3OA 2QGNA 3UPUA 1KK2A 1X1EA 2OMKA 1W2WB 2XRYA 4YMLA 3RVLA 2IS1A 1VHTA 1ZCZA 4JJ7A 1VIVA 1T9GR 3DWIA 3ABOB 1VSVA 4JB8A 4U2BA 2PGIA 4FDVA 2VPZA 3OOSA 4LDNA 2BOVA 3R74A 2HSEA 3U3RA 4GLFA 5CCEA 4JBWA 2EU8A 1KWKA 4OG2A 3R76A 2P30A 3RJTA 4B09A 4F1JA 3WGIA 4QRIA 1AC5A 3WLSA 1XZ8A 5JBQA 3TJZA 1SHJA 2NVWA 3TQFA 3S2GA 4PZPA 2WIDA 4OP2A 1DPFA 1QFMA 4LC9A 1AUPA 4XD7A 2HU7A 3R4CA 4ZO4A 3TSAA 3VR3A 1I0LA 5M3BA 1R0RE 3DMYA 4K5QA 4ZMSA 1RHQA 1EVYA 2YYAA 1Q44A 3GXBA 2PSHA 1D0IA 1ZS9A 4KQHA 3SDZA 3C98A 2PPLA 2YJZA 1H2ZA 1Y82A 2MMGA 1UDRA 1VI6A 3BGVA 1XCMA 4JHXA 3ZNQA 4IQ8A 1QO0D 4DV2B 1N8TA 4JU8A 2VXOA 4HNTA 1KEZA 2YZGA 2G77B 2ZDHA 3O8QA 4XVHA 1XUOA 4CQMB 4NS4A 4M1YA 5I7HA 1U11A 1EI9A 5EWJB 1IM5A 5CB8A 5A0FA 1FRVA 2CHEA 4DGSA 5IKPA 3FZGA 2ZWOA 3H13A 4KH1A 4R69A 1B8PA 2CLSA 3KUUA 3GT7A 1WW3A 3MJFA 1KYWA 3IP6A 4N65A 4UPEA 4ZV4A 2QAGA 4PLPA 5JWHA 5KINB 2J0EA 3ISJA 3CEJA 3TVTA 3V97A 3QW4B 1T0BA 1NUUA 2HWUA 4R2JA 3H87A 5AKJA 1I2BA 2YIVX 1G9XA 5EKUA 3NBZC 1OJLA 2H5EA 1PWEA 3ZJYA 3UJ9A 4CKWA 1GAEO 1J56A 4WLNA 1KRHA 4YIHA 2JJ2A 1B1CA 3PGMA 2OT3B 2NQ8A 3RC7A 3FVQA 4E1AA 5EAIA 2YN4A 3H3FA 3K0FA 1TUBB 4IVQA 4NE7A 2PSSA 1JDTA 1D0VA 4MVWA 4RSMA 1WDTA 1HDRA 2AYYA 2C9BA 2M1ZA 4XJTA 4W8HA 3OPYA 3WV5A 5L53A 3NHSA 1T36B 4MGZR 1RAFA 1NNI1 1C3LA 4DNFA 3KTAA 2A5JA 2QMHA 5J47A 3FXAA 4Y2XA 2AN9A 4NR0A 1W52X 1TK9A 1XC7A 3EQ7A 3BWYA 2B34A 4DLBA 1KZGB 1UP7A 2L18A 1BX3A 4CE6A 3PK0A 2QM0A 1HTBA 4ID9A 1L4NA 4TWZA 2NU9B 2OXCA 4F3TA 2EJUA 3DNMA 3K5HA 2A35A 3IHLA 3QE4A 4MGEA 1Y4DE 4OI1A 3L8DA 1CF4A 2ZKIA 1V1MA 3ZJUA 4NOKA 3LQYA 4K9KA 3KQUA 1JQBA 2J4CA 2XI4A 4C7BA 1ABFA 3ICOA 4BQFA 4YCCA 2CCKA 4XB1A 1D4FA 4DBLE 1S2GA 3GLIA 5FO1A 1XA4A 5LMUB 1WQ4A 2J41A 5EPEA 1AMOA 2IJGX 2AFVA 3PHGA 1GXSA 4FLEA 2OCIA 2ZJYA 3ILVA 1UUFA 5EY5B 1QFJA 3UENA 4Z5XA 5EP4A 1F1BA 4Y98A 4KE7A 1W76A 3PI6A 2C1ZA 1H5NA 1PWZA 2B94A 1UK7A 3EOBI 3GJ4A 3O92A 1Z13A 1YA8A 4YQZA 2P8SA 3RIHA 4PS1A 5E4TA 3VKWA 4X91A 5KPDA 3LUPA 3AM1A 4UEQA 4BVFA 3OJCA 4QO8A 1AOXA 2IPLA 2YFKA 1SBTA 4IP0A 4G4GA 5HA5A 5EEGA 4AY6A 2FUG6 2R6ZA 2IXGA 3X1XA 1BKYA 3L7KA 3GROA 3NAMA 4S1OA 2BFFA 2O2JA 1TCAA 3KEQA 3V8PA 5IDVA 4ZZ2A 2PQ2A 4EB3A 1X2BA 3PXDA 4DDUA 3A6GA 2YYZA 2XRFA 5I9BA 3ZLVA 2L69A 2RIRA 2ZUDA 3C16C 2OQ2A 2FX2A 1C9KA 1DX9A 3PQ5A 4L28A 3J7TA 3M2TA 2P6OA 4AN4A 5DX8A 1O6CA 5TJHA 1JH9A 2H0QA 1KK3A 1KJIA 1KI7A 3ELBA 3S2ZA 3TAUA 2R7MA 4NULA 2PGAA 4FGSA 4A6XA 2X0EA 4KKVA 3VNUA 2CK3A 1K7XB 1XCBA 2DKOA 3OQJA 2VHTA 2VNJA 4BOYA 2ZLBA 3U49A 3WL6A 4ZAXA 3AB8A 2Y0EA 4DMFA 1RYMA 3G8BA 3DL0A 3HUDA 1YCDA 3JQCA 3E7XA 1IVYA 4YMHA 4O59O 1CC1S 5JJ5A 1HBJA 2QW1A 2VHUA 3M4XA 4PLVA 4OXIA 1GDTA 3B6IA 4FZ5A 1LPPA 3T4XA 3RIMA 4X9XA 1I4OA 1UXIA 3T61A 4RLSA 2GAFA 3ONDA 4KO4S 4PYIA 2NQTA 3FYCA 2PV7A 1BXGA 3N2GB 1AS0A 2X40A 5LZ9A 4MCHA 1RPAA 1S96A 2BBOA 3C3WA 3EGCA 4BFLA 4YAIA 1FFEA 5FB3A 1NHGA 3WBJA 4FR5A 4ZAZA 2TSYB 3AI1A 2H8GA 2O52A 1PIWA 3DPIA 3M3HA 1K4MA 1YDHA 4LECA 3U1TA 3W9SA 1Y6GA 2HHJA 5K3BA 1XZEA 5I4CA 2ACWA 2Z1NA 3IKLA 5C1PA 1Q77A 2VYFA 3KWJA 5K3OA 2DY0A 1UBLS 2HHLA 3QE3A 4UXIA 2LKCA 3BCUA 3E8XA 1UT6A 3T35A 3UAOA 3UJDA 3NWJA 4R40A 2PLAA 1ZOLA 5IHPA 1VQ1A 4OHFA 4YWHA 5JSQA 1I7LA 2DKNA 2B6HA 4QGBA 4JKIA 4BNLA 2OE2A 3DAOA 3ICVA 4HX2A 5EKSA 5ILQA 5K1ZA 3NI2A 1X14A 5JH7A 1HX7A 2J4FA 4DL9A 1XRSB 1ZW1A 3N2ZB 1UBMS 2D7CA 2W4IA 3T3MB 2QN7A 4WZBA 1VRVA 2Q1UA 2SCUA 2GH1A 4TTRA 5ALDA 5KTTA 3NZEA 1QKKA 1VP3A 3TTSA 3IXQA 4FS3A 1N1DA 2VO1A 1HL7A 2XYPA 4LY9A 4EYQA 4FR2A 5BR1A 3EGWA 1E2NA 3CZ9A 1JT9A 3PPVA 4K8OA 3NHBA 1XZPA 5F5XA 3RODA 2ODEA 1GZDA 3RC3A 4I99A 1I3LA 1OMOA 1RWXA 2IT1A 1XDSA 3VUFA 4BGUA 5BV0A 1E1CB 2PL1A 3FOWA 1JR4A 1D09A 3BWVA 1IOZA 1WMBA 3SYKA 3KU1A 3TE6A 3MPUA 1CY2A 1W5SA 4RGYA 1UJCA 3VC2A 3T94A 1E79A 3EVCA 1MD9A 3MUNA 4AO6A 4MVJH 4HNAB 1M6NA 3FWHA 4C20A 1AUOA 4IDAA 3U60B 3ZGOA 2FSFA 4AJ2A 5T4EA 5JYDA 2BTOA 2FV8A 1GCIA 3L8GA 4PZEA 3EQ8A 1ONNA 2BM9A 3A58B 3DYBA 3FLBA 3LUGA 5KOJA 4G65A 2R7KA 3G9XA 1KR5A 1KEEA 3FNGA 4HQOA 3FMOB 3MNFA 5BPFA 2RHBA 4PAWA 3IBGA 2XXJA 1CUUA 3E35A 4CQMD 4MEBA 1K8ZB 3UPTA 5KTPA 4Q19A 3W4JA 1OX4B 5HJEA 4QDZA 3LW8A 3I04A 4O3FA 5IBPA 2NX2A 4K26A 3QVLA 5JC8A 2FQQA 2VH2A 1VL2A 2BFDB 4NJOA 4D6YA 2YXBA 4ZHQA 5F23A 3IIMA 4UU7A 1V0JA 4JL5A 4E88A 4QRDA 4G0YA 4MS1A 4DNXA 3OCUA 4BCBA 2R8ZA 1B6GA 2C88A 4DC0A 4ZOQI 1W0JA 4L57A 4X6XA 1UXGA 3VZCA 2EX0A 3X2FA 4OL0A 3THXB 2WHEA 4FKZA 3BPSA 1T35A 5GJWC 3G9QA 3W5HA 2OBLA 4C6HA 3ZJVA 4G3XA 4NENB 3OZ7A 3PJDA 4EELA 3FNEA 4JJZA 4RD2A 3CF2A 3NTRA 5G0TA 1V9LA 2B0CA 1YOBA 3KL2A 3MD0A 4OREX 2IELA 3FOBA 2B2NA 2FG6C 5A6VA 1EK6A 1G2PA 2QW0X 4ISBA 4QXQA 1MQAA 2JASA 1OCEA 5LQKA 5BMVB 2ECFA 2GNAA 2J31A 3QPBA 3UT6A 1IOVA 3VZQA 3WXBA 4LY3A 5IAAA 4OI2A 4H7JA 3UFBA 3ZX4A 1QP8A 2B2CA 2YHSA 4HBZA 1WUKS 3GJ3A 1GDDA 3QTBA 4HLUA 2FDXA 3QMVA 2VT6A 3G2QA 5LIPA 4FCVA 4QDUA 2RG1A 4YLYA 2V7XA 1V4VA 1N0WA 1THMA 2W2XA 3W8EA 1Z2AA 5A3RA 2WQ6A 3HLKA 5A4DA 3N8IA 5BMVF 5IPFA 3W6ZA 2FPMA 3AERB 2FY8A 4DLXA 1NUPA 4YJGB 4MWOA 2BHTA 2HWYA 4GMXA 4BNXA 3TFWA 2J3IA 4CHTA 5HUJA 4BTVA 1P7WA 1TRKA 2W2NA 3S1AB 5E0KB 3TMAA 4C87A 3ZE6A 2FHSA 4H18A 3DMTA 4ML3A 1XZFA 3RC1A 4QBKA 4NYJR 4XTRA 1UC5B 2JFVA 4QDKA 3QJ5A 5KNBA 1HDIA 3LA6A 1D2AA 1P33A 1VIYA 2QL7A 3FCOA 4LG1A 4Z7QB 3E5RA 4RD4A 1RLTA 4QYSA 4KQMA 1XQWA 1NU6A 2X1MA 4RL4A 5D86A 5C1IA 5TS2A 5KPJA 2VLBA 4DR1B 1US8A 4I1UA 2O3QA 4Z3OA 5D1NA 5C3MA 3WKCA 1YGYA 2QLJA 3LQ4A 4Q7EA 3KZCA 3RYIA 4ZU6X 1QGUB 2PM8A 3U7EB 4AURA 4EHJA 4CG1A 3UK1A 1IDN1 3NTUA 5HK8A 5FUQA 2QYHA 2OQIA 2ZUCA 3O4IA 4K0RA 4OV6B 3F6RA 4UHDA 4X8OA 4GDMA 4YUWA 5L6LB 1UH5A 3OF3A 1R4MB 4MUFA 2Q7XA 1D4ZA 3DW1X 3LL7A 3FJ1A 4OLFA 1L7RA 3JQBA 3AP3A 5F3RA 1EJBA 2GF9A 5FOTA 1KY2A 2PLRA 3GLQA 4U3JB 3D7RA 4KQGA 4N0QA 4UHCA 3QELB 5CDFE 2HIMA 4Q4HB 2WF9A 2B3DA 4AJLA 1EVLA 5BXYA 1X1CA 3NHAA 5BN3B 1TK3A 1ZFNA 1K8YB 4HL6A 5IX8A 4J43A 2JIRA 4F2PA 2QHXA 2YL2A 4OQDA 4BMSA 3PLRA 4NYIR 3ZJTA 5KNCA 2EFDB 2JFQA 4TXHA 1EK0A 2NAPA 4LOHA 3CINA 2LP4Y 2JEYA 2QPTA 1VG1A 4D8XA 5G0VA 3H0CA 3IEPA 4NIMA 3ANNA 1I1OA 3CH5A 4P34A 5LKAA 3GLFA 1DZ3A 1MJGM 1CBUA 1UR5A 5I7SA 2J6CA 3R3SA 1K9SA 2FEXA 1E4OA 3E6AA 3R3VA 3UFXA 4YRMA 1MV5A 4Q02A 1VL5A 4CKWB 3OLVA 3U9SA 3UWPA 3IAFA 4H7DA 5GV8A 3ZV5A 4B6EA 3IE1A 1E9AA 1A9TA 1A72A 2PGDA 3P9IA 3WLMA 3GZNA 5KDLA 5HK9A 1QIIA 1RYZA 4BZWA 1U8AA 3WHKA 4EQZA 4C2AA 2JPDA 1JA9A 3TLCA 2WWTA 3WGYA 2GF0A 2BEJA 3DV9A 2C5LA 3FTQA 1U0TA 4R1OA 3CG0A 1JXAA 3AUAA 1J24A 3ISTA 4JCCA 1Y1RA 3RJ9A 3TNYA 2L17A 1IQPA 2NYAA 5FTJA 2ZIUB 4IF6A 1R50A 1EQAA 3DD1A 3FBTA 2XDYA 1LB1B 4HDMB 3K0AB 3LPNA 4J4BA 4Z0HO 5A4FS 3N75A 2IY8A 2CJWA 1N2HA 1X74A 3DKKA 1PTJC 1WPXA 2FZLA 2QL6A 3F6BX 3JVDA 1VKZA 1VFPA 4I55A 4RVGA 3KYBA 1OBOA 2XIQA 2QMEA 5HIAA 4YXFA 1FYEA 4B3HA 4HFRA 2BRUC 3H2KA 4LE0A 1YVDA 4JZKA 2IF2A 1E6KA 1XAGA 5DSTA 4UM7A 5FNVB 4D0SA 1KF0A 5IZ4A 4DV6B 1B42A 4L51A 3S0JA 2QUAA 2VPWA 1JEYA 2OSBA 3ZY2A 4EG3A 3W9BA 1I94B 1CR2A 3CX6A 3MCZA 4RF3A 4RFSB 4UDOA 4CEJA 4MKXA 1UMDA 4XSGA 3O1JC 1L7BA 3K70D 2P9HA 2W2LA 3TD6A 3TNLA 2Y1LA 2RGNC 5K2MA 1U2GA 1LDMA 1JDPA 5AVXA 2Z6UA 3PQ7A 1LA2A 1ZIDA 4HQLA 1KDVA 1TUBA 1ZU5A 3EFBA 1BH2A 3G9ZA 1CJMA 4NEQA 3GJXC 4NV0A 1JIXA 2C2KA 3PKZA 5DBHX 1N2BA 4ZT4A 4N6OA 4YDQA 4GPIB 1JL3A 4XYEA 3A6FA 3AHIA 5IS2A 2WJJA 4JLKA 2JAUA 2C4MA 3KJHA 1JHAA 1JFRA 2O8CB 1H4VB 4P7KA 1I30A 4GP7A 5ARDA 3NVMB 1QYDA 1UKVY 2VYND 3PQ4A 4B87A 1UBHS 2ETXA 3O95A 2WWVD 4WAUA 4RCZA 3NYIA 1SO8A 4NZOA 4RK1A 4B9AA 1Q91A 7GPBA 4FK8A 2AG1A 2O9JA 3QI7A 2Y0DA 3VDQA 4DUPA 2YJ5A 1U1IA 5LR6A 2WU4A 3HKEA 4JR1A 4XX0B 1MR3F 3FFAA 4MV1A 1Z9BA 2ZEJA 3ADOA 2UUAB 3EZ2A 1J2EA 2AZ4A 4M0PA 1DGQA 2DVMA 3ZQUA 1MGPA 3WG9A 1ZVJA 5A5FA 5DX1A 4OHKA 3TLKA 4NXNB 1DIOB 4XR9A 1T25A 5EXPA 1O5IA 4ZI7F 5LWHA 1GARA 4M53A 3IAHA 3TRDA 3W2GA 4KQEA 3BE5A 5D7BA 2ZRLA 2D1YA 2NZ2A 2YZMA 2BMVA 1J8FA 3O8LA 1AK9A 3TR5A 1GLVA 2I54A 1Z17A 2XOEA 3KWLA 4AMUA 1NQOA 1Y7IA 3GP3A 2G80A 1EHCA 2F00A 3BCSA 1I3CA 1L7QA 4G5FA 4RKEA 4WKNA 4BLVA 4DR3B 5DYNA 4Z9FA 1DI0A 1DRUA 1DJNA 4RGVA 1GHTA 2C2ZA 4RVCA 1C7FA 5AKHA 3UHOA 1ZK4A 1NOIA 1IMOA 1I4LD 1U3FA 3M5DA 1H5QA 4NS1A 4RIGA 2EEZA 2WWIA 5L6MB 3R7SA 2CXQA 4IHQA 2OMEA 2VPTA 4MKFA 3AT1A 1HE2A 5EUBA 1KVSA 1P1KA 1RM0A 2XZLA 3IVAA 3O7MA 3DVAA 4N01A 2A1UB 4KL8S 2P1ZA 2F43A 4MGHA 1ZD2P 4OF4A 5ARCA 2WVHA 3HJGA 1LWOA 4BNTA 1TXGA 2HREA 4J7XA 4WWHA 5KHOC 1FQKA 3INTA 2Q4DA 1G9SA 4CMKA 3GP5A 4MA5A 3N05A 4UTZA 2EG5A 5CDTA 3V4FA 3MIZA 5ALRA 3LOPA 5ESXA 4BXOA 4BO5A 3W2FA 3GFBA 4P93A 3G2KA 1SR8A 3HGQA 1WMEA 1J5PA 1H6AA 1RXCA 5HFAA 3RVOA 4ABYA 4M37A 6CHYA 2DM6A 4WBNF 4A0FA 2G28A 3WMWA 2HMSA 2PS1A 2G71A 3EFHA 3FHLA 2ACVA 2GYVA 1HY3A 1XAJA 4U8HA 2ROQA 4XUEA 4E2FA 4RPHA 4ZFNA 1XZGA 2H51A 3SICE 2J9RA 3VHXB 4I5GA 2VEDA 4PTLA 1R15A 3RCBA 4DADA 3CX4A 4DLKA 1SFRA 5JRDS 2Z09A 1E9FA 1H93A 2HEIA 3GPIA 1RHJA 4K9LA 4DKJA 1AKRA 2JI8A 3UT5A 4QRHA 5IRCD 1AGNA 3DF7A 3WNQA 3IUYA 4IDNA 3E9MA 1PK8A 3HM2A 3HXKA 3AWIA 5EXTA 1KHHA 2GZAA 3ORYA 4UXJA 4WUTA 3ZHVA 4JEHA 3ZD9A 1QVAA 3A4LA 2PSFA 2H1LA 2PBFA 3OOJA 4I3FA 4UUMA 4DSTA 5BN1A 1RRMA 2C2GA 2D0PB 1SCDA 3OQIB 1CT9A 4LNUA 4XQGA 1Z82A 4YRAA 2ORYA 4TMZA 5BUZA 1T4CA 2HCTA 3KO8A 2ZIEA 4KI7A 5D87A 4YUXA 1X0VA 1Z6TA 2WD9A 5L95A 1KJZA 1YD7A 5FL3A 5F9MA 5LA6B 3ZDYB 3AHCA 4EW2A 5KSZA 2OD7A 2X6QA 1KAGA 2X8JB 2B2XA 3E4DA 1H69A 1QGED 3EH1A 4I08A 4Z9AA 3IUQA 3FYTA 1ZIPA 2G0NA 3LVFO 2P2CA 3LZCA 5AKXA 3X1WA 3F73A 2VDPB 4X61A 4DLUA 4AMBA 1C2TA 2WMNB 1S89A 1E98A 2COUA 1HDOA 1SC4A 3QTTA 1GGVA 1GZ4A 3ZZUA 5BWNA 2YWCA 1RWWA 3WQBA 2IUYA 1YVRA 4EYKA 5L3VA 5HQ3B 2QT0A 1HDEA 1BEZA 1TZKA 1ZIYA 2G17A 3HKDB 2NU8B 4N76A 4GOMD 3TTVA 1N25A 3B5IA 4WKGA 4XWAA 3GBSA 2UKDA 2WPDA 5JAIA 1TO6A 3KKMA 4NBUA 1GZHB 5FBQB 3GJTA 3X2SA 3G0OA 3ENZA 4EG8A 3UH0A 3M34A 3PFKA 4NENA 4B2LA 2R4QA 3PHIA 1FFXB 2GN8A 4YJ3B 1RXSA 1U1DA 2BFMA 3FWKA 1PZEA 2DKFA 1XD2B 2QGZA 4TZKA 2XIJA 3DOIA 4L2IA 4LHYA 3RROA 3KFXA 2OAP1 3PX3A 4LCBA 5ITZA 1S8NA 2AFIB 3ICWA 1XDUA 4GPEA 1DMSA 4QQKA 5E9AA 5BR8B 4X92A 1H42A 2C9ZA 2P2ZA 1IMJA 2P4HX 2Q49A 2GDZA 1RBQA 1PJAA 4W1SA 1DEAA 5FUMA 2FVYA 1MQSA 3MMZA 3SE0A 3T52A 2FE1A 2D1QA 1G4AE 5JPIA 5B7PA 2WTBA 4JGGA 4LF5B 4OP3A 1SXQA 1LI4A 1K2WA 1NW3A 4HAXA 4QQ8A 2AEEA 2JI6A 4Y2HA 5B1HA 3I3SR 121PA 1EJ0A 2AC7A 1VIAA 2RHHA 1PBTA 2OYSA 3ZEIA 5KQPA 4K9NA 2W43A 2D1RA 4HO1X 1CERA 1Z5WA 4WY2A 1NV9A 2FX3A 4JLWA 5A4KA 1C0LA 3CVJA 5DTIA 4R5HA 3UK6A 1LTKA 1YR7A 4JY7A 1EP1B 4X6LA 3HGMA 4Y6PA 1K5GA 2WG0A 3BFPA 5B53A 2JFGA 5CB0A 2XODA 3VI3B 2GF2A 1VSUA 5EPOA 3CIOA 4KMSA 1JVSA 1A5SB 1UKCA 3A31A 1C80A 5EA2A 4OSEA 4U1RA 3USES 4CM6A 3LHKA 1T6ZA 2PL3A 4EHLA 1NBEA 3K94A 1JHRA 4PZZA 1RPJA 2HWXA 2ZAOA 2VDNB 3B82A 4F04A 2G1AA 4GDFA 1I9GA 4JENA 4MB6A 3OAAD 3O9ZA 2UXDB 1I10A 1X7YA 4CF5A 2RGUA 4N7RA 5HCNA 4EKEA 5ITWA 1J9ZA 3SGLA 5B7GA 1Y5IA 3V1NA 2O57A 4A5OA 2HYDA 3MUOA 2I7XA 3AIOA 1FFBA 2RH4A 4EKNB 3LC7O 4DPLA 2ZU6A 2H08A 4I1IA 3F6YA 5A06A 5CLJA 3RNLA 1FFDA 4NZNA 3A26A 2CD7A 3NIDB 5EJEA 1UL1X 3D3JA 1GTG1 3E9DA 2D2IA 1RCTE 4IRMA 4PPFA 2GKGA 2L0XA 1CQJB 1YQ9A 1WDKA 2FP3A 4IG4A 4NYJQ 3W5IA 3WGNA 5HTOA 1JHVA 3KOOA 5JO9A 2AHRA 3HCCA 2EP7A 2IEZA 4P7FA 1JEQA 1MA3A 1DLIA 3HSSA 4P5EA 5DK4A 3BWMA 4BATA 2NSJA 2CNOA 2M32A 4INPA 4YBZA 1KBZA 4MIYA 2W93A 4YPOA 1M0WA 1LDEA 1Z29A 1MCZA 1JG7A 3C43A 3I37X 3KM0A 1LX6A 4QEZA 5FHRA 5CVTA 3JRNA 3PEEA 4MAMA 4ZYTA 3OE5A 1W5TA 3M6VA 1E2KA 1KP9A 2WIAA 3RQIA 3TXAA 1ZEMA 4KRXA 5JCJA 2ZRFA 3CCCA 2X42A 1UPUA 3GPLA 3P5BA 2CFOA 4DMLA 5BWBA 5JY1A 3EHEA 3DR3A 5CJJA 3AEYA 1CR6A 2ZIVB 4AUMA 4G9BA 3PUIA 3MT8A 1XAHA 4N40A 2FKNA 5ETJA 3SSAA 1P1HA 2E0IA 3VU0A 2O2YA 4N5MA 1LQUA 2QP3A 3K6SB 3GT4A 2VQDA 2WU8A 1IXYA 4HPWA 4IDFA 3LPLA 1BW9B 2ZBDA 4P31A 5GZ6A 4JI1B 5ALKA 3GCWA 1EFKA 3L7MA 3ZQ6A 1VC2A 1WXIA 3DV2A 4Q6BA 4BECA 1SC6A 4OM8A 1UAAA 3TG2A 5C46F 1SVSA 1BFUA 1V2GA 3AF3A 3TPFA 3EDRA 4KN8A 1PGJA 2A33A 4DLTA 3M8KA 3ED5A 3AMVA 1Z74A 2I34A 5IJWA 4HN4B 1CU1A 1T9GS 2RI6A 2VHVA 2OA0A 4ZYZA 3DZIA 1PNRA 3BHMA 4JOCA 3SBEA 4BNGA 2QM3A 4GBMA 1PJ3A 1P4RA 2RBGA 3WGVA 2C03A 3GA0A 4GWKA 2YXEA 4B35A 4DV7B 4LJ5A 5EWMA 3ZNNA 5ICGA 5ALWA 5JOQA 5FNVA 3QE2A 4JELA 1RLOA 2QI9F 3C2QA 4TKUA 1JUDA 3IJ5A 5CIQA 1E7YA 5AK0A 2IPNA 1QZ3A 1QRRA 3QUCA 1RD4A 1USKA 2GEFA 2QKYA 4XASA 5AI5A 1I6LA 2R8EA 1C1DA 2QTVB 3PC3A 4QA9A 4DCNA 2WA1A 3A6DA 2XMPA 2CDBA 4CM9A 3ESXA 1F8FA 1N5LA 3MINA 4BCCA 4PO8A 3TQQA 6ADHA 2DLNA 3N7UA 4YRCA 2V1UA 1GUBA 5DGHA 2QSJA 3PJEA 2X9LA 2TS1A 4AJKA 3FA2A 3R7LA 6ABPA 5K3FB 1L7NA 5JI2E 3R5JA 3A36A 1HMYA 4YMSA 3N7AA 1OBCA 2NYRA 2RB5A 3OU2A 1OH8A 4FFRA 4J2OA 1QLWA 3ND8A 4RY8A 3VTAA 4R84A 3G1WA 4HDNB 4NH4A 4TV9B 4D46A 3Q3VA 3AFNA 1VA5A 4HDMA 2YIJA 4M9ZA 2DXIA 2A2ZA 1NMXA 4NHOA 1D2CA 5K8JB 2B69A 1NQTA 3EZ6A 1UWCA 1WX1A 2ONYA 4L5JA 4LBWA 3VOSA 1P5ZB 2PJRA 1IBCA 2ZRAA 3CE9A 3PE4A 4G41A 4DIBA 4UE2A 5HWSA 7YASA 1T2CA 3EFOA 1WIWA 2VZEA 2Q1SA 4RMNA 2W4MA 1NKSA 4QUBA 2GYYA 4UNNA 1FS6A 3VU3A 3HHEA 1S2IA 2FR8A 4CV1A 4DJJA 4E22A 4X65B 2XA2A 1UPTA 4YCMA 5JADA 2GK6A 2IUUA 3VR5A 2DOKA 3IEIA 1KKUA 5HQTA 1GU7A 3PS9A 1NQAO 1B76A 4URVR 5J2UF 3FYUA 1A8SA 1B6SA 1OC4A 1UXHA 2CF6A 5U4XA 4MQ4A 3SK0A 2X0NA 4CM7A 4DREA 2H11A 2GHIA 5JRZA 5D85A 2IOFK 4NBTA 4B8ZA 5AW4A 1RHMA 5TE9A 3C3KA 3WYEA 1X94A 2NO9A 2VHZA 1ZNYA 2ZUBA 2C5HA 3F5MA 3JR3A 4LRXA 4PR3A 5IC5A 3V2UA 3ZGZA 1P9RA 1RCUA 3CJTA 2ZZMA 2OOSA 3H3XA 3IR6A 2GBIA 5A05A 3EXFA 1GA1A 2P2LA 3CSDA 4J7AA 4MNTA 4MPTA 4TZ0A 1XMIA 1RYHA 1EDOA 2EKZA 2Q5IA 4I6JA 3PR2B 4UNQA 5BQXA 3L0ZA 1E6UA 4CF6A 4TQ9A 2IIVA 3CNLA 3RBVA 1JFLA 5JTTA 3VA7A 3GLGA 3IR7A 5H4HA 2RK6A 3ED1A 4JLDA 3VR4A 2XADA 3V6MA 5AW2A 4HAWA 4ZO7A 1NJGA 1EBUA 1SVIA 1O7JA 1PZHA 2A1UA 2H1WA 2H6EA 3CQ9A 1I4WA 2Q0XA 2QRLA 3RU3A 3VDNB 2KHZA 3NHMA 3UWOA 2UXCB 2QG4A 1IN8A 2XGMA 5DB4A 2R1ZA 4ZWNA 5JISA 3WTCA 5LYJB 5KEIA 2IYOA 2GTPA 1BEUB 4JFRA 1HFKA 1I3OA 4K2AA 4V1CB 4JROA 4J1TC 2AT1A 1NJ8A 2JAHA 1CEYA 1XTJA 1AUVA 3QPWA 1OW3B 3ZDZB 3KSBC 2ZIWB 3K3PA 2R1UA 3IRUA 3NC0C 2ODTX 3K31A 4HDKA 4AXBA 1MX5A 3TOZA 5A4JA 2DTXA 1DMRA 3BE6A 3EBLA 1AZTA 2R1TB 3H19A 4JVMA 4LSGA 3WJAA 5MF6A 1CEEA 1XVTA 4YA6A 4R0MA 2GDJA 3MIIA 1XKQA 4ME6A 5ALYA 2XMCA 4LYHA 3O31A 1Y81A 1YULA 2HMYB 1ZD1A 4GQIA 4TLBA 1ENYA 5A5VA 4C5CA