2AD8A

Crystal structure of methanol dehydrogenase from m. w3a1 (form c) in the presence of ethanol
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
571
structure length
571
Chain Sequence
DADLDKQVNTAGAWPIATGGYYSQHNSPLAQINKSNVKNVKAAWSFSTGVLNGHEGAPLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAGQIVKKQANGHLLALDAKTGKINWEVEVCDPKVGSTLTQAPFVAKDTVLMGCSGAELGVRGAVNAFDLKTGELKWRAFATGSDDSVRLAKDFNSANPHYGQFGLGTKTWEGDAWKIGGGTNWGWYAYDPKLNLFYYGSGNPAPWNETMRPGDNKWTMTIWGRDLDTGMAKWGYQKTPHDEWDFAGVNQMVLTDQPVNGKMTPLLSHIDRNGILYTLNRENGNLIVAEKVDPAVNVFKKVDLKTGTPVRDPEFATRMDHKGTNICPSAMGFHNQGVDSYDPESRTLYAGLNHICMDWEPFMLPYRAGQFFVGATLAMYPGPNGPTKKEMGQIRAFDLTTGKAKWTKWEKFAAWGGTLYTKGGLVWYATLDGYLKALDNKDGKELWNFKMPSGGIGSPMTYSFKGKQYIGSMYGVGGWPGVGLVFDLTDPSAGLGAVGAFRELQNHTQMGGGLMVFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The enzymatic reaction-induced configuration change of the prosthetic group PQQ of methanol dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methanol dehydrogenase subunit 1
total genus 172
structure length 571
sequence length 571
chains with identical sequence C
ec nomenclature ec 1.1.2.7: Methanol dehydrogenase (cytochrome c).
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13360 PQQ_2 PQQ-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.140.10.10 Mainly Beta 8 Propeller Methanol Dehydrogenase; Chain A Quinoprotein alcohol dehydrogenase-like superfamily 2ad8A00
4MH1A 4CVBA 2AD8A 1LRWA 1YIQA 4MAEA 1W6SA 4AAHA 1H4IA 2D0VA 1KB0A 1G72A 1FLGA 2AD7A 4CVCA 1H4JA 4TQOA 2AD6A 1KV9A
chains in the Genus database with same CATH superfamily
4PV7A 2AJLI 3G0GA 2D5LA 1R9MA 2I78A 2DCMA 2HHAA 1X70A 2AJBA 1H4JA 1H9YA 2QJRA 2AJ8A 2QKYA 2QT9A 4JH0A 2OQIA 2OQVA 3WQHA 2GBIA 5T4EA 3F8SA 1YIQA 3D4LA 2BGNA 4WJLA 3G0BA 4N8EA 2AJCA 2BGRA 2G63A 1H4IA 1WCYA 2OPHA 1KB0A 4N8DA 5T4BA 2AD8A 4KR0A 1E2RA 1QKSA 5KBYA 3OC0A 5T4HA 3VJKA 2I03A 1W1IA 2AD6A 1ORWA 2ONCA 1LRWA 1TK3A 1NU6A 1RWQA 2GBFA 1GJQA 2RGUA 3H0CA 1HZUA 3CCCA 3VJLA 1HJ5A 4AAHA 3SX4A 1TKRA 2P8SA 1ORVA 3Q8WA 2JIDA 2GBCA 4L72A 3VJMA 2D0VA 2FJPA 4Q1VA 3KWJA 2OAEA 2Z3ZA 2G5TA 3G0DA 3NOXA 1H9XA 1NU8A 2OLEA 1N50A 2OAGA 3W2TA 4QZVA 2RIPA 4MH1A 2G5PA 1HCMA 1W6SA 2ECFA 3OPMA 3O95A 4CVBA 5T4FA 4FFWA 1J2EA 4DTCA 1AOFA 3Q0TA 2IITA 5J3JA 4TQOA 2BUBA 4DSAA 4PNZA 1PFQA 4DSZA 1AOMA 3QBJA 3SWWA 1KV9A 3CCBA 3EIOA 1HZVA 2BUAA 2GBGA 2IIVA 3O9VA 1G72A 2I3ZA 3C45A 1NIRA 1AOQA 2OGZA 4J3JA 1BL9A 5LLSA 3C43A 1GQ1A 1R9NA 2BUCA 2EEPA 3KWFA 1HJ4A 1N90A 4CVCA 5ISMA 3BJMA 1U8EA 4MAEA 2QOEA 2Z3WA 2QTBA 1NNOA 1FLGA 1N1MA 3HABA 4FFVA 5I7UA 2AJDA 4LKOA 4G1FA 1Z68A 1DY7A 1N15A 3G0CA 1HJ3A 4A5SA 1XFDA 2AD7A 3HACA
chains in the Genus database with same CATH topology
4MH1A 4CVBA 2AD8A 1LRWA 1YIQA 4MAEA 1W6SA 4AAHA 1H4IA 2D0VA 1KB0A 1G72A 1FLGA 2AD7A 4CVCA 1H4JA 4TQOA 2AD6A 1KV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MH1 A;  4CVB A;  2AD8 A;  1LRW A;  1YIQ A;  4MAE A;  1W6S A;  4AAH A;  1H4I A;  2D0V A;  1KB0 A;  1G72 A;  1FLG A;  2AD7 A;  4CVC A;  1H4J A;  4TQO A;  2AD6 A;  1KV9 A; 
#chains in the Genus database with same CATH topology
 4PV7 A;  2AJL I;  3G0G A;  2D5L A;  1R9M A;  2I78 A;  2DCM A;  2HHA A;  1X70 A;  2AJB A;  1H4J A;  1H9Y A;  2QJR A;  2AJ8 A;  2QKY A;  2QT9 A;  4JH0 A;  2OQI A;  2OQV A;  3WQH A;  2GBI A;  5T4E A;  3F8S A;  1YIQ A;  3D4L A;  2BGN A;  4WJL A;  3G0B A;  4N8E A;  2AJC A;  2BGR A;  2G63 A;  1H4I A;  1WCY A;  2OPH A;  1KB0 A;  4N8D A;  5T4B A;  2AD8 A;  4KR0 A;  1E2R A;  1QKS A;  5KBY A;  3OC0 A;  5T4H A;  3VJK A;  2I03 A;  1W1I A;  2AD6 A;  1ORW A;  2ONC A;  1LRW A;  1TK3 A;  1NU6 A;  1RWQ A;  2GBF A;  1GJQ A;  2RGU A;  3H0C A;  1HZU A;  3CCC A;  3VJL A;  1HJ5 A;  4AAH A;  3SX4 A;  1TKR A;  2P8S A;  1ORV A;  3Q8W A;  2JID A;  2GBC A;  4L72 A;  3VJM A;  2D0V A;  2FJP A;  4Q1V A;  3KWJ A;  2OAE A;  2Z3Z A;  2G5T A;  3G0D A;  3NOX A;  1H9X A;  1NU8 A;  2OLE A;  1N50 A;  2OAG A;  3W2T A;  4QZV A;  2RIP A;  4MH1 A;  2G5P A;  1HCM A;  1W6S A;  2ECF A;  3OPM A;  3O95 A;  4CVB A;  5T4F A;  4FFW A;  1J2E A;  4DTC A;  1AOF A;  3Q0T A;  2IIT A;  5J3J A;  4TQO A;  2BUB A;  4DSA A;  4PNZ A;  1PFQ A;  4DSZ A;  1AOM A;  3QBJ A;  3SWW A;  1KV9 A;  3CCB A;  3EIO A;  1HZV A;  2BUA A;  2GBG A;  2IIV A;  3O9V A;  1G72 A;  2I3Z A;  3C45 A;  1NIR A;  1AOQ A;  2OGZ A;  4J3J A;  1BL9 A;  5LLS A;  3C43 A;  1GQ1 A;  1R9N A;  2BUC A;  2EEP A;  3KWF A;  1HJ4 A;  1N90 A;  4CVC A;  5ISM A;  3BJM A;  1U8E A;  4MAE A;  2QOE A;  2Z3W A;  2QTB A;  1NNO A;  1FLG A;  1N1M A;  3HAB A;  4FFV A;  5I7U A;  2AJD A;  4LKO A;  4G1F A;  1Z68 A;  1DY7 A;  1N15 A;  3G0C A;  1HJ3 A;  4A5S A;  1XFD A;  2AD7 A;  3HAC A; 
#chains in the Genus database with same CATH homology
 4MH1 A;  4CVB A;  2AD8 A;  1LRW A;  1YIQ A;  4MAE A;  1W6S A;  4AAH A;  1H4I A;  2D0V A;  1KB0 A;  1G72 A;  1FLG A;  2AD7 A;  4CVC A;  1H4J A;  4TQO A;  2AD6 A;  1KV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...