2AD6A

Crystal structure of methanol dehydrogenase from m. w3a1 (form c)
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
571
structure length
571
Chain Sequence
DADLDKQVNTAGAWPIATGGYYSQHNSPLAQINKSNVKNVKAAWSFSTGVLNGHEGAPLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAGQIVKKQANGHLLALDAKTGKINWEVEVCDPKVGSTLTQAPFVAKDTVLMGCSGAELGVRGAVNAFDLKTGELKWRAFATGSDDSVRLAKDFNSANPHYGQFGLGTKTWEGDAWKIGGGTNWGWYAYDPKLNLFYYGSGNPAPWNETMRPGDNKWTMTIWGRDLDTGMAKWGYQKTPHDEWDFAGVNQMVLTDQPVNGKMTPLLSHIDRNGILYTLNRENGNLIVAEKVDPAVNVFKKVDLKTGTPVRDPEFATRMDHKGTNICPSAMGFHNQGVDSYDPESRTLYAGLNHICMDWEPFMLPYRAGQFFVGATLAMYPGPNGPTKKEMGQIRAFDLTTGKAKWTKWEKFAAWGGTLYTKGGLVWYATLDGYLKALDNKDGKELWNFKMPSGGIGSPMTYSFKGKQYIGSMYGVGGWPGVGLVFDLTDPSAGLGAVGAFRELQNHTQMGGGLMVFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The enzymatic reaction-induced configuration change of the prosthetic group PQQ of methanol dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methanol dehydrogenase subunit 1
total genus 173
structure length 571
sequence length 571
chains with identical sequence C
ec nomenclature ec 1.1.2.7: Methanol dehydrogenase (cytochrome c).
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13360 PQQ_2 PQQ-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.140.10.10 Mainly Beta 8 Propeller Methanol Dehydrogenase; Chain A Quinoprotein alcohol dehydrogenase-like superfamily 2ad6A00
2AD6A 2AD8A 1YIQA 1FLGA 1KV9A 4CVCA 4MAEA 1H4IA 1W6SA 4MH1A 4TQOA 2AD7A 2D0VA 1H4JA 1LRWA 4CVBA 1G72A 1KB0A 4AAHA
chains in the Genus database with same CATH superfamily
1R9MA 2P8SA 3HACA 3C45A 2ONCA 1HJ4A 2AD7A 2JIDA 4KR0A 1XFDA 4FFWA 4CVCA 3O95A 5T4BA 2Z3ZA 2GBCA 2D0VA 5KBYA 4CVBA 3OPMA 1LRWA 2AD8A 2QOEA 1NNOA 1NU6A 1ORWA 2AJBA 3KWJA 4N8DA 3VJMA 3Q0TA 4G1FA 1N90A 1NIRA 1HZVA 1E2RA 4DSZA 3F8SA 1FLGA 3VJKA 4DTCA 4N8EA 5ISMA 5T4EA 1H4JA 2G63A 4PV7A 1HCMA 1X70A 4Q1VA 4TQOA 5T4HA 4WJLA 2GBIA 1GQ1A 3QBJA 5LLSA 5T4FA 2OQIA 3VJLA 2Z3WA 1PFQA 2QT9A 1TK3A 2D5LA 2OPHA 3D4LA 4DSAA 2OAGA 2G5PA 3OC0A 4QZVA 1AOQA 3O9VA 4J3JA 2RIPA 2BUBA 2DCMA 3W2TA 2I78A 1H9YA 1YIQA 4JH0A 3NOXA 1BL9A 1NU8A 2RGUA 4MH1A 1TKRA 1Z68A 2BUAA 1DY7A 2BGRA 2FJPA 1KV9A 3BJMA 2OQVA 3EIOA 1U8EA 2I03A 2AJCA 1KB0A 1GJQA 2AD6A 2QKYA 3Q8WA 4FFVA 1H9XA 3G0DA 2AJLI 1W1IA 3CCBA 1HJ3A 3CCCA 2AJ8A 5J3JA 1W6SA 1N1MA 2IIVA 1AOMA 3SX4A 3WQHA 2ECFA 3SWWA 1QKSA 2OAEA 2OLEA 3C43A 1R9NA 1HZUA 2BUCA 4L72A 1WCYA 1ORVA 2GBFA 1RWQA 2OGZA 2QTBA 1N50A 4MAEA 3HABA 2QJRA 4A5SA 1HJ5A 1G72A 2GBGA 4AAHA 2HHAA 3G0BA 2IITA 2I3ZA 1AOFA 1J2EA 1H4IA 1N15A 3H0CA 5I7UA 2BGNA 2G5TA 2EEPA 3G0CA 4PNZA 2AJDA 4LKOA 3G0GA 3KWFA
chains in the Genus database with same CATH topology
2AD6A 2AD8A 1YIQA 1FLGA 1KV9A 4CVCA 4MAEA 1H4IA 1W6SA 4MH1A 4TQOA 2AD7A 2D0VA 1H4JA 1LRWA 4CVBA 1G72A 1KB0A 4AAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AD6 A;  2AD8 A;  1YIQ A;  1FLG A;  1KV9 A;  4CVC A;  4MAE A;  1H4I A;  1W6S A;  4MH1 A;  4TQO A;  2AD7 A;  2D0V A;  1H4J A;  1LRW A;  4CVB A;  1G72 A;  1KB0 A;  4AAH A; 
#chains in the Genus database with same CATH topology
 1R9M A;  2P8S A;  3HAC A;  3C45 A;  2ONC A;  1HJ4 A;  2AD7 A;  2JID A;  4KR0 A;  1XFD A;  4FFW A;  4CVC A;  3O95 A;  5T4B A;  2Z3Z A;  2GBC A;  2D0V A;  5KBY A;  4CVB A;  3OPM A;  1LRW A;  2AD8 A;  2QOE A;  1NNO A;  1NU6 A;  1ORW A;  2AJB A;  3KWJ A;  4N8D A;  3VJM A;  3Q0T A;  4G1F A;  1N90 A;  1NIR A;  1HZV A;  1E2R A;  4DSZ A;  3F8S A;  1FLG A;  3VJK A;  4DTC A;  4N8E A;  5ISM A;  5T4E A;  1H4J A;  2G63 A;  4PV7 A;  1HCM A;  1X70 A;  4Q1V A;  4TQO A;  5T4H A;  4WJL A;  2GBI A;  1GQ1 A;  3QBJ A;  5LLS A;  5T4F A;  2OQI A;  3VJL A;  2Z3W A;  1PFQ A;  2QT9 A;  1TK3 A;  2D5L A;  2OPH A;  3D4L A;  4DSA A;  2OAG A;  2G5P A;  3OC0 A;  4QZV A;  1AOQ A;  3O9V A;  4J3J A;  2RIP A;  2BUB A;  2DCM A;  3W2T A;  2I78 A;  1H9Y A;  1YIQ A;  4JH0 A;  3NOX A;  1BL9 A;  1NU8 A;  2RGU A;  4MH1 A;  1TKR A;  1Z68 A;  2BUA A;  1DY7 A;  2BGR A;  2FJP A;  1KV9 A;  3BJM A;  2OQV A;  3EIO A;  1U8E A;  2I03 A;  2AJC A;  1KB0 A;  1GJQ A;  2AD6 A;  2QKY A;  3Q8W A;  4FFV A;  1H9X A;  3G0D A;  2AJL I;  1W1I A;  3CCB A;  1HJ3 A;  3CCC A;  2AJ8 A;  5J3J A;  1W6S A;  1N1M A;  2IIV A;  1AOM A;  3SX4 A;  3WQH A;  2ECF A;  3SWW A;  1QKS A;  2OAE A;  2OLE A;  3C43 A;  1R9N A;  1HZU A;  2BUC A;  4L72 A;  1WCY A;  1ORV A;  2GBF A;  1RWQ A;  2OGZ A;  2QTB A;  1N50 A;  4MAE A;  3HAB A;  2QJR A;  4A5S A;  1HJ5 A;  1G72 A;  2GBG A;  4AAH A;  2HHA A;  3G0B A;  2IIT A;  2I3Z A;  1AOF A;  1J2E A;  1H4I A;  1N15 A;  3H0C A;  5I7U A;  2BGN A;  2G5T A;  2EEP A;  3G0C A;  4PNZ A;  2AJD A;  4LKO A;  3G0G A;  3KWF A; 
#chains in the Genus database with same CATH homology
 2AD6 A;  2AD8 A;  1YIQ A;  1FLG A;  1KV9 A;  4CVC A;  4MAE A;  1H4I A;  1W6S A;  4MH1 A;  4TQO A;  2AD7 A;  2D0V A;  1H4J A;  1LRW A;  4CVB A;  1G72 A;  1KB0 A;  4AAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...