2ADJB

Crystal structure of monoclonal anti-cd4 antibody q425 in complex with calcium
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
214
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPDKGLEWVATISSGGSYTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARHEDGNWNYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Q425 Fab Light chain
publication title Interfacial metal and antibody recognition.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 214
sequence length 220
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adjB01
4B0MM 4DVRL 3MNVA 1JHKH 1YEFL 1XGPA 1EEZB 1QSVA 2J88H 1CCZA 2E7LA 3OXSB 2VITB 3AMLA 4MA8L 3WNMA 3EOTH 2W07A 1BQSA 3QEQE 2I27N 2NY0B 5GHWL 4QTIH 3H6JA 3QQ3B 1QFPA 3QPQC 3OKOA 4ZFOL 5EZLA 3LD8B 4HIHB 4W6WB 4Z7UF 3SGEH 4NZTH 3O6KL 4JCLA 1XFPA 3NCBB 4HT1H 1N2RB 1RIHH 1BEYH 4F7CB 3KWWB 5CP3A 4F7EA 1ZTXL 5MEOB 4NUGH 4HAGA 2V7HA 2ERJC 3UTTE 5EFIB 4MNQD 3IFOA 3CVHB 4C56E 4DKEL 3MRQB 4LSQH 3KPSE 5DUPH 5LAXA 5CIPH 1T0NB 3CCHB 3NH7L 4JO1H 4HKJB 4G8GE 4U1KA 1YJDL 2G75A 2MQ3A 4PJFB 4YHIB 3HS0A 4RQQB 1NBYA 2IQAB 1GPOL 1HCVA 3MJ6A 3KPRA 1H15B 4NC2B 5I6XB 4AK1A 3RA7L 5HHXL 4ETYA 4V1DD 3BD4A 5CWSA 3MR9B 4PRHB 1QFWL 3S36H 1KB9J 1YY8B 5GS2H 3GMPA 3ARGA 1RY7B 4NO3B 5HTSA 2DWEB 1ZT7B 4AEIH 3C5ZA 2ICEA 2YR3A 2LAAA 3MRFA 3QCUL 5F88B 3VXSD 2HRPH 5JDSA 5IJKA 1EH9A 3NCYS 2EH7H 3CUPA 3UTQA 5A16A 1NBZA 4DZBA 4XVTH 4E0RB 1MH5A 4P3DA 3BAEL 5HHME 4OQTA 5L8LB 2FLRT 4BSWB 2I5YH 1MHHA 4ZPVA 5B4MD 5EUOE 4PJHF 1MJUH 3VDAA 2A74B 3QFJA 3HR6A 4LLMA 4CUCA 1DBKH 3Q0HA 3VJ6A 1KCKA 3B3IA 2FEDD 4O2CA 3TZVB 4NWUH 3SE4C 5IB2B 4U1GB 5C0AD 1MEXL 3T09A 4ZOEA 5DRNA 2X1XR 3ILPB 1LEKA 1JYNA 1DBBL 2Z0BA 2WLYA 5C07A 1HYSD 4KJPC 4NPYB 3QJFB 5FV1L 3PWJB 3UDWA 2B1AH 5KS9E 5IV2A 1FNFA 4ZS6D 5GGSY 1I8LA 4R90H 4Z77A 3D3VA 4U1NA 4WTWA 1X5YA 4OSUH 3WIIH 1IQWH 3BEVB 2DM2A 3TN0A 1R3KB 4H20H 5D7LD 4YDLC 1OLZA 5ADPL 3WIFB 1BFTA 1WAAA 2WQ8A 2GFBA 3MGAA 1XCTB 1F3JA 1HZHH 1JGEA 3ZSTA 1RZ7L 3KDMB 4QXGH 4IDLA 3H7BA 5A3IC 1PY4A 4JRWA 4GG6A 4FQCH 3IVKA 2IQ9L 3FZUD 3ZYJA 4YX2H 1F00I 3QEQD 1FJ1A 5C0BE 4Y5YB 4ZQKA 3FQUB 3SKOA 5I1CH 3MXVL 5T1LB 5I1KH 5DLML 4F3FB 3MNWA 2A6DA 4HH8A 5C0GA 2XWTB 1FZKB 3BFOA 1NSNH 4P23A 4BQBA 4JFHE 1CGXA 3CXDL 2W0KA 2GEEA 1F90H 4AYFA 3UTTD 5GGUB 2CRIA 1V3LA 4UQ2A 1NANI 1ONQA 3HHRB 4AT6B 2CK0L 4C56D 3KPSD 3TYFA 2UVEA 3ARBC 4YHPB 4G8GD 4ZG1A 1B88A 1OAKL 3FO9A 1MWAB 2WP3O 4OLWL 8FABA 5LQBH 43CAB 1U3JA 4K8RD 3CVHL 5FYKE 1IC7H 3ROOA 1E4XI 4LMQE 3WLBB 1OTTC 4YR6A 5BZWB 3I75A 2CGRH 4Q9QL 4JDTL 5FK9B 4Y4HC 5ILTL 2D4DA 1A64A 1FNSH 3LS4H 2AQ3A 5DO2C 1T1YB 5T3ZH 4YZFE 4KKBD 4ZFZA 3QWRD 3MV9E 3VGEA 5D1ZC 3V6OC 1I9RH 1W72H 2BERA 4MNQA 2ZUXA 3GBNL 1S7WB 3MRPA 2YOCA 2MMXA 5K9QG 1MJJA 2ED8A 1NCAL 3QEGL 1REIA 4MAYB 1X7QB 4PJGA 1W0VA 1GHFL 3QG6B 1FVEA 3S35H 2AI0H 1OD9A 4KJYB 4HJJH 5HHMD 1F6FB 1VGKB 4ZD3L 1YEKH 2GUOA 1JNLL 1MCFA 4LSSL 4U3XA 5I1LB 2IPUK 4V1DA 1WK0A 2OZ4H 1IKFL 3X11A 2DQHL 2FECL 4OFYD 1EIBA 1JZ7A 5EZIH 3GJFH 5BV7H 5DJ8B 1BIHA 3PGFH 3EJZC 1TTFA 1FLRL 3VXSA 2V2WA 4OD2A 1A6ZA 1C16B 1A1OB 2BC4A 1G7QB 5CMAA 2X4OB 1EJ6A 4XBPB 2A9NL 5T33L 4GW5A 3E3QE 4LAQH 3WFCL 3C6SB 4YWGL 5BOPA 2GSIB 2BNUA 4MCZA 2BY2A 4NGHL 1JNHB 2APWA 3ZE0F 3VI3E 5SX5H 1RZJH 1F8TH 3ABZA 35C8L 2XTJC 3TCLA 4EKXA 1CDYA 1R24B 2HTKC 4XB7A 2YKLH 3RI5K 1K4DA 1SY6H 1CICB 3L3JB 4J3VA 5D5MA 5EOTA 5TDOA 1CIUA 4U2YA 5DD3L 5F7HA 1RVFH 4Z78B 4F33B 5C0AA 1ZWIA 3MRRA 1UM5H 4OZIB 1GGYA 4K94L 4YXKH 3SCMC 4NQCD 4QHKI 1HEZA 6FABL 1T5XA 2HFFB 1XGQB 3HB3C 5KVGH 3ZE1F 4XP5H 1KXQE 5C0BD 5KG9A 2X70A 1VENA 1OAYL 2BFVL 5CILL 3VG9B 3G5ZA 4OLEA 4RAUA 4BA8A 4LSDA 5MHSE 2P5WB 3O2WH 2VXSL 3DV6B 1S7VA 2XPGB 3CFCH 1IGIL 1XR9B 1UQSA 5DK0B 5ESAA 2OTPA 3OB0H 5TDPB 3OKYA 4JFHD 5GGQL 2BNQB 1T1XA 3FQNA 2DQIH 4PGDB 5DD0H 4QT5A 1PKQA 1OLLA 1MNUL 4LGSB 5DEZA 3IU4L 1MCIA 3WYRA 5GZNC 1NEZA 1IEBA 3JV5A 4Z0XA 3MJ9H 1DSFH 1YNTB 2BK8A 1U8IA 3K0WA 4WV1C 4X6FB 2BCKA 4M5ZH 1J12A 5D7JD 2L4OA 4WWKD 3CK0H 3DTXB 4PG2A 4KUZL 5CGYC 3UTZB 3HE6D 3QEQA 5FYKD 1WBXA 5DD5L 3D39B 1HINH 3NABH 1MWAL 5D6CB 3U9UA 1QFOA 1K4CA 5DXWA 2VQ1A 3QUMA 3V8CA 4E5XA 5E7FA 3HKFA 5JHDD 2BDNH 2V7NA 1S7QB 4M62H 5DHYB 3MV9D 3VXQA 1CGTA 4D0DA 3U7YH 3UTTA 2F74B 1I7RA 4M02A 4M7LH 5EZJA 1WZKA 2D31B 2OJEB 4C56A 3KPSA 1UJTA 2J6EL 2NMSA 2J8UB 2NLJA 4G8GA 1A7QL 3CSYA 5HGGS 3DRTA 3EYVA 3SGKC 4KRLB 1XF3B 2IPTL 4P46D 3LKRB 5C0CB 4P4KC 1M7IA 2ZP0T 4U3CA 2Z8SA 4Y5VC 1GC1C 1KN2H 3ZO0A 2NY5H 4ZTOH 2X5PA 3NZ8A 1RZKC 4JGUA 2BXZA 2R8SL 1QO3B 5JOEA 1S7TB 2C3WA 1JHLH 4KZEL 3MLSL 3QWRA 2EYSA 3JTTB 5GGTL 1J1OH 1QD0A 1XF2B 3SY0B 3LS5H 4NJ9L 1CD1B 3BYYA 4X0KA 5IG7A 4J1UA 2P46B 4Q74A 1V7ML 4PGCA 3P4LA 4J4PC 4WCYL 5JZ7D 4BK5A 2QR0B 5DEFB 3MPCA 1AC0A 1U58A 1T22B 4K7PX 3LOWA 5EUOA 4HF5H 1CXEA 4LVHC 3FONA 4P59H 2QQQA 4FXLA 1S5IH 4XX1E 4G7VH 4OFYA 1FVCB 1O7VA 4TOYL 2HYMA 2HLFC 5F70A 1CN4A 2VL5A 3T8XB 3RZCD 5KVFL 4OGYH 4XCEB 3P11L 2VDNL 4FP8H 1NCBL 3PL6C 5HPMA 1N26A 4GUPA 3Q6GL 5HDBF 5IT2L 4Y4FD 3PNWB 5D2NC 1NGZB 5ACMA 3CD4A 4LVEA 4YBLB 1AHWA 1FL3A 5EC1B 5MHSD 5F8RC 1AI1H 4F58H 2VDRH 3NACL 3VFVB 4UUJB 2YS4A 1I7UA 4EI5B 2GJ6E 5A2FA 4LRNH 5J89A 1JHTB 1ORQB 1G0YR 3DUUB 1DFBH 5I17A 5C6WH 3AREB 3W5NA 1C7SA 4MVBC 1FYTB 4HIEB 4X6CE 4EBQL 2C4FT 4MQ7A 4M9OA 3G6AA 4TSCL 3FFCB 2ZUYA 5TDNB 4YJZL 2NY6B 1QYGL 3V8OA 3PP4H 3P4OA 2J4WH 2VNCA 3L6FB 1CFQB 1CGWA 2OTUB 1NJ9A 5HDQL 4Z9KB 2P5EE 4Y5XA 1BQLH 5DEGB 4PRBA 4D8PA 3MFFA 4X7TB 1MFBL 1YMMB 4AMKH 3TIDB 1E28A 1EA9C 5ESVA 3CGTA 5C0BA 2CJUH 4KVCH 4Q9BA 3LIZH 3HZYB 3V79C 4YDKH 5B3JE 5CZVL 4LPCA 3TO2A 4KQ3H 1N6UA 4LVNB 1OL0A 2HJLB 5L9DH 3TP4A 1PG7W 1CK0L 1ADQA 3CFEB 5CP7A 3BESR 1J8HB 5BS0E 1B6DA 1I8IA 2VZUA 1V3JA 3BKYH 4OB5L 2X05A 1BBDL 3BZEA 3TVMD 3LSOA 5H94B 4GRLB 4PG9B 4P9HL 2FR4B 1YEGL 1EEYA 5IW1A 4NNYA 3DSFH 2WLZA 1JYXA 2IWGA 4HUUA 3MRLB 4P3CL 4GW4A 5D7JA 4M7JH 1U8HA 3C60C 2IJ0C 4WWKA 5F6HI 2DQUH 3PDOB 2HKHH 4RGMC 3NPSB 3UP1A 4Y4KD 3O2DA 3VMOA 1TZIA 2ID5A 4P57B 3MUZ1 1D9KC 1JWSA 5I8KL 4QO1A 3RY5A 2NY4B 4WO4B 4MZ3A 3QIWC 2VB5A 5KZCB 2UWEB 5MENE 3MLZL 1IBGH 4LSRL 4O58H 3L5XH 3IKCA 4EIGB 5FCSH 4H1LB 5B8CC 3U36B 4OCSL 2KKQA 3MUY1 3MV9A 2C7UA 1SM3H 2HKFL 3ARFD 3ZYZA 5CEZH 15C8H 3UJTH 5I8EA 1RK0A 3KLAB 5D9SA 3ROLA 1JWMB 3T1FB 2ADGA 3DROA 1TTGA 2YSSA 1B3JA 2AXFB 3DIFB 2DOCA 3KPLB 5CHNA 1TPXB 4M48L 1C5CH 5D7IF 1JWUB 3VXMB 5IIEB 5IKCB 4MHHI 1ZT4B 3VW3H 1HCFX 1O5DT 5K9KB 5I18L 2VDPL 1RZFH 3PE9A 2ZUSA 2FHCA 3P0YH 4KJWC 4PRAA 3LKQA 5D1QB 3MTRA 4ODWA 5TPWH 1I1FB 4JN1L 5T1MA 4I4WA 1YPZA 1M6OB 3GI9H 4Y2DD 3WS6A 2CQVA 3BZ4B 5CGMA 4PUBH 5KSAC 4O2FB 3W11C 2XA8H 4CMHC 1GIGH 4U6HB 4N1CA 2CR3A 2WNGA 4LSUH 1OVZA 3T0DA 3S97C 4NQSB 1KV3A 2I25N 1V5JA 3MA7A 3ECBB 2EYTB 4QRQB 1NKRA 3F7QA 5JDJA 2GJ6D 4IEFB 1YEIH 4H88H 4KK5D 5HI3D 3SDCD 4ZMAT 1BX2A 3IDYB 4CVXB 5DSCB 3I6GB 3RVXC 1BOGB 4N0UE 4U1JA 4XP4L 3EYQD 5IROA 1FH5H 4YXLL 1U8LA 4QEGA 5LWYH 4X7SL 3HNVH 3EOAA 3GIVA 4TUJB 3TV3H 5D2LF 5J3HD 3FT4A 4X7CC 3RKDD 5GISL 1S9WB 3RZCA 4O2EB 2H6PB 5IVXB 2P5ED 2H2SC 2C1OA 2MTPA 4NHUB 4Y4FA 3B8YA 1HWHB 3X12A 5KSBB 4QTHB 4L8CA 1TVBA 1R3LA 4XMLL 4YHOL 3FQTB 2ITCB 1RJYB 2X4QA 4Q2ZA 3MRHA 1W8OA 3LD8C 4M8VA 4QHNB 4H0IA 3RKPA 2VZVA 2ITDA 4R7DA 4LSPL 3D25A 2HN7A 2Y4SA 2M8XA 2WBJD 3RIFF 4OCWL 5BS0D 5F7YC 5ABDE 1LO2H 1MVUA 1JNNL 1INEH 1UWEL 3VXPB 3QXDA 4JQXA 2AJ3B 1CD9B 2CUMA 1HHKA 2IH1B 3DHMA 4JVWA 3KJ4C 2FJHA 1KJ2A 4OUUA 4JQVC 4UOW0 1XZ0B 2AVGA 1C12B 4C4KO 3IJYB 1CZ8H 4YLQT 1Z5LB 1OCWH 1RUMH 1DBML 2FO4B 5L7XH 2F9BT 4XNQB 2R1YA 1LO0H 1S8DB 3IF1A 5AWNH 2AV7B 5CP3H 5I6XC 5DFTA 5TJWK 3GSNB 4X99B 5E6ZA 1DQQB 1NANH 3I3BA 5IM7A 3JBG7 2NXZB 1F11B 5MEND 3DETC 4GS7B 3DX7B 3ES6B 4JZOA 1YEDA 4ZUSB 3BIKB 2YPLE 4X98B 4KY1L 4QHLA 5C0RL 3GUTB 2F8VA 3HZKA 5IR1B 4X7EC 4Z0BL 3H9SE 4OKVA 2CLVA 3E2HB 3UYRL 1T03H 1OTUC 2R0KL 4UV4H 4O5LL 3SKJL 3TVMA 5B38B 2AK1H 3MA9H 4GG6F 1KJVA 2IGFL 1U92A 5MERB 4S2SA 3PDGA 1E4XH 1KIPA 1KT2A 2ADFL 1R5WA 4UILH 4W4NA 5C08E 3QI9D 2C3VB 2RQ8A 2GAZA 3EGSB 4M43H 4LNRB 3K8KA 2WUBH 3QHFH 1ACYH 5HGHB 4Y4KA 1YDPA 1BF8A 3LQAH 1Y18B 1VKXA 4J3WA 3DARA 3G6DH 3RPKA 5HGBB 5J6HB 2FO1A 3V7AG 4KI5F 3SOBL 3U7WH 3TBVA 3FT3A 4UZGA 4M5YL 4HG4J 3TZVC 4POUB 4LF3A 3ARFA 1D7FA 3JWOL 1AXSB 4NWTL 4GAYB 2K3TA 5H35B 1K2DB 1R6VA 1KTLB 1TJGH 4M3JA 1IT9L 3RU8H 2QSQA 1KN4H 3OAZH 3V6BR 4FMKA 5D8JL 3F7YB 3DYOA 2CLRB 1EZVX 4AENA 5C86A 5HVFB 3IXAA 1BD2B 1U95B 1Z9OA 2Y7QA 4G8EB 4LLWA 5DC0A 2UV3A 4K94C 3WFZA 5F1IA 5EUKA 3RWDB 5LJYH 4JFFB 1CFSB 3EO9L 4XCFH 4Y2DA 4YE4L 4KMTL 3HE7D 1XF5A 5F89A 4F9PC 1PW3A 5IB3B 5D1XD 1QBML 4Z7WF 1GH7A 4UIKH 5FM8A 4LFHG 5C9KA 5J1TC 3M17A 1HHJA 4HXBL 4Y5YC 3W0WE 3BPNC 3UBXB 4ZUWA 1P4IH 2D7PA 2GJ6A 3VFUA 4DWHA 1BFVL 4HUXB 3SDCA 3VA6A 4PJXB 2APXA 4LLQB 2XWBB 4DK6A 3AMKA 4LASH 4X6CA 1C1EH 2QQKL 4IRJC 5EU4A 1KCLA 3DURA 1HHIB 3VXTB 5ISZA 4K7FA 2H32B 5C9JA 1JK8B 4OFKA 4JDZA 2VXUH 3MLUL 1NPUA 3ZKMD 3QP3A 1RUAH 3FO2A 1C8PA 3LKPB 3QBTB 2OSLB 2P5EA 3VD3A 2WK2A 1A14L 4LARH 5F9OH 3GBML 3JWDH 5KBNC 4FZEH 1RIVH 2GJZB 3VGAB 2W92A 2FD6H 2IFFH 3U9PH 3FO1B 2IH3B 1A1MA 3WBDA 4Z7VE 4GKOA 4HWNA 4M8QA 2EKSA 3EHBD 1VEOA 2YPLD 2VZOA 5HDOA 2WBJA 5BS0A 1KTRL 3H9SD 1YN6B 3GSUB 5D5MF 5E8DH 2PTTA 1T83A 3IAQA 2VDLH 3RVTC 4JANB 1AO7E 2EDNA 2GCYB 5TE7H 4YHZH 1EJOL 2CDGB 2VKWA 4U05A 3E6HB 2RIKA 4BSVA 3O3BA 5DJYA 3LH2L 5C08D 4LCIL 4JHZA 2JCCE 4MAYC 4H26A 4QYOA 2A6IA 3KHQA 1BF2A 1LVEA 1NGYA 4LQ1A 2DN7A 4QCIB 5EBMA 1MPAL 2QEJA 1BZ9B 3MLWL 2RCSL 1E6OH 4F2MA 3DGGA 4HK3N 2BHUA 1K8IA 2MPAH 3MYZA 2BP3A 2CDFA 5MENA 1BJMA 2YEZB 3ULVE 1KIRA 3MRKA 1PZ5B 3T77B 3C5SA 4PJIB 2NY2D 3P30H 5ICXA 5T3XH 1CTNA 2XQBH 4XNUL 2IBZY 1CVSC 1MJ8H 1NH6A 2AJZA 4X8JA 5JW5A 3QZWA 2DQGH 4Y16B 3SDDD 4CU7A 3TT3L 3VFNB 4W70A 4G6KH 3QI9A 4IIQC 1CXKA 1V7NH 1MJ7H 1BVKB 1P84K 2EIBA 3V52L 4R96A 1OP3K 1YECH 3MZTA 1EAPB 1A1NA 4MD4A 1FO0L 5DJAB 5DF0A 8CGTA 2Z91B 2P8PB 3EDKA 4ZO6A 3SDXB 5HYJB 3MCKB 3I3DA 1P7QD 1CICC 4XWGL 3SE8L 3ZDZF 3HI6L 3R0NA 3I02A 3QUYB 1KIQA 2VZ3A 2ESVB 4PJ9A 4S1DD 3PWLB 3PWUA 4PRPE 5IB1A 3I50H 5IHZA 1VA9A 4HEPG 5HGDB 3V5DB 1MAML 1JGVH 2ICCA 4D0BB 2R0LL 2GK0B 3MJGX 4WDIB 3W0WD 5BRZE 4OD3H 3VG9C 1NCCL 4L9DA 3TBYA 3WEXA 5SV4A 2BHZA 4YQXH 1MRFH 4DGIH 5BZDA 1MFNA 5CJBA 5IB4B 1QFUL 1VCAA 4N0UA 2W0FB 3B2VH 2NY1D 1OTSC 1YUHA 3D0LA 2B1HH 1F97A 4M7KH 1BBJA 2NZIA 3MLTA 2YD3A 1QA9A 3B9KB 5J6GA 3CH1B 1XGYH 5C1MB 2VQUA 4YHLL 1JPGA 4KKLC 5KAQG 1ZLWH 3HE7A 3JV6A 1GOFA 4QRRE 5JPNA 1OAUL 3HPJA 3OSKA 2CMRL 1IJ9A 1JPSL 3TWCH 5D1XA 1NLDH 4KAQL 2QSCL 1WC7B 3GDBA 2GT9B 5CD3A 4HJ0C 5IHBA 1NMBL 1Q9KB 3G08A 4JO3H 3PDDA 1X4ZA 1HN1A 1TVHB 1PSKL 4JREB 1QR1A 3HZVB 5HYEA 3OKLA 1A6WH 1HHGA 5GRJL 3JTSA 4P9HC 4QF1B 1BLNB 1EGJL 3F65A 1UM4H 1YN7B 1P1ZB 1AO7D 2K1MA 1T7WA 2PTUA 4NZRH 1R3IH 4X4YA 4XVJL 3UPRB 3B5TA 1IL1B 3TYGH 5C0EA 3GHEH 3H0TA 2G5RA 3U0PB 2A6KB 5FUCE 1GL4B 1F3DH 5TF0A 3VFRB 2PR4L 4HV8A 3VXRB 5HGAB 1A7PH 2YK1L 4IDJL 5CAYB 5IFJA 5LGJB 1TMCB 3TIEB 3HCVB 3ULVD 1OW0C 2YPLA 4FQHB 1OAZH 3J8F7 4RBPK 3H9SA 4XAWH 4GAJL 2ZSVB 3LQZB 4XRCB 3RDTB 4MS8C 2NYYC 3ME0A 3P9MB 3ALXA 5FB8A 1F4AA 2HFGH 3AM8C 5C0IB 1QBAA 5INCB 3BKCH 4FRWA 5C08A 2XACC 4L3EE 4RFOH 4ZODA 1KTDB 3KYOA 4J3OC 4NKIL 2NX5B 1YEJH 2A9MH 2JIXB 2B4CH 5F97E 1GGBH 4X9HA 3SQOH 1BGXH 3BP7B 3CSBA 2RAMA 1UWGH 3MGOA 3S37H 3C2AL 1QVOB 1I1RA 5DJXB 3VFWA 1UJ3A 4OZHB 5IMOB 1IAKB 5EG6C 2Z8WC 4KPHL 4XCCH 2UUDK 3U1SH 2FEEL 4PJ7B 5FKPA 5IGXH 2VOTA 3DRQA 3NTCL 1IGCL 1WBYB 3O6MH 3T65B 4EQ2A 4FG6D 4P2RB 5ESQB 1I9JL 4NN6B 3JV4A 1KCVH 1F4XL 1S7RB 1YYLL 3K1KC 3G04A 4W6XB 3CAFA 4TPRL 3SDDA 1VFBA 5BRZD 3WFDH 4YBLC 2P24A 3KHOA 3LRHA 4KV5F 4LOUD 2B20A 3G5VB 5IW6B 3MRGB 5JNYB 2DD8L 2MCPH 2VLRE 4EI5C 1NCDL 3GSRA 1UT9A 4LSVH 2Z93B 3TPKA 3ULUC 1D5XB 4WHDA 3AREC 4ONGL 4Z7UB 1T7VA 2F54E 2DM7A 3AC0A 1O0VA 2W0LA 3EFDH 2NY6C 3EDFA 3QIBB 3N1FC 1P7QA 4O51B 2WSKA 2XFXA 2XN9E 3L7EB 4FQIL 1TTUA 1HSBB 4Y1AB 4QRRD 1FBIL 5JIKA 1UFUA 3W39B 4PV8B 4MCYA 4WUUB 3VFMB 1OOAA 2P8LA 5E2JA 3CDFA 2BVOB 1U8PB 4PJBE 3RY6C 1U8MA 3W0WA 4PD4J 1KACB 5T1DH 5TFSL 4LVNC 3AB0B 4NNXA 2R2HA 4PREA 2DQEL 1ZMYA 5T1KD 3VRIB 1AXIB 3ISWA 1Z3GL 1YPZF 1I8KA 2ENYA 1JHKL 1ZGLB 4G8IB 2R0WL 3G5XA 4YEEA 5IMMB 2RHEA 1KBGL 2XKNA 2WMPA 4GRLC 3CZFA 3SE9H 5JORB 5E5RB 5FO8A 3O9WB 3GGWB 4OZ4A 5JW3H 2X4TB 2DRUA 4HC1A 4DKFH 2QSVA 3HMXL 5C09E 2V2XB 2VISA 4M61B 1A3QA 4B7LA 1Z2KA 4LCWB 4NZTL 1JYWA 2CLZB 1H3TA 2HJKB 3BHBA 4WI9A 1X5ZA 3NPSC 4HT1L 2Y6SC 1RIHL 1BEYL 3VI3F 4QHKJ 4Q6IA 4Z7VA 1MHCB 3FQWA 1N5AA 4NUGL 2P48B 1UEMA 2NY4C 1QNZH 4WO4C 4PJHB 7FABH 3HG1E 5I1GH 3FN0H 1HXMA 4LSQL 4NYLA 4PGJA 5DUPL 1BPVA 2OQJA 3RIFK 2JB5H 1QFHA 2APFA 1AO7A 3UPAA 3STLB 2DLGA 5HDLA 4QRPE 3O2DH 3BP6B 5EC2B 1A7OH 1WZ1L 4L3ED 5HHPB 2H26B 1D6VH 2JCCA 1IC1A 4NSKA 3RGVD 4NN5B 4KDWA 4WEMB 5FYLE 5C8JA 2IPKB 1U3HB 2X4PB 1TPXC 3CJJA 5KN5A 1A2YA 1JF1A 4GMSH 1MCNA 1UWXH 1YEEH 1TVDA 3LPFA 4NRXB 3QEUB 1BJ8A 4AEIL 1P7KB 2E8YA 3S5LA 3RNKB 2P1YA 3MLVL 1A4KA 4HMDA 3EDDA 5D1QC 3JWOC 3D69A 4UTAL 4MJIE 1PEWA 2HRPL 4EI6A 4I18A 5GGRB 3SKMB 1KIUA 3U30B 3PV6A 5EWIL 3HFMH 2ARWA 2IPUG 3KPOA 4PJAF 5E6IC 2XXCB 4EUPB 1A22B 4I0PB 2O26U 1S7SB 3G5YA 3C9NB 5KSUB 2I5YL 3JXAA 3U4AA 1T1ZB 3OKKB 4NM8H 1EO8H 3V6OE 4BUHA 2VLRD 1DBKL 4K3EH 4JFDA 3IDYC 2F54D 3O6FD 2D7TL 4UB0H 1TJIH 1UZ6E 1FG9C 2YD8A 2BOCB 1HNGA 5IOPA 4XNMB 1BVLB 4S0SD 1CR9H 4KFZC 5DA4A 4J12A 1JGDA 5C0FA 3O45B 2B1AL 2CO7B 4UIMA 1JZ5A 4PRPA 4D9QE 4R90L 5F9JB 3G6JF 2DIBA 1H3XA 1MAJA 3WIIL 2X4UB 1IQWL 1OGAE 1FC2D 1U2CA 5BRZA 1A21A 3FB7A 1P2CB 4H20L 1CXLA 3CDGA 4JAMB 1HZHL 3T1WA 3OR7A 1KSRA 3IDNA 4NRYB 2YMXH 4K3DH 3MLYH 3V0WL 4N1EA 3ULSB 1YNKH 4GAGL 1IMHC 1KB5B 1N59B 3QDMB 1RUQL 3KPQA 3RUGE 1P5VA 3RWCA 3ZLQC 2VDQH 2XTJE 1AXTH 4QRRA 4BH8A 3WUWB 4PR5B 5C09D 3O11A 1OSZB 5KANG 1IFHL 2IADB 1F5WA 3UC0L 4IOIA 1S3KH 2HFEB 5I1DB 2ATPA 2R56H 1FN4B 1NSNL 4HKBB 5B39A 1FNAA 5A3ID 4PJEE 2Y5EA 5E5MA 1MQKL 3HRPA 1LE9B 1F90L 4CVWA 2X4NA 3VFOB 3V5KB 2NXZC 3HG1D 5HHQB 4GS7C 5FA3A 2CXKA 1K9TA 4ZOCA 5F6IB 1HIMH 5I19L 5T1KA 4XC3H 3E2HC 2W65A 4XP6H 3Q1SH 3OJDB 3FMGL 2O5YL 4QRPD 3IGAB 5FHBH 2WIIB 4NO5B 4DZ8A 5CSZA 2NR6C 5LQBL 2OX5A 3VH8A 4BKLA 1IC7L 4P5KB 4XTRD 5FYLD 2IALA 4EVNA 2IAMB 4GKSA 3WDHA 5DGRA 1SJEB 2NY3C 3MRBA 1U93B 5FM4A 4LPWA 1J0HA 4O02L 1AP2A 1NFDF 1R5VB 1CGUA 4QRTB 1GVIA 1B4JL 4ZAKD 2QJDA 3AXLA 4X6CF 1I9RL 2P7TB 4FQXD 4QXUH 1GAFH 2DMBA 4MJID 2PW1A 4MQXD 1JPFB 3QHTC 3IU3B 1IM9D 3OB8A 3S35L 4LHUB 2AI0L 4M1GL 4IHOA 1F3DJ 4JZJB 4WW2A 1BFSA 1QKZH 1AQKH 2OP4L 4L3EA 1C7TA 5HYQB 5DO2D 2VIRA 3RGVA 1CL7I 3QUKB 4FFVD 3WHXA 4OLYL 5C71A 1PY9A 3V6ZB 3KYKH 1G6VK 1LO4L 4H0GA 2FH8A 5EZIL 1KEML 5BV7L 3MYJB 5F6HJ 3K4AA 3PGFL 4HS3B 2EXYC 4I5BB 1A9EA 5IBUG 5I1AB 4X6EA 3KLHC 3WL9B 4TUOA 5E70A 3RWEA 1CLOL 2CKNA 1T6VN 1MCHA 1XGTA 2ZCHH 1ZHBB 2Y07H 4MGXA 3BH9A 3CFJA 4LAQL 4MMZC 4D9QD 2EDRA 3IXTA 4Y8AA 4NKQB 2EDKA 1N4XL 4L4TB 1H9VA 1KUMA 1OGAD 2NZ9C 2WUCH 3G9AB 1RJLA 3QNZA 4JG1L 5HYSA 5HD8C 4RZCA 1E4WL 2CPCA 5F96H 3EJZD 1J1PH 5JQ6H 1R3HB 4PJ5B 2VXQL 2VLRA 3TF7C 1GGIL 4XCNB 5ICYA 1N8ZA 1CG9A 2AKRB 3U48A 1JUFB 1MVFA 4GXVH 2F54A 3O6FA 1RVFL 1WQVT 5GS3A 3AS1A 5FGCB 1FAIL 4LHQB 4FXKA 2XN9A 5KVGL 1VHPA 2XTJD 3DBXB 2UY6A 4YFLI 1IAIM 5HHNA 4XXCA 3WIHA 3L3IB 1FC1A 4PYGA 3HI5H 3MGTA 3CFCL 4EN3D 1KB5L 3N1QC 1G7PA 4LLYA 2VE6A 1Q0XL 1NC4D 3T08A 1CF8L 4PJBA 1CFBA 3SE4A 1MRDH 3HA0A 5KSVB 4J8RB 2DQIL 4UDTA 3CVIH 3RVVC 3LPGA 3SCMD 5DJ2A 4FMFA 4PV9A 1HE7A 4MHHG 3HB3D 5DFWH 1Z9MA 2AEPH 4F8TA 3BGFB 2GYSA 3QEHA 1T3FA 3FB8A 3IFLH 3KR3L 4M6NH 5BO1L 4M5ZL 1FL5A 2DQDL 4P2YA 4F7MA 4H0HB 1WT5C 4UU9A 4L4VE 3EYOA 5EOCH 3SDAC 4L8DB 3TLRA 1NFIA 4MJ5A 1A4JA 5AYUH 3M07A 4K3GA 1JPTH 3LKOB 1MI5E 3D6GA 5C09A 4G42B 4A6YA 3P73B 4N0YH 5IVZA 4WJ5B 3NCMA 1DBAH 2FRGP 4FQ1L 3WUZA 2EIDA 3N1PC 5C6TH 4APQD 2BDNL 1KLUB 2A73A 4M62L 3VMNA 3S3PA 3Q3GA 3U7YL 1A9BB 1GZQA 4G6MH 4M7LL 5CCKH 3HG1A 4XNYH 1S7XA 1JI2A 3B5GA 4XH2A 5FXCH 4LLDB 1QBLH 4P5TD 1JCKA 3QNXA 1Q72H 1JMZA 2OL3A 3BI9X 4QRPA 5D71L 3O2VL 1XMWA 2E5EA 2FCBA 1RFDH 4KMQA 5KJRH 3LN5B 4Y16C 1WLHA 1CDCA 3BQUA 4FXGB 1JV5B 1NGWB 5IBLD 1KN2L 1KTKE 5J12B 2YXFA 1GZPB 4YEFA 3B9AA 4ZTOL 2O61B 4U1SB 4WNQA 1QSEE 3SGDH 4RGOH 3T0XA 1OT2A 1G9MH 3BH8B 4LPXA 4ZAKA 3LRSB 2HJFA 1FG2B 2AW2A 5F7DA 1J1OL 4TNVF 4FQXA 2R2EA 2XQYK 4HFUH 4MJIA 3T0BA 3LS5L 3KGRA 4OLUL 3RWHB 4R0LB 4JZNA 1IM9A 1MCBA 1PD6A 3QUYC 1QHPA 2DKUA 1ZS8A 2DWDB 2R29L 1OHQA 1OF2A 1H3PH 4GRWE 1U0QA 1CIDA 5F9WB 5JIPA 4MJ4A 4WHTB 1D5BB 1K5NB 4MD5A 3V4PL 2YBRB 1OSPH 2EIZB 1KC5H 3NA9L 3V6OA 1ZA6A 1AGDA 4JPIB 1VGEH 4P2OB 2RFXA 2HG5A 1T6WA 4KDTC 2F19H 4JO4L 2DDQH 4E42B 4KUCF 1E4KC 4X83A 5IFHH 4ONFH 5GSRA 2XZAH 1I8MA 2XTLA 1UM6H 4NKDA 5BVJB 3B9VA 1I85C 1PYWA 2HT4D 5C0DA 3TC9A 2R4RH 1J0ZA 2FZ3B 3BE1L 1P9MA 4RA3A 3TO4D 3OHXB 2APVA 1ZGLM 4WI6A 1AI1L 3L3HA 4F58L 1U8QB 3TH4T 3OXRB 3TA3D 2CR6A 4LRNL 1OGAA 3UTSE 3DX9A 3P2TA 5FUOH 4KWUA 2DQFB 3MRJA 3MJ8B 5CEXB 2ZUQB 1DTUA 1RZ8A 2R1XB 1LMKA 3MOBH 2AQ1A 4HJGA 4OT1L 4JREC 5SWZE 5JMOC 1NLBL 5CEYA 5D7SH 5GJTH 3PP4L 3P40A 2J4WL 1PG7H 2Z9TA 4Z7NF 2R2BA 4L8BB 1CLCA 3IJHA 3NCEB 1T4KB 2V9TA 3O4OB 2CIKB 3S4SG 3O41A 4JLRB 3RUGA 4L4VD 3FB6A 3P4NA 4AMKL 4E41E 2VDOL 2BSRB 5GGSB 4GKNA 3N1MC 5L2KE 4YUEH 2LE9A 2CJUL 4JDVA 1CE6A 4YDKL 1H0DA 4WHCA 2YUVA 4EN3A 4DTGL 1MREH 1NC4A 4U33A 5DTFA 2VAJA 3TPUB 4PJEA 5D7IB 1K85A 5CUSH 4IM8A 2DBLH 2W9EH 3BKYL 3OKOB 5EZLB 5GSVA 3SCMA 4D94A 2ZUWA 2GITA 3AAZA 5DFVD 3T4YB 1NMCB 5I9QB 4XBGA 5AZEL 2CIIB 4RAVA 4EUPG 2VZTA 1F6AB 2V7HB 5J9PB 1RHFA 2CK2A 2HVJB 4M6OH 2Y36H 1SVCP 4G7YH 4WY7H 3PGDA 2HKHL 2EDXA 3W9DB 3AVEA 4NQVB 4U1KB 2E27L 3BDBA 5DUBA 1A7NH 5DA0B 3KPRB 2HAZA 1INQB 4EOWH 2I07A 1QSED 1IBGL 4O58L 1OM3H 2AP2A 4HWEL 2CSPA 3L5XL 2XKSA 3OR6A 2F58L 4APQA 4CU6A 3BDYL 3QNYA 4CN4A 4WV1A 3C60D 4PJFE 3VFTA 4OCYL 1T2QL 1DQLH 5IQ9A 5D2LB 1PKOA 3RZWA 2DJSA 1D5MB 1D9KD 4P5TA 5MEQA 5AG8A 5EN2B 1T0MA 4ZPTA 4F7PA 4PRHE 4NN6C 4MSWB 1LK2A 3VW3L 5DRXB 1NBZB 3VRLF 4DZBB 4EDXA 3P0YL 5MEPA 1NL0L 4P3DB 2QSTA 4B7IA 1MHHB 2VAAA 5KVMC 2OBGA 3L5HA 3UZQA 1CTOA 4Z7QF 4LU5H 4LLMB 3RL1A 3QXVA 1LD9B 3VJ6B 3SGKA 3QIBC 3WUWG 1G7LA 1GIGL 4XWOC 5E9DB 5F21B 1WITA 2N4IA 1I75A 4B41A 2PNDA 2Y9RT 5TQ0L 1MFEH 4DCQA 1Q0YH 5DRNB 2EH8H 4PGEB 1OD7A 3OKEB 5KVEL 3HMWH 3MNZA 5C07B 1FL6A 1TQBB 4FNLH 5IV2B 5IBTL 2DLIA 1NGPH 3SDYH 1T04A 2QADD 1S7UA 3WMSA 4Q9RH 1JZ8A 4MNGB 3HNVL 5KSAD 1T2XA 3HC0B 3W11D 3D3VB 4U1NB 3L3DB 4W81A 3T3ME 3TV3L 5SWZD 4R4FL 3UXFA 1UB5A 4LKCA 3AB0C 4WI3A 3TN0B 1A7RH 3OAYH 2ARJQ 2VXTH 5GGVH 1OP9A 1N64L 4BZ2H 1F3JB 2FX7H 4KQ4L 4E41D 4UT6H 1J9CT 4XPGH 3U83A 5L2KD 1JFQH 1FZOA 4GG6B 5JOFB 3O9WC 3IVKB 3TO4A 2B0SL 4OFPA 3TA3A 4N0RA 2AJYL 4ZQKB 4RMTA 4ZFGH 3EYSH 1LO2L 4XXDB 1INEL 1CU4L 1VADA 1B0WA 4L9LA 5FECA 1FVDA 2EKJA 2XZQH 2NY0D 5C0ND 1CZ8L 3AGVA 3U7AA 3KJ6L 5GIRA 1FIGL 1HQ4B 4HFWB 4L29A 4BFIA 5IFAH 4L4VA 4HUWB 1FQ9C 3TYFB 2C9AA 2DLTA 1W8NA 1X9QA 3BN9C 2ZJSL 5L6YL 5AWNL 3O6LL 2JTDA 4HWUA 3X13B 2D03H 5T3ZE 2H1PH 1JZ4A 4TUKH 1MI5A 5E2TL 3MODH 4RWHA 5SV3A 4F57L 2Z8RA 4NN5C 4OCXL 5JW4R 5HJ3B 3DVIA 1U3HC 2OCFD 4LVOB 4ZDHB 1VFMA 3WNPA 4FZ8L 1PDKA 4HAFA 2VUOA 3I75B 4WU7B 1IAOA 3C8KA 4I0KA 1T03L 1U8OB 3LN9A 1Y6MR 3CSGA 3SKNB 2GY5A 5EOCJ 2HFTA 4C83A 2OK0H 5J56B 5M94B 4N0FA 1RJZB 4UILL 3INUH 4G43A 2HTLD 1XCQB 1P84J 4M43L 4PRHD 5E94A 4HS8H 2WUBL 5EPMA 1N5YH 3QHFL 1ACYL 5F9AC 3EBAA 4M6MH 1W0VB 1OTUD 2XNAA 3G6DL 4JO2H 4AH2A 5HHOB 1ZHLB 3ULVH 1WWWX 2JELH 1S9YA 2NY7H 1RK1A 2A1WH 5FYJE 1QSEA 3BVNA 3U7WL 4PIRF 3NFSL 4MJ2A 1PVHA 1L7IH 4LIQE 4JFEB 1QG3A 3U0TB 3U2SB 3X11B 2HA1A 1P6FA 5IUSA 3C60A 5ACLA 2Y72A 4M1DL 4OQTL 2COQA 1EDQA 3QUXB 2C1PA 4D0CA 2QHLA 5CJXC 3KNBA 4J6RH 1QRNB 4HK0A 1TJGL 2J8UF 1CL7H 3REWB 1D9KA 2QQNH 4RNRA 4OF5A 1AD0A 2XZCL 4XP1L 5HY9B 4NBXB 5CMAB 1CT8B 5IP4A 3DI2B 3CFBA 3D0VB 4MNHA 5AZ2L 2VLME 3QPXL 2CUHA 4NC1C 4HD9A 4XC1H 3NIDE 3EYFA 4JG0H 4XCFL 4YO0A 3TCLB 3GRWH 3VXNA 5D5MB 5TDOB 5E99H 3FCTB 3HLAA 4XPBL 4JB9L 2FATL 4UIKL 1YYML 1OB1A 5LBSL 4WW2F 4OLZH 4ONHA 5EZOL 4ODUA 2Y5TA 1ZEAH 2VL4A 1W0WA 1RUKL 1HEZB 2Z31B 1P4IL 1T5XB 3UTSA 1GGTA 3CIQA 4I9WE 2FGWH 1G7JA 3G5ZB 4ODXA 3IRZA 1JBJA 4OZFB 5KSAA 1UZ8A 3O4LB 5ESAB 1KPUB 3BGAA 5SWZA 3MROA 1W2KT 1FFQA 2Q87A 1HSAA 1OGTB 5F6IC 2VXUL 1T5WA 1RUAL 1VFAB 4PLKD 1XR8B 1SYVB 3QQ4A 3VFPA 1KLFA 4QT5B 1PKQB 1BVZA 1ZE3C 2R23A 2P5WE 1XGUB 2YD1A 4E41A 4NRZA 3BPOB 1BQHG 3JWDL 1IEBB 2H3NB 5L2KA 1RIVL 1J10A 1EMTH 4H25B 5T3ZD 4UINH 2CUIA 4HBCH 2FL5B 2E8ZA 3U9PL 4G6JH 2BNQE 2IAMC 1GYAA 3HI1A 1XT5A 5ALCH 5TE4H 4YPGA 5DMKB 4V2CB 4Z95H 2ZWLT 1A6TB 3AY4C 1FCCA 5HVWA 2VQ1B 1FCGA 3QUMB 2EEAA 2VITA 5TE7L 5DT1H 1CBVH 5CS7A 4F7TB 3D39E 3ZE2F 2UZIH 4JFPB 1I7RB 4PLJC 3QQ3A 4IRSC 4E9LA 5EZJB 1Y0LB 4HIHA 1TZGL 2NLJB 4YDVB 3V7MA 4G8GB 1ACZA 1N2RA 2DF3A 5J1SC 1RSFA 5MEOA 4R2GB 3N1GC 3MOAL 3EYVB 3GMOB 2MPAL 2I9TA 5EFIA 5FYJD 2OLDA 3MRQA 4UMGA 1M7IB 5ETUB 1T0NA 3CCHA 3EAKA 4MAYD 1BFOB 4U1LA 4KDVA 4P9MH 4PJFA 2XQBL 1QFWI 3QISA 4FQQB 2IQAA 3K3QA 3L95B 1OPGH 1SEBB 1X5XA 1H15A 5A1AA 2DQGL 3ZDYE 5ITFA 1V7NL 4ODSH 5KVDH 4PRHA 4K3JL 1YY8A 5F7MC 4JPWH 3WKMH 2JF1A 4X0KB 4NO3A 2DWEA 3NCFB 1ZT7A 3BDXA 5A43C 5DHVB 2WP3T 5HVGB 5F88A 5HHMB 2VLMD 3QG7L 4H5SB 1D5IL 3DXAA 4LK4A 1U58B 3GFUA 5EUOB 4NO0A 3WFHA 2A0LC 1QEWB 3T3PE 3A6CH 3HAEH 4E0RA 3FN9A 3LB6D 3OGOE 3I50L 4OI9A 2VL5B 2XG4A 4TNVK 4BSWA 1QPPA 3ZKSD 4OD3L 2ED7A 2A74A 4KU1A 4GUPB 1CVRA 4BFEA 5BJTA 5C0JA 2VDMH 4YQXL 1MRFL 1SHMA 1CICD 3QDAA 4NCDA 4DGIL 5DD1L 3ZSSA 4I9WD 1Y6NR 5EBLA 1AHWB 1L6XA 3B2VL 4KMLB 4M7KL 1FSKB 5E8EB 3BOVA 3ILPA 5I16A 5AAMA 1S9VB 3MBEB 4M7ZB 1XGYL 5DYOB 1RURH 4XPAH 3QJFA 5J1AB 3VGFA 3G6AB 4C57C 3BGFC 1L0XA 2P5WD 4OIAA 4X6DF 1MCQA 5IK3A 2V17L 2V5TA 3BEVA 3ULUE 1DP0A 3OG6B 4CW1B 1OTSD 2BNQD 2VC2L 3LEVH 2XWJA 4D8PB 2FJGB 3QJHB 1FYTE 4JO3L 4KRPD 4EIZC 4M1CD 2GQHA 1WZLA 2VR5A 3FFCE 3QCVH 4R97B 3SPVB 2RB8A 2ZNWA 5JUEH 3KDMA 3L3GB 2BSSA 1VDGA 4KKLD 4LCCC 1JTOA 1K6QL 4B50A 4F9PA 4WI5A 1FFNB 3LMJL 1Z0NA 4TULL 4L1DA 4HJ0D 1IGTB 1R3IL 1F02I 1I8IB 3D39D 1FZJB 2FSEB 3FQUA 5IQ7H 4A6YH 3LSOB 3QDGB 3TYGL 1DLHB 2EXWC 1CDJA 3QFDA 3QUML 4LFHD 3VFGH 1RULL 1EEYB 2XWTA 3VWJB 2DM3A 3BPLB 1J8HE 4TN9A 5DJDB 3HNSH 1W72A 1C08B 1U8HB 5CEZE 4TTDC 2YD2A 5J12C 1IGMH 3VFSB 4HMEA 1MHPH 1A0QL 4YHPA 1WF5A 5GZOC 4BH7B 2PETA 4UT9H 1MWAA 2J1KA 4Q7DA 4K8RL 1MSPA 4ORZC 43CAA 2HFGL 5D1ZB 4DN4H 3BKCL 1H5BB 4PBWD 5FYLH 3WLBA 3BO8B 5K59E 5EIIB 4R0LC 2OZ4A 4JM2C 4X5WA 5I8EB 3ARZA 3CLEH 1YEJL 4OGAC 2A9ML 3ESUF 3SE3C 2B4CL 3ZKND 5F9WC 3ROLB 1GGBL 3SQOL 1BGXL 2UWEE 2DJ4A 3S37L 2YSSB 3QH3A 1BHGA 5EOQH 4AIZA 1T1YA 5CHNB 5GS1A 2NYYD 1BECA 1KGCE 2AJVH 4P2OC 1S7WA 1NAMH 4OGZA 2DLEA 1LP9E 3U1SL 5IGXL 1INDH 2VDKH 4PY8J 3O6ML 3RL2A 4MAYA 1X7QA 3QG6A 4ODWB 3O8XC 1UCTA 4KJYA 5T1MB 2H41A 5DZNA 4I4WB 1VGKA 3HPLA 3VXME 1YPZB 4DQOH 2MHAA 3MRCB 4LRIC 1ULVA 3WFDL 5I1LA 3B2UC 4HKZB 4NJAH 3WHE0 2G2RA 5FAAA 1J05A 3BZFB 3QUZA 1KFAL 1KJ3L 1SY6A 5T5NG 1BQUA 3DYPA 3PF2A 1CGVA 4JKPH 3CU7A 3DPBA 4DFHA 4HPOL 4LSVL 5DJ8A 3MA7B 1RQ5A 3GKZA 1U91B 4ODVL 1Q94A 1MLBB 3JV0A 5TH2B 3EFDL 2A6JA 4PP1D 3NZHL 3MMEB 4NDMB 3V95A 1C16A 4U1JB 1U8LB 5ACZB 4XBPA 5BXFB 12E8L 1ZANL 3P0VL 4M00A 3I85A 5BVPH 3O4OC 3C6SA 2GSIA 4EI5D 1JNHA 2I26N 4ZYKA 1DL7H 3ULUD 1LK3H 3ARED 3H3BC 3CX2A 4ZFFB 1FYTD 4DOHE 2JJUA 2E7LC 3FTGA 4I3SH 3FFCD 2NY6D 2CH8A 5T1DL 1IGJA 3X12B 1CICA 3W2DH 3MJ9A 2ZCKH 4HGWB 3RVWC 1TVBB 3IYLW 4F33A 4Q2ZB 2X4QB 5IVXE 2EIEA 1I3RB 1N6VA 1A3RH 1UKQA 1AGBA 1IZJA 2ITDB 2HN7B 1NMCC 2HFFA 2FBJH 5I9QC 4K7PH 3SE9L 3D9AH 1MVUB 5KSBE 1CGSL 1MCWW 3RWGB 1BAFL 3QXDB 5ICZA 2VH5L 3PIQA 2P5WA 1HHKB 4RRPA 1RZIB 2XPGA 4TSAH 1KJ2B 1XR9A 2UY7A 1ADQL 3OJVC 1IQDA 1YNLH 4NN7C 4PJAB 4OAWB 1J8HD 3WKNA 5CEZD 3BN3B 4PGDA 2R1YB 3VGHA 1QNZL 4F9LA 3IF1B 1BWWA 2MCG1 4PJXF 3DX8A 1YNTA 3L5JA 3BUYB 5I74B 1K3IA 4GKZB 4X6FA 1JRHH 5FYKL 4QHLB 3UTZA 3HZKB 2LTQB 3O2DL 5D70L 1G7IA 4JN2B 3D39A 3JSSA 1XGRB 1D6VL 5DRWA 2M1KA 1J0KA 1UYWL 2F5BL 4ENEC 1A5FL 5DR5H 1KJVB 3L1OH 5D6CA 4S2SB 5KZCD 3GB7B 3MOQA 1ZKAA 2KH2B 5IJKC 1XF4A 5BOZG 4TVPH 2Q20A 4R4NC 1S7QA 4M4RA 4MA1C 2DMKA 1F45A 2GAZB 4NZUL 1XAUA 2F74A 1KGCD 4P4KB 4JVPA 2D31A 2OJEA 1YDPB 2WWMC 4GBXD 5E2WL 2IANB 5E8OA 1RJCA 1A6PA 4S1QH 3HFML 2UYLA 2Q6WB 4ZSOE 2NTSP 3VXMD 2ADJB 2IG2L 4GQ9H 1DJSA 5TQ2L 3ZL4L 3LKRA 1LNUA 1FHGA 2YPVL 4AQ1B 2X1QA 1DLFH 1QLEH 4NM4H 4NM8L 3U4EA 4TSBL 1ZVYA 5DQDH 5LVEA 1ETZB 4OZFG 2F8XC 4X5XB 1S7TA 3S88L 1TQBC 3UDWC 1TJIL 4OJFH 4WU5A 4UT7H 1I8LC 3QSKB 3UJJH 4Y89A 4MXWL 5JR1L 5DWUL 1TETL 3SY0A 4DVBB 2DQJH 1VSCA 1CD1A 4X9FA 4B53A 4RAHA 3TN0C 4KZDH 2Y7QB 5I2IB 1X5JA 4LLWB 1JI1A 1P4LA 1RZKH 3S98A 4MAUH 1CFVH 5EA0H 1NGQH 1DEEA 3LAFA 1CWVA 1T22A 3PL6B 5FA4B 3K74B 1FP5A 3HUJF 3WNLA 5D2NB 1BD2E 5EU3A 5J06A 4N8VB 3CFKB 4HIXH 1SBBA 4JFFE 3MZGB 4KKCC 2O5ZH 3TESA 3R1GL 3T8XA 2YMXL 2Q8BH 2XZZA 3MLYL 1HNFA 4XCEA 5IW3A 4ZUWB 4KJQC 1NFDB 2GJ6B 4CN1A 1YNKL 3VFUB 1Q9LB 2FJFB 3GMNA 3NFPB 4OCRL 2ICWB 5C7XL 3PNWA 1NGZA 4X6CB 4OM1H 3NIGE 3OJMB 4RMWA 4KI5C 4XZUB 1FNEB 3PQYE 1VB9A 3VFVA 2XV6B 5ISZB 4EI5A 1JE6A 1DUZB 2HMID 3THMH 1S3KL 1JHTA 3DUUA 5DJZB 5CBEB 2R56L 3AREA 3B5HA 4ZFOB 1IEHA 1NGXA 1FYTA 4HIEA 1CE1H 2VWEC 2V9QA 2ATKB 2X9WA 4YHYC 3FFCA 3FOLA 3HAEG 3WN5A 5TDNA 1LEIA 4RIRB 43C9B 3V5HA 5I1IL 1KJ2L 4LVOC 2DBJA 4PJDE 1HIML 3L6FA 4HLZH 3RJDA 3WFEL 4JJ5A 1FLTX 2OTUA 3TEUA 4G3YH 1AE6H 3IS1X 4X7DC 3Q1SL 4NQUA 5LCVH 4X7TA 2EE2A 3LHPH 5BS0B 4EXKA 4DVRH 1G84A 2PTTB 3RY6A 1YEFH 4XPFH 5DI8B 4A2LA 1BZQK 4L5FL 2BVTA 3UX9B 5DQ9B 3NCJH 3CFEA 5DJYB 4K71B 4OKDA 3OKDB 5T3XE 2A6IB 1ZLSH 4Z76A 1NGYB 3RPIB 3WXWH 5JHLH 2P49B 4ALAH 3O6KH 4QXUL 4PG9A 2FR4A 3DLQR 3A6OA 4F2MB 3VXOB 3GJEB 2BOBA 3MRLA 1K8IB 4CL7A 2DLFH 1CDBA 3O3EB 3N50A 4DKEH 2EC9U 3PDOA 3H7LA 1EVUA 3QUXC 1AQKL 4HX1B 3NH7H 4U6VL 3J7HA 4CNIA 2RGSA 1F58H 4R26H 4XPTH 3PABA 1F2XK 2J7LA 4L4JA 5FO7B 5JW5B 3QZWB 2UWEA 3RA7H 5HHXH 2CO6B 2EICA 5GJSH 4C4KT 2XQYG 2WZPD 3MUGB 4IJ3B 3QI9B 4PRNB 3KPNA 4PJIE 1GGCH 1QFWH 5ID1B 4RFEA 1LP9A 3EUUA 1A1NB 1B90A 4GQPH 4L8SB 4LSTL 1Y6KR 1JIBA 4GBXA 1JWMA 3W9EB 3T1FA 4OGXL 4OFVA 4TRPH 3DIFA 2AXFA 2ZCHL 2Y07L 1R0AL 3KPLA 3RWJB 1JWUA 3VXMA 5IIEA 3WFBL 5IKCA 3S3JA 1ZT4A 2YA1A 2WUCL 3V4UL 5CINH 5I30H 2XRAH 5F96L 2DTSA 4ZXBD 3T2NL 3FB5A 3EJJX 1BD2D 2L7UA 3AFLA 4PJ9B 5JQ6L 3PWUB 1CS6A 3GSXB 5C92A 2Z31C 5IHZB 3KLHD 1QACA 4BZ1H 3SDXE 3VWKB 5LKNA 4JFFD 1HYSC 2H9GB 3UTOA 3ZT7A 1X44A 4JY5H 5E0QA 3TBYB 3WEXB 3BZ4A 4P4RA 2N56A 1UXSB 1GXEA 4O2FA 2ESVE 3STZB 4OZHF 2WM0A 4U6HA 1ORSB 1DZBA 1CQKA 4PJ7F 1X4YA 4NQSA 2WWKO 1YUHB 1MEXH 3MCLL 3PQYD 5SWSE 1JGUL 4JPKH 2EYTA 5ANMB 1BWMA 2MQ0A 3BPOC 3N0PB 4CVXA 5DSCA 1BOGA 3BXNB 3NGBB 5DHXB 3IJSA 3EOYG 3FZUC 3BJLA 1X5IA 4PG2C 5CD3B 3QRFM 4MXVE 2BRRH 3G08B 2H6PA 5IVXA 1G9EA 3ARDA 1TCRA 3IFLL 3NCYP 4RWYL 3MV7B 5I0ZA 3P3YA 2W1NA 1QQDB 3DUHA 3JTSB 1RZ7H 2KQNA 3F6IA 5FOJA 5KSBA 1WEJL 3UYOD 5AYUL 3KJ4B 1JPTL 2OMNA 5F7LB 3FQTA 2ITCA 1RJYA 3ZHLA 4QHNA 4X4YB 2AJUH 3SGJA 4PY7B 3MXVH 5T3XD 5DLMH 3VXPA 4R2GC 3FOMB 2AJ3A 2IH1A 4K8RC 1DUYA 4L3CB 4X9IA 3AUVA 1XZ0A 1C12A 1U6AL 2XY2A 1RIUL 3IJYA 4KGLA 4W68A 1WICA 3I6LE 4ETQB 2FO4A 4OTXL 1S8DA 1RFDL 2AV7A 1QTYT 2BSTA 1OAKH 3VXRE 1FFPB 3BKML 4OLXH 5L88H 2KUTA 1DVFB 3GSNA 1DQDL 3IDGB 4OLWH 5FB8B 3CVHH 3TJHD 4ZUSA 3GUTA 4X98A 5JIIA 3BEWB 5IR1A 5DVNA 3KYOB 1RUPH 4Q9QH 1MFCL 4AEFA 4JDTH 4CMMB 3VE0B 5B38A 2E6QA 5ILTH 1ZVHA 5MERA 4Y19B 1KF9B 4Y16D 5HVHB 3VFWB 2ILLA 1G1YA 3T2OA 2C3VA 1H3WM 2P47B 3EGSA 4ZSOA 3GBNH 2PYFA 1I9IH 4LNRA 2NX5E 4JFQA 2GIYA 1FZMB 3QAZB 1SVZA 5HGHA 1NCAH 3RVUC 1Y18A 3MRMB 3DMMB 3OF6D 4NZJA 1MRCH 3GM0A 1OSPL 3BRDA 1I7TA 5HGBA 5J6HA 1VGEL 4ZD3H 2AEQL 4LSSH 4KK6C 4OV5B 3SDDB 2ZSWA 1VFBB 2F19L 1AHWC 3L5WB 1JP5A 5GRVL 1JNJA 1A7BA 2XZAL 3BJ91 1H3GA 2ESVD 1AXSA 1FSKC 1KB9K 3GSRB 4P2RE 4JHAL 4WUKH 3GM8A 5H35A 4LPVA 1K2DA 3MBEC 4M7ZC 2R4RL 1KTLA 5EDXA 5SWSD 3WSQH 3KXFB 3ARUA 3EO1B 3HR5A 1CLZL 1IC4H 2ED9A 1FYHB 3F7YA 3ARTA 2XFXB 3LDBB 5FUOL 2CLRA 4A2MA 4QRUB 4FFZH 4Z7UE 4ZXBA 1MFDH 1BD2A 1U95A 4NQCE 4YWGH 3MOBL 4MCYB 2R1WA 4G8EA 1I1AD 3N85H 1U8KA 3B9KD 3MBXL 4R97C 3RWDA 3WJJC 4JFFA 1CFSA 5D7SL 3BPNB 5GJTL 2OR9H 35C8H 1CDHA 4BSJA 1U8MB 1IE5A 2W91A 3PWVA 3NBNA 5CD5C 4Y1AE 2PF6A 1JZ6A 4PREB 4WUUE 5F7EL 5AUMB 3UJIL 4IRJB 5DD3H 1MUJB 3PQYA 2D7NA 4K94H 1KCSL 4HUXA 2EE3A 3CZFB 4LLQA 5FO8B 1OAYH 2BFVH 2XWBA 4OZ4B 5CILH 2X1OA 4LPTA 3VWJC 3QDJB 2EE6A 3BPLC 2E9BA 2DBLL 4K2UL 5EB9A 2VXSH 1CDIA 4JRXB 1IGIH 4MJ6A 1HHIA 3AS3A 2AABH 4PJDA 3BHBB 3VXTA 1F4WH 4WFGE 3HNTL 2H32A 3ZHKA 1JK8A 5DURB 1AGEB 3EZJB 4OCNC 4Z7VB 1R3JB 2DKMA 3OPZL 2Q3ZA 2A83A 1T2JA 2VZSA 3I6LD 5ENWB 3KG5A 4M6OL 4MLSA 3X3FH 3E8UH 4FQJH 3MLRH 4IS6B 5JHDE 4G7YL 4XNXL 4JY4B 1H3UA 1HXMB 4NYLB 1PGRB 3ARVA 4JJHA 2GJZA 1LE5A 1EGJA 2OQJB 1H5BC 4R4BB 4QOKB 3VXRD 3FO1A 2IH3A 4ZUVB 1A7NL 2QQLH 2X89D 5IESH 1SMOA 3MXWL 1MY7A 3N9GH 5DD5H 5EH1A 4PJHE 3QDHA 4WI8A 1OM3L 2V9RA 1K3ZA 1RU9L 2JCCB 4WW1A 4C58B 1YN6A 3F8UB 3GSUA 1NCWH 1KENL 4XCYB 4MZ2A 1MWAH 3RDTD 3IT8D 1A2YB 1JF1B 2GCYA 1WT5A 1FPTL 2BVUA 4AM0B 2FWOA 2EE9A 2EZ0D 1ED3A 3OX8A 5I1EH 3L9RA 4HGMA 5FIEA 3D69B 2NX5D 4QWWC 2JIXD 2J6EH 1K8DA 2B2XL 4I18B 5DZLA 4N8VG 2P8MB 3WS6C 2ZCLL 1A7QH 4HLZG 4Z18A 2BVPB 3S96B 1ZT1B 1A6UH 2IBGA 2VXVH 5FYJH 4S10A 3G5YB 1F4YL 1VFUA 2YEZA 1B6UA 4LIQH 4IIQB 1JN6A 3V4VL 1KOAA 4S11A 1X3DA 4PJIA 2EEBA 5GS0C 4LU5L 5JZ7C 2FLBT 4P2RD 3EJYC 4NUJB 4Z5RB 3NMEA 2EC8A 4JFDB 4WI4A 4P99A 1HKLL 2DTMH 3NN8B 2Z92B 3SBWA 4Y16A 1L4IA 5DJ6B 5IROC 3VFNA 1MFEL 1Q0YL 2EH8L 5IOPB 2HLAA 3HMWL 4NJ9H 1KYOJ 2HT2D 5HYFA 1EAPA 4LLVB 3RZCC 5TGBB 5C0FB 4FNLL 4P5MB 4UIMB 5DJAA 4X80L 1PBYA 1NGPL 4JHBA 4PRPB 1J88A 2P8PA 3BGMB 2YRZA 2XYCA 4ZO8A 5BW7C 5JA8B 2ZUVA 3QIBD 1J8KA 1QBBA 1JF5A 3MCKA 3Q6FA 4KKNA 4KKAC 5BRZB 3FB7B 4OZGF 4D9LL 4HBQA 4FHBD 2VXTL 4Y1AD 5GGVL 4HIIB 3CDGB 3HC4L 5JO5B 4QHUB 4N5ED 4BZ2L 4WUUD 2FX7L 4TOYH 2PO6D 2FH6A 4UT6L 5D7LA 2GY7B 3IDNB 4PJCF 4R3SB 2DB8A 3V5DA 5KVFH 4I2XB 1JFQL 4D0BA 3P11H 1ZSDA 5SWSA 4GRMA 2GK0A 4WDIA 1M71A 2VDNH 2DM4A 3L3OB 1NCBH 3UBXI 3BX7C 4JQXC 5IT2H 4ZS7H 2EECA 2NTFB 3RWCB 1ZLVH 4YFEA 5JXED 3QO0B 3ZKQD 4AIXA 2W0FA 3EYSL 5SX4I 3WS3B 5J0BA 1CFNA 1I1AA 4I8DA 3B9KA 4WFGD 2ATPB 3CH1A 1I85A 3QDME 1AJ7H 4YXHH 5E5MB 4X8XA 1MIEH 4EBQH 1QFWM 1WIPA 3O9WD 4NT6B 2AXGB 3MACH 4HC1L 4R7NB 2ZOLB 5I74C 4W4OC 3FO0L 1I7ZB 2JLLA 5FA3B 2YRLA 3O0RH 4LCWD 1WVZA 2LTQC 3H2WA 5T1KB 4I3RL 2D03L 1MF2H 2H1PL 4OI8A 3MODL 1PQZA 3DVGB 1TVHA 1WUNT 5CSZB 2J2ZA 1DR9A 3HZVA 4RDQF 4BKLB 3UAJD 5I76B 1EUTA 4QF1A 1BLNA 1ZLUH 4H8WL 4FQ2L 5CZVH 5ADOH 1YN7A 2FIKB 1P1ZA 1CK0H 4PB9L 5CJOL 1M7XA 1RHHB 3AU1B 1IC5H 3BN9D 3Q5OA 3WD5L 2QKIB 4GT7A 3UPRA 1T20B 3LPWA 1IILE 1BBDH 3INUL 3AXLB 1IL1A 1MCOH 3U0PA 1U3HD 4NQXA 2K7QA 4P9HH 1N5YL 3TBWA 2PW1B 3VFRA 2BVQB 1JGLH 2PKDA 5KANI 3VXRA 5HGAA 1X5KA 1JVKA 4IHOB 5LGJA 3ARFC 3ORJA 2X89A 3ZE0E 3ULVL 4WW2B 3TIEA 3HCVA 2JELL 2LVCA 2NY7L 4FQHA 4JGMA 2A1WL 4YHNB 2Q76A 3RGVB 1L7IL 2AS5M 3K7UA 1T66D 4XRCA 3RDTA 2CKBB 3C08L 2JJTC 1SMAA 4DKDC 3RGHA 1WFNA 3MLZH 3QYCA 4NKOB 3O3AA 2PYEB 3DJ9A 2LABA 3ALWA 3OGCA 4I0PD 1U3YA 4OCSH 5INCA 4OLVH 4J6RL 2HKFH 4G8FB 1KTDA 3U4BH 2QQNL 2V5MA 3ZE1E 2NX5A 4X6EB 2D7OA 2JIXA 4TUOB 3BP7A 1U36A 4Y2DC 1LO3H 2W60A 1KLGB 1QVOA 3STBA 3CFJB 5DJXA 4M48H 3FFDB 1MFAH 3TT1H 5IMOA 3HC3H 2ZOKB 2C4XA 1IAKA 1UB6A 2A77L 5KS9A 5HYSB 5I18H 2VDPH 1NCNA 2IMMA 3C6LD 4RZCB 4JG0L 3QO1B 1LDPL 3ZYOA 3T65A 1IKNA 3W81A 3MRIB 1IVLA 4X4ME 4WEBL 3LEYH 4P2RA 4JN1H 5ESQA 3KYMA 4KK5C 5HI3C 3SDCC 5SWQA 5E99L 4L4TE 2AJSH 2F54B 3PHOA 3O6FB 5F1OB 2B39A 1VEPA 2P42B 3LEXB 3EYQC 5ID0B 4M03A 2VSDA 4JM2F 4K23H 5IW6A 3MRGA 5J3HC 4FXKB 4HUNB 2XN9B 4N9GA 3TH2T 2Z93A 1MCCA 2YA2A 4Z7UA 4NQCA 5GRWA 4DJMA 2OMBA 4MDJB 3MGTB 4LLYB 3ESVF 5I1JH 5J13B 3QIBA 3QDMD 5F8QC 4G80B 4O51A 5FGCE 4ELMF 1TIUA 5E2VL 3JVGC 4WEUD 4XP4H 1LP9F 4YXLH 4X7SH 4LKXA 4Y1AA 5DJ2B 1IM3A 5HPOA 1YQVL 5GISH 3W39A 4PV8A 4WUUA 3OAUH 2XIDA 2PO6A 3D18B 3ULUH 1YJDC 3QEHB 2BVOA 1T3FB 3FB8B 1OP5H 1T83C 1FL5B 4G6JL 2BRQA 4WVRA 4UU9B 4DAGH 4Z8FL 1U42A 5ALCL 3LKNB 1NFIB 5JXEA 4RFNB 3GO1L 1WFUA 4K71C 3RWIB 4Z95L 5LXGL 4O9HH 4XMLH 1IAII 2F15A 2H2PD 3HE6A 2CRYA 1ZGLA 4G8IA 5DVMA 3VDBA 5IMMA 1CBVL 2H8PB 5HYIA 5JORA 1NDMB 4I0CC 5IEHA 1JNNH 1UWEH 3CLFL 1G9NL 2X4TA 4WTXA 1GZQB 1KG0B 2IAMD 2VLJB 4YH6A 5JHDA 2V2XA 2CLZA 4KXZI 4XH2B 4XVSL 2HJKA 4C54A 1ND0B 4LLUB 4CVZB 3QNXB 1MHCA 3F5WB 2OL3B 1DBMH 3MRNA 1B9ZA 1WFTA 4PJHA 3FRPG 4XGZB 4J3SA 4HEME 1QLRA 4KTYA 5F1KC 2UVFA 3BQUB 2DI7A 3GI8H 5DS8B 4PLJD 4IJ3C 3QI9C 1N3NB 1X5LA 4P9ML 4LHUD 4F37F 2AAVA 4P46A 3STLA 5HI4D 5C0RH 4WNQB 1OPGL 2IBZX 5EC2A 4LEOB 4Z0BH 3VRJB 4L8SC 3RBSA 1I1YA 4AEEA 4ZAKB 4HKXB 4O5LH 1YY9D 3WDJA 5DMIH 2HJFB 3BWAB 4HPYH 5HDBE 3S4SA 2DYPD 2IPKA 2CKBL 2IGFH 1U3HA 4ODSL 3VGBA 3MRDA 4JPWL 4DUVA 1NBQA 2ADFH 4H1LH 3UTPE 4NRXA 5K9OA 4X6DB 4FQLH 3GKWH 5E6IB 2EDEA 1P7KA 5FO9B 3RNKA 2W38A 3L5IA 1OF2B 2VN4A 3FQXA 3IDXL 2PN5A 4PJ9C 1OARH 1DQJB 3ARQA 4OQ1A 3VWKC 1L7TL 2YUWA 2Q7YB 2X1PA 3SKMA 2OXGA 2ZPKL 4WFFE 1YA5A 4PS4L 3EFFB 4EUPA 4I0PA 4L4TD 4ZOBA 3VXUB 5KSUA 1TXKA 2ZG3A 3C9NA 3FRUA 1G7HB 2ZZUT 1I8MB 3JWOH 2IMNA 4NWTH 4LCUB 2O5XL 2VDML 3QXTA 3RTQB 5C0DB 2VLKB 5EORH 1N6QL 1QSZA 3K80A 1IT9H 2A0LD 4I3GA 3HE7C 1H8NA 2AQ2A 1ZHNA 3NGBC 1KPVB 4JHWH 4CVUA 2BOCA 4ZUUA 5D8JH 2HWZL 5D1XC 4XNMA 3BP5B 4HQQH 1BVLA 5FHAH 1X4XA 4ZUTB 3C6LA 1RURL 3WIHL 3V0VB 4GAFB 3H3PH 4HULB 1A3LH 5F9JA 5CEYB 2X4UA 4MXQD 4YE4H 2JK5B 2R2BB 2AK4B 4KMTH 5DK2A 3IJHB 4LQFH 3V2AR 1G0XA 5F7UA 4PP2B 4QNPF 4QXTA 3FB6B 4G6FD 1SJHA 2D0HA 4GKNB 4JAMA 3M1BB 3ZKMC 1TITA 4HXBH 3EYUL 1QP1A 5DD6A 1H0DB 3KYNA 2FX9L 4GJTB 4BM7A 4EN3B 2EDLA 1BFVH 3GJFK 4YNYB 1NC4B 1N59A 3QDMA 5IEKB 5HXMA 4D9RE 2H45A 2BJMH 1S5HB 2FX8L 5CFHA 2QQKH 4NQDE 3DV4B 5IQ7L 4OBSA 2YZ8A 4PR5A 3WUWA 2GITB 3AAZB 1WAAF 2F8OA 4A6YL 3SO3B 1OSZA 3LCYA 4WI7A 2IADA 2E7CA 1UH3A 4XBGB 3MLUH 2HFEA 5I1DA 1Z6JT 1FN4A 4HKBA 5D7IE 2YN5A 1A14H 3MV8B 5EO1B 5FOBA 3TBTB 3GBMH 4PTTB 1LE9A 1A02N 1DVFC 3VG0L 4BFGA 1IGML 3GK8H 2FHBA 3V5KA 5HHQA 3DVNB 1MHPL 4FN0A 1HI6B 5DUBB 2NY3B 3EIFA 5IHUL 1MCPH 2OL3L 4UT9L 1U8NB 4PGZA 3OJDA 4MA3B 2EXWD 2I07B 3ARPA 4UNTA 2WIIA 4KRNA 4APQB 4DN4L 4QRSB 1CYGA 4P5KA 5FYLL 1G6RB 4J23A 2BX5A 3GSNH 4XHJC 3REVB 5HVHC 2IAMA 3VFTB 1SJEA 4TTDD 4MX7B 3CLEL 1U93A 1XH3B 3IFPA 1X5AA 3UTPD 3QAZC 3VCLB 4LCIH 3E6FB 1R5VA 4P5TB 4QRTA 5EOQL 4Z6AT 3DMMC 5MEQB 1S9KC 2J3SA 5IHLB 3OB0K 4LHJB 1KCRL 4RRPG 3MLXL 4P48A 1MPAH 3KPMA 2JJSC 1FO0B 1BOYA 4HW6A 3MLWH 3SDDC 2JB6B 4K9EL 3OKNB 5D2LE 4WFFD 1JPFA 2Y23A 1CXIA 3IU3A 1XIWB 4KVNL 3BRFA 4LHUA 4JZJA 4GFTB 4JFOB 4DQOL 4S1RH 5HYQA 2VR9A 4F15B 3K2UL 4HH9B 2DYPA 4XNUH 5FM5O 1U2HA 4ODHL 1G7LB 4P2OD 3LDBC 3WLWD 3MYJA 4I77L 4PJGF 3FAWA 4HS3A 3V52H 2OR8A 4S1DC 4I5BA 3NOIA 3WL9A 1S78D 4LP5A 5E9DE 3B2UD 1PAMA 3QQ9C 1T04B 3VI4E 1S7UB 4JFYA 4X4MA 5D6DC 4EDWL 5BVPL 3M8OH 1FFOB 1KXVC 4L4TA 2FB4L 3FHQA 2FYYB 4PB0L 2IFGA 4JFZL 1A6AA 4I3SL 1F13A 4MNGE 4XCNA 2K7PA 1MAMH 3W2DL 1FZOB 4D3CL 1NCCH 1I4FA 1HHHB 3CFDA 1OAQL 1A3RL 4D9RD 2FBJL 2GJJA 4NQDD 3DBXA 1YC7A 4XVUD 4GG6E 4ELKB 3TNMA 4AG4H 3L3IA 4RMVA 4L9LB 5FECB 4TSAL 4HHAA 3TNNA 2HP4A 3OQ3B 1IGFH 4YIQB 3V6FB 3GMLA 3F7VB 1L9MA 5GIRB 4H8WC 5SX4H 5KSVA 2CMRH 4RISH 3RWFB 4J8RA 3SDAB 1JPSH 3UCRA 4KAQH 2QSCH 1FNLA 4QGYA 2H32H 4QHMB 1ZV5A 2X41A 1JYVA 3IFNH 1MI5B 5EBWA 2R0ZH 4KI5E 2AXJA 2Z4QB 3CC5B 3GZKA 5GRJH 1UADC 2QV2A 3VD4A 2MNUA 1EGJH 2X10A 1OAXH 3GSQB 4QY8A 5IWLC 4YDJA 6CGTA 3LKOA 1W0YT 4G42A 3P73A 4CDHA 3GSWA 4WJ5A 1CD0A 1B2WL 4XVJH 1WIOA 5DJ0B 4I18C 4RCAA 4LGRB 1KLUA 1G6RL 3BPCB 4N68A 4FABH 1BREA 1A9BA 5E94B 4IOFD 4S1SH 3HUJB 2DIJA 2PR4H 4X9BA 1UVQB 2YK1H 1TZHB 4LLDA 4ENED 1FDLH 1WBZA 4YBQD 1S9YB 4PTUB 3K46A 5JXAL 4NFBA 4DW2L 5FKAA 4GAJH 4JPVH 3LN5A 1FFRA 5EU6E 1F6LL 5FUZH 4JR9H 4NBYB 4Z7WE 1NGWA 1DLFL 1BQHA 1GZPA 5HHOE 2PCPA 2C1PB 5I8OH 3KNBB 4U1SA 4HK0B 1TJHL 1UA6L 3BH8A 3RX5A 3K8LA 1AD0B 4GRWB 4NKIH 4JFEE 4OJFL 4UT7L 1FG2A 3U46B 3TFKD 5E9DD 3RWHA 2VABB 4R0LA 5DMJB 1QRNE 5D93B 4DN3L 1UACL 2DWDA 1RZKL 4CDGC 3PHQA 4LCYA 4KPHH 2AXHA 1MLCA 3RX7A 3QWOB 1AQDB 5I66A 2F5AL 1D5BA 1K5NA 2AGJL 5LGHL 4YGVB 2YBRA 3V0AC 4WGWB 1QRKA 4G9DB 4FFWD 2Q7NA 3O3DB 1A6VL 4P2OA 1ITBB 1F4XH 1YYLH 1MIMH 1AGFB 5I75B 4MYWB 4HIXL 2NW3A 4DUWA 4E42A 2O5ZL 2Y5TB 2V5SA 1EHNA 4ORGB 3UTSB 3T2PA 3EDJA 1NCDH 5D5ME 2GK2A 1G7JB 3X14A 4ONGH 4ODXB 5MI0B 4H1LG 5JMRA 4YC2B 5EUOF 2QADB 3KVQA 1AIFB 4GW1B 1B0GA 3MREB 4GMTH 3MROB 3ARSA 2K9UA 1QPXA 2GI7A 4YHML 3OXRA 3RNQA 1HSAB 3T04D 3THML 4FQIH 4KKCD 3Q5TA 4XI5D 4IMLB 3VFPB 3MJ8A 3H42L 3TM6A 5CEXA 3E0GA 3QT2A 4R8WL 1Q1JH 2R1XA 4JEGB 4CKVX 4MWFB 5E6YA 1T80A 1NC2B 3O4LE 2BNRB 5L2KB 3C09B 4N0CC 5CJQH 2NNAB 3KLDA 5KS9F 4L8BA 2DLHA 3P4MB 4KI5D 4MB3A 4CBPA 1G9NC 1T4KA 5FUCC 4G3YL 1AE6L 5TFSH 1PKQE 4JLRA 5CIPB 1FGVL 1NDGB 2DQEH 4KI1A 2BSRA 5FGBC 1IRAY 4NQDA 4JCMA 1Z3GH 4XPFL 2R0WH 1E6JH 1KBGH 5FFLA 2HVKA 3SGDI 3NCJL 4Y2OA 3TPUA 1NAKH 5D7IA 2VLLA 1IAIH 3EZ8A 1EXUB 1RPQA 3WXVH 3HMXH 3GMRB 3IDJB 1ZLSL 3WXWL 5BQ7A 5JHLL 4DFIA 3T4YA 4ALAL 1T7XA 4WW2C 3TH3T 3ILQD 3OJ2C 4HUVB 1D5ZB 4MD0A 1V05A 3A67L 3H8NA 2CIIA 3BP4A 4WTZA 3RGVC 1QSFB 1AY1H 3IDIB 1F6AA 3H9HB 5J9PA 2I9TB 2DLFL 2HVJA 3ZDZE 4YK4B 4KXZH 3W9DA 4NQVA 2PXYB 5EU6D 3BIAX 4U1LB 3BKJL 1OQOA 5MP6L 1NMAL 1F58L 4R26L 4XPTL 5HHOD 4G9FB 3T4AB 1INQA 4JQIL 3WO3B 1WZ1H 5GJSL 1EFXB 3P9LB 4JFED 5ITFB 3DO3A 4PRIB 4FOMA 1GGCL 4EJ1C 5CJ5A 2Q1EA 4LEXL 4NCC2 2MKWA 3QUXD 5D2LA 4HUKB 1QRND 3MLVH 1DN0B 1D5MA 3F62A 4TRPL 5FM5M 3DXAB 5EN2A 3VGGA 4UTAH 3S6CA 1RZGB 4F37K 4NO0B 3WFHB 3GMMB 4MSWA 1KXTB 5CINL 1KPRA 3O6FC 5DRXA 2EDWA 4YZFF 5I30L 2XRAL 5T5FL 4GG8B 5EWIH 3ZDXE 1PLGH 1B0RA 4BZ1L 1OT1A 4UTBH 3B9EA 5E08L 4JFXB 4JY5L 4XXCC 4BK4A 1U8JA 4PGBB 5BJTB 4EEEA 5C0JB 3KPPB 1LD9A 4N90E 3IETB 3L3KA 5J13C 1QR4A 5EBLB 5E9DA 2D7TH 3D5OF 2YD5A 4PGEA 4JPKL 1N0XL 5B38G 5I16B 2Z31D 3OKEA 3QA3A 1BIIB 1FRGH 5F3HB 4IMKC 5M95B 1UXWB 2J88L 2B5IC 2X7LA 3CMGA 2FBOJ 4MNGA 5IK3B 3EOTL 3HC0A 3O4LD 3L3DA 2WINB 4QTIL 2NXYB 4RFNC 2XWJB 2BRRL 4HMCA 3ZT5A 5C3LD 3R8BB 3I3EA 1J0YA 2EDQA 4J2XA 4U1IB 2BSSB 4HZLB 3V0WH 5JOFA 3PWNA 4GAGH 2LU3A 3GMQB 4UOW1 1RUQH 1SJXA 3HRZB 2KDGA 4JO1L 2AJUL 3OAZK 1CQYA 1X5GA 3QPQD 3PXHA 1HH9B 3IB4A 4XXDA 1MHEB 1IFHH 3MO1A 1I3VA 3QFDB 3UC0H 32C2A 1RMFH 1VACB 5DRZA 2MOVA 1MQKH 4XTRC 3GNMH 3BQUC 2YN3A 5F93C 1W72B 4PD4K 2W9LA 2Z35A 3S36L 4JKLA 1HQ4A 3QDGE 4HFWA 5JPMA 3P9WB 4HUWA 1YMHB 3MJ7B 5I19H 2E9JA 2I9LA 4RMQA 3X13A 2AV1A 3GSVB 4ZAKC 4OLXL 2GTZB 5L88L 3FMGH 2O5YH 4R2GD 5HJ3A 4FQXC 2AJXH 1AFVH 1BZ7B 2EH7L 5E1AA 3UZEA 4ZDHA 3P77B 4GOSA 4U2ZA 4KV5E 4MQXC 4XVTL 4K9EC 1ZAGA 1NUFA 1MCWM 2ZUUA 4WU7A 4X5WB 1RUPL 1U8OA 3UBXG 3SKNA 1QHOA 3GJFB 5BV7B 4N9OB 4OFIA 1P69B 2G5BB 4O02H 1UKSA 3QH3B 1MJUL 4UBDC 4AIZB 3HTLX 4UV7H 1B4JH 1RJZA 5GS1B 2DIAA 2DL9A 5GGVY 4FFVC 1XCQA 1I9IL 1J5OH 3EOBB 4NWUL 3RL2B 5EU6A 5I0DA 4CN6A 1MRCL 4Z7WA 4M1GH 5HHOA 1ZHLA 3HPLB 2BMKB 5FF6A 2MHAB 4UQ3A 3PWPB 2OP4H 3RTQC 2BVYA 4YDIH 5ERWA 3BD5A 5CBAB 3GRWA 1M7DB 2G2RB 1J05B 2VMFA 1P9MC 4UDUA 1WISA 2N7BA 4JFEA 4RGNB 3QUZB 3U0TA 3U2SA 4OSUL 1B4RA 4N90D 5E7BA 4OLYH 2D2OA 4EUPH 3VMPA 5CZXC 1R5IA 3EKCA 1LO4H 3QUXA 4WUKL 1KEMH 3RVUD 1YPZE 1A8JH 4LBEB 1CFTB 1QRNA 4WRLA 1X5HA 4X4XB 2R39A 1Q94B 3REWA 3WSQL 1I3GH 5FCUH 3R06A 2Q8AH 2A6JB 4KJPD 4QXGL 1IC4L 5FDWA 4KK6D 4OV6F 4PBXA 1CLOH 5HY9A 4MB4A 2ADIB 5L2JB 1CT8A 4FQCL 2EO1A 5I73B 4FFZL 4YX2L 3X17A 5M7QA 1MFDL 4S0TD 3D0VA 2ZUTA 1N4XH 4FTVB 2FNBA 1EO5A 4ZYKB 1ZXQA 4JG1H 3N85L 3FL7A 3MBED 5I1CL 2OR9L 1OWWA 1E4WH 3CXHK 5ECJE 1HDMB 5I1KL 1GGUA 2VXQH 3FTGB 3WJLA 2YPKA 2VO5A 1GGIH 3LV3B 1IGJB 4EN3C 1ZHKB 4PRDB 1CD8A 3FCTA 1RAMA 5DDHB 3I84A 1HILA 1S9XB 2SEBB 5I8CB 5DJCB 2W0PA 5F1NB 4GSDH 1AGBB 2Z31A 1FAIH 3SO3C 3DX6B 3QXAB 4DGYH 3IRPX 5ICZB 5CD5D 3PIQB 1ZVSA 4OZFA 1KB5H 5IMLA 3O4LA 1KPUA 1P4BH 1Q0XH 2YZ1A 1IQDB 2AABL 5KOMC 1F4WL 1CF8H 1OGTA 2V5RA 2D7QA 2CGRL 4PY8I 5GRXG 4JM4H 1VFAA 4HWBA 1XR8A 1SYVA 4KRPB 4HCRA 4ESKA 3QDGD 1QLFB 3ARBD 3X3FL 3E8UL 4FQJL 1XGUA 3MLRL 1FNSL 3LS4L 1MOEA 5T3ZL 2H3NA 4APQC 1C5BH 4TVPE 4H25A 3DX8B 3VWJD 5BO1H 2FL5A 3KR3H 4PJAE 5GRYA 1W72L 2DQDH 3R8QA 2QQLL 3UPCA 5IESL 2WANA 3N9GL 1OTTD 1G7IB 3NPZB 5HHVH 1HOCB 4IRSB 5DMKA 5DRWB 1NCWL 4P5TC 1A6TA 4HJJL 4Y4HD 3IDMA 1YEKL 1DANT 1WWAX 3QWQB 4FQ1H 1XF4B 3B83A 5D1ZD 1E27B 4F7TA 2OZ4L 2WIMA 5E8PA 3WE6B 1T21B 4JFPA 5IBLC 5B3JF 5I1EL 1XIWC 4OZGB 1Y0LA 2QL1A 1ZLWK 3EO0B 5AD0B 4YDVA 4JRYB 1C5DB 3G6JE 3DVFA 5E8OB 3QXUA 4PJCB 4F15C 3QULB 2UYLB 1A6UL 5D71H 2VXVL 3O2VH 5FYJL 3GMOA 4YAQB 3LKSA 4LIQL 3CX5K 1LNUB 1JZ3A 3HAEA 5ETUA 2IANE 3U4EB 1BFOA 3QIUB 1FGNH 4X6BB 5J4MA 3Q5YA 4QWWD 1RZJL 4FQQA 1F8TL 2I60H 3L95A 1SEBA 1SEQH 2DTML 1KELH 5AYQA 1N7MH 2YKLL 4WU5B 3B6SB 3LN4A 2IF7A 1SY6L 3QQNA 1WTLA 2X1WL 5INDA 3L7FA 4OLUH 5KW9H 1JTPA 3ARXA 1UM5L 4OBRA 4YXKL 1J86A 2KZWA 5GS0D 1P4LB 2R29H 5DHVA 3EJYD 5E8NB 4XP5L 1DEEB 4H5SA 3SJVB 1UC6A 2HT4C 4F80A 4FA8A 2HTKD 3V4PH 1VPOH 3NA9H 3BD3A 3O2WL 3NFNB 3TO4C 1QEWA 5EU3B 3W5MA 2J8HA 3I6KA 3TA3C 3DECA 4JO4H 4XNZB 5JLZB 2V5YA