2ADJB

Crystal structure of monoclonal anti-cd4 antibody q425 in complex with calcium
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
214
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWVRQTPDKGLEWVATISSGGSYTYYPDNVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARHEDGNWNYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Q425 Fab Light chain
publication title Interfacial metal and antibody recognition.
pubmed doi rcsb
total genus 40
structure length 214
sequence length 220
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adjB01
4OAWB 1MCWM 1ADQL 3G6JB 4G8GD 4OCWL 5IVZB 2AEPH 4X6DE 1WTGT 3MA7B 4JRXE 4KGJA 3FL7A 4M43L 3UP1A 4YUEL 3NCMA 2C3HA 3O9WB 4R0LB 3TGXA 1TCRA 2ITDB 3BXNA 3O3AA 1M7IB 5HTSA 4R26L 4BSJA 1UZ8A 3BDYH 4PTUA 1IM9A 2FGZA 1FC2D 3LKPB 5HJ3A 5D1QA 3IKCA 4UAOB 4P9HH 2XN9D 4ZMAT 2Y5EA 4ACPA 2VR5A 4IJ3C 1MNUH 2PYEA 2ZP0T 3GKWH 3PWUB 5T3ZL 2DJSA 2B4CC 3C87A 3NFPB 3MLYL 2PETA 1CLYL 1QBBA 1MHHB 4M7ZC 4Y5VC 5HHMD 1T7YA 3S5LA 5EC1B 2OJZH 3RAJL 4ZNCD 4PRPA 4Z7QE 1S7UA 1ZE3C 1Y0LA 2H6PB 4L8SA 5IMMA 4K23H 2IPUK 5J9PA 4ODWB 2OQJB 4FQXB 1ZT1B 4LARL 3CMOL 5L8JB 3O6FC 1XGUB 3ESUF 3QXUA 1J8KA 4F33A 4KRMB 5FYLD 3BKCH 1EFQA 5JDSB 1JNLH 1EHNA 2D0HA 3WNKA 5E00A 5FM8A 1P6FA 2GTWA 3VGGA 4YFLF 1HI6B 1HKFA 1KCSL 3DHJA 2E27H 5E8DL 1WBXB 2JJWA 1A7OH 1LO5A 4H1LG 4X6EA 4NHCH 3HPJB 1DL7H 5F7UA 3CC5B 4UT9H 1CK0L 3UTTE 4OB5L 2GHWB 1VEPA 1A1OB 5AYUL 2APBA 2YZ8A 3TO4A 5ILTH 2I07A 4FQLH 2DQTH 3L3KB 4MD5A 2CIKA 3VMOA 4K3EL 2CR6A 2OL3L 4LMQE 4YZFE 1F6LL 4ZQKA 1I3UA 4FQXD 4W4OC 3IF1A 2VISA 3O6MH 1KJVA 2R0LH 5C09B 5GGTH 1JBJA 4NWTH 2EEBA 3B8YA 4LEOA 3SE4C 2B8OT 1KJ2H 1BQHG 4G6MH 3PL6D 2AEQL 4K94C 1ACYL 1FPTL 3HZKB 3AREB 1G6RB 1MFDH 2NZ9C 3GFUA 2B5IC 5DUPL 4LCWB 3GSOB 1KCVH 4HUNB 4GKZB 1RIUL 3DI2B 4HK3N 3W11C 5DXWA 1P2CB 3I6GB 4Q9RH 1BFVL 3WFBH 4KVNL 4PGEB 3E0GA 3P30L 1WVZA 4J3OC 2OTPA 3VXUA 4NQEE 3V5HA 5DEGA 2VWEC 1UCTA 5D1ZA 1AE6L 4GBXA 3WFCL 1YMMB 4DEPB 4HKJA 1SBSH 1E4KA 1RMFL 5BV7L 4GSDH 1E4WL 1SJHB 4PJFA 4G6JL 4ZTOH 2YPLB 4NWUH 4CAGA 4JM2C 1FDLL 3FQRB 2WINA 4LU5H 4MS8C 1FFRA 2I5YL 2O5YH 5MP6H 1S8DB 2R2HB 4GAYA 2BFVH 4OUUB 5DD6B 4XVUC 5C7XL 5D96B 2XZCH 1N7ML 4KAQH 1M71B 3RHWK 1PG7X 3KHQA 3BMVA 5E8NB 2EDKA 4LLQB 4P9HC 5FYJE 1OGTA 1XZ0A 3TBSB 4UDUA 5KSAB 1LDPH 1MHPH 3MV01 5FM5M 3QCUL 5GJSL 3LQZA 3GB7B 3QSKB 3O2DH 5DMKA 3VD5A 1OY3B 3WSQH 2KL6A 3PWJB 2YPLD 2AABH 3ARWA 1O7SA 3CVIL 1IGML 1RZ8B 4RGNB 3GSNB 3EJYC 3L3IB 1OAZH 3OAZH 4UIMB 3ZDZF 1XAUA 4LHJB 1V7NH 4OZHA 3I3EA 4HPYH 3MX0A 5D7IE 2ZCKH 5T1DH 5J89A 1XR8B 3B9KC 2GIYA 3DVNB 2OZ4L 4YPGA 4WIQA 5HI3C 3UTQB 1IGJB 4PJCA 1OP3K 2PYEE 5HBBA 4G7YL 4MLSA 3QEHB 4K9EL 3MRKA 5JO5A 5HDBE 4YHZH 5DJ0B 5F7WC 2Q7NA 3A0OA 4Q9QH 5D6DA 3EKCA 2RAMA 3MV7A 4PRPE 3S88L 1P4BL 1U8QB 5EZLA 5KN5B 3VGFA 1H5BA 1REIA 4P2RE 4RGND 2AQ1A 2OTWA 1DEDA 1RUQL 3L5XL 3MJGX 1RIHL 3E1F1 3WUZA 3DRQA 3RGHA 4XVSL 3VGBA 2DQFB 4WFGD 4JG1H 3OKMA 1W72H 4C57C 2DQJL 3VD7A 1EFXA 3AREA 4LBEA 5L2KA 5BRZA 4GMTH 2YEZB 1P84J 5LWYL 3QP3A 5F7DA 1UEMA 4XP4H 4WTXA 2VLLB 1NBZB 3IVKA 1BAFL 1KTKE 4JN1L 3GNML 2FGWH 4WI2A 3AGVA 4PJ5B 2SEBA 1A7QH 1MH5A 4NM8L 5EZOH 4BELD 4G43B 5BJTA 1Q72H 1ETZA 5GIRB 3WXWH 3UMTA 1KTDB 4JR9L 4DW2L 1P4IH 4AIZA 3K2UH 3HNSL 1AGDB 4XMKH 1NLDH 1EK3A 1F97A 3MACH 5F3HA 3EYQD 5I66A 3JV5A 5IHBA 1L0YA 5CINH 4PV8B 3MRJB 2H8PB 1ZLUH 2F9BT 2IANB 2V5TA 3RWDB 4G3YL 3VXTA 2WUCH 1MJ8L 1IGCH 3BP4A 3SBWC 1JYWA 3CH1A 1CFSA 3EDJA 5CD5D 3DYMA 3KWWB 4WWKD 5IW1B 1QKZH 5KVDL 2HRLA 3VXUE 2QKIB 4UT6L 3PNWA 4HH9A 4FXKA 5T1LD 5KSAA 2XKSA 4ZUWB 4MVBD 3OJDA 4FG6C 4OLYL 4WDIA 5IFJA 3ZKXB 3F5WA 4ZTPH 3EGSB 4GKSA 5ISZB 2ATKB 5T5NF 5BZWA 1MFCH 2UUDH 4H1LA 1J12A 1YQVH 5MEQA 4MX7B 3Q5OA 2P7TA 4KMTL 5HSFA 5C0EA 3GGWB 2LAGB 4OLXH 3KPOA 1FZMB 4L4VA 2CRYA 4WUUA 5DC4B 3C6LC 1ZLWH 4HKXA 3HUJB 4N1EA 5E08H 2YWYA 2H41A 3LDBB 4PRHB 3R0NA 1YNLL 4XHJD 3N9GH 4P2QB 5GS1A 4IRSB 2X4QB 3ZYZA 3ULVF 5DMYA 3C5ZB 5DJCB 1KTLB 4FABH 1BQHA 2HFTA 3KR3L 3KGRA 1UKQA 3RWFB 4EI5A 5EPMA 4HV8B 5KVFL 2Q8BL 1YDPA 3EYFB 2V9RA 3SKOA 1UB6A 3IXTA 1HHKB 3IFNL 1KLUB 5T1KB 1CXLA 3P9LB 5DJ2B 3TO2B 2XFXB 5ISZD 1I9EA 2FNBA 2FECL 4GKOA 4WTZG 1CWVA 4KQ4H 2NTFB 4PYHA 4GRLA 4UIKL 1TVBB 3K3QA 2R4SL 3VXNB 3FB8A 3VI4F 4S1QL 2BNRA 4J4PC 4QTIH 1MCNA 4D0BB 1KLGA 5JHDA 4OZHE 5D7JB 9CGTA 1YEGH 4LKXB 3KHOA 2Q7YA 3IDNB 4P2QD 3U4BL 4LKCB 3QRGL 3OZ9H 3C5ZD 4PJCE 4YXHL 3SDAB 5DJZA 4R4ND 4U3XA 4YH6A 4YFDB 4DAGH 4X0KA 3EOAA 3ALPA 4IOIB 4F9PA 3HR5A 4FP8H 3R8QA 4XP9H 5T1KD 1U95A 3P4MB 4JAMB 5EFIA 1KPVB 4ZO6A 3BN9C 4QCIA 1C5BH 3ETBF 1FRGL 1MCDA 4GW4B 5FEBA 5C09E 1MCOL 2DQEH 2J4WL 4NGHL 4MXVE 2WP3O 1TJGH 5IMOA 5F9JB 2YK1H 1JZ5A 4ZUSB 3LRSA 4YX2H 2K7PA 2WW8A 4KJQD 2AXHA 4HUUA 3QCTH 3MRIB 2MFNA 3IDUA 2X4OB 5L2KE 4Q58C 5HXMA 3ULVL 3CVHA 4JFXB 3ALXA 5BRZE 3WS6C 4LCWE 5C0NC 12E8L 3CLFH 4ZUTA 1OGAA 2VDOH 5FDWB 2W0FB 2X9WA 3U7WL 2EIZB 3WD5L 2WBJB 4ALAH 4ZFZA 3GUTA 1W0VA 3U4AA 4HWZA 2BZDA 4OFDA 2Y5TA 2XRAH 2VDKL 4PG2A 1H3PL 3BD3A 1EXUA 3BZEA 4OT1H 3MLXL 4R90L 2A1WH 3D48R 3ARFC 2VDLL 3CFCL 1YEDB 4F57L 4K3DH 5ELIA 5JW4N 3N0PB 1BIHA 1DTUA 1QRKA 1G7HA 4PJ9A 1OSPH 3DSFH 1UXWA 4HK3J 3HI5H 4P4KD 5ACZB 3MRPA 3SDXA 2HAZA 4TPRL 2FYYA 4DKEH 4FQ2H 3RX5A 4XNZB 5EN2B 1ZHBA 1KGCD 2GK0B 5JIPA 3ULUH 3W9DB 1L9MA 1KC5L 1JNNH 4L3EA 1S9YA 4NT6B 4AENA 1KIRA 5L8KB 2M8XA 1NGWB 1UGNA 3VG0H 1FIEA 1BIIA 4HT1H 2KDGA 4PLOB 1I9IL 1ZT4A 1N8ZB 5DUBA 2J8UA 1K3IA 1A9BB 1EAPB 1FZJB 1CFTA 2NZIA 3WO4C 4EKXA 3DRTA 3LPWA 4PY8I 1FNAA 1GJIA 2BRRL 3C2SA 3W5NA 1S7QB 5DJYA 2QADD 1Q0YL 3IAGC 1S78C 1VCAA 4YHPB 2F54D 4R97C 5J11C 3ARBC 4G8IB 3G5ZA 3G04A 3F7PC 2O5XH 5BS0A 3E6FB 4D9QE 3BQUC 4L4VE 2YC1B 4WUUE 4NFCA 4BFIA 4XPAH 4X9IA 2NYYC 4TVPE 3X14A 1TENA 4DGVH 5IG7B 1KFAL 4S10A 4PTTA 4HPOH 4QOKA 4MAYB 3BVNB 3O11B 3GMQB 5JLZB 4XB7A 2MCG1 4QRRA 4CVXB 2VXQH 1ZHNB 4G7VL 3WIFB 1WT5C 3MSPA 3O4LA 5DJ8A 1EAJA 4EUPB 1BF2A 1RV6X 4XGZA 1DEEB 3BP7B 3EBAA 4U1SA 5I16B 2APVA 2YN3A 1L6XA 3FCTA 4L3AA 3E2HC 2VB5A 4JKWA 3RIFF 1UFUA 1NFIB 5IB4A 2NW3A 15C8H 5JXAH 5J6GB 1EH9A 4QHKJ 3NMEA 4Y4HD 1R3KB 5JHDE 1TNNA 2NY7L 3KXFB 3MCLL 2XZQH 4OM0H 4I48B 4RIRA 5EZIH 1IKNC 4Y2DA 5TJWK 1U3HD 5D72L 1FVEA 2QHLA 4HIEA 1NGQL 1RJZB 4TRPH 4YXLH 4JREB 3RZCA 3TBYB 1EHXA 3F7YB 1K4DB 1LGVA 4U05A 5IV2A 4UNTA 4BQ9A 4F80A 1MRFH 1FO0A 1IEBA 1MCPH 2UY7A 3PHOA 1IEAA 4PJ5E 2OR7A 4OF6A 3IYLW 3U2SB 5ITBL 4UBDC 1KIPA 4URTB 4R4FH 3VRIB 2M26A 5T3XD 4Q74A 4ZPTA 5GS2H 1U2HA 5JXED 2NXZC 5DF0A 1I7ZA 1S7XA 3GMRA 4JFPB 3LVEA 5EC2B 1AQDB 2PTTA 4QXUL 5HVHC 4JM4H 4I4WA 1RZFL 3CFBA 4FXLA 4AJ0A 3EYSH 4POZC 3ZYOA 5B3JE 4X98B 5C0GB 4L4TB 3OQ3B 4O51B 2IANE 2ADFL 4WY7H 4WTZA 4K7FB 1OGAE 1MIMH 1A6ZB 2P8PB 2X9XA 2MTPA 2JKXA 2VH5L 3GIVA 5KSVA 2PCPA 3CLEL 2XTJC 5FA3B 4QT5A 1T0NA 1HHGA 1A2YA 4S11A 1CBVL 1WV7T 4GG8A 1MAMH 3ULUC 1XF5B 1XGYH 1FGVH 1FG9C 3HNVH 4B0MM 4WW2A 3SE3A 3QUMH 4Z7NE 1IAII 1RUAL 25C8L 1KUMA 4MCYB 1JNHB 2P5WA 3SE9L 4KKLD 3DGGB 1T1WA 2WZPD 1BD2B 4NZRL 1QYGL 1N64H 2EDQA 3EJZD 3MRFA 4PR5A 1QFWH 4K2UL 3LOWA 4OCXL 1MCHA 1G6VK 1VFAA 4KPHH 1OP5K 3A6BH 5IGXL 4NKOA 2BSSB 3OXSA 4JJHA 5A3ID 4HDIB 4GW1A 2RCSL 2J6EL 3HUJE 1I8LA 3PWLB 4AIXA 3GEWB 4CKVX 4OZIF 3QNXB 3P9WB 3MJ8B 2JLLA 1WSST 3QUZD 4RWHA 4GRWB 4U6HB 4YDLC 2A38A 5GXBB 5ID1B 1D5BB 4LLWA 3RWGB 1D5MA 4L3EE 3D85A 4MNHA 3SQOL 2NY5H 1CE1H 2J2ZA 1BZ7B 2R23B 4NN6B 4EBQH 4GUPA 2AV1A 4L3CB 5KS9B 3B5GA 1Z9MA 1BOGB 4LIQE 2J8UE 1S7SB 1F4WH 2CRIA 5JUEH 3K1KC 4MZ3A 5HVWA 2GSIA 2Y6SD 1ZVSB 2Y36L 1BD2D 4I13B 4NP4H 4DGYH 1RZIB 1HQRB 2CDGB 4LRNH 4NN7C 3DXAD 3FO2B 4JKPL 2H2PC 5BS0E 5AEAA 3C8KB 3MROA 2V2WA 4HWEL 3C9NB 5D93B 4UDTB 2J1KA 3MRMB 3I85A 4I77H 2C1PA 5F8QC 1A5FH 1CGXA 2F74A 4QOKE 3TIDA 4G8FA 4C56B 1R6VA 1FC1A 3QEGL 4XH2A 2AJUL 2X42A 5I76A 1OLLA 2NW2A 3DUSA 4QRRE 2ERJB 5I1AB 1S7WB 3NAAH 2EO1A 5MEOA 3T8XB 2V2XA 4RAVA 4OCRL 2QQNH 1R3LA 5D71L 2ICWI 3TBVA 2D2OA 5CSGA 3EO1A 1KSRA 5DC0A 4X7EC 4ZS6D 2Z92B 1Y18B 2ZUQB 5C8JB 2XA8H 3HLAA 3RUGB 4N0RA 3X12A 3LMJH 1UJ3C 2R29L 1Z5LA 1FLRL 3SKMB 4Y4KB 2VLRD 4Q9CA 1ZT7B 4ODTL 4OZGF 1G7LA 4KK5C 1NEUA 4F58H 1AGCA 4XBGB 5GS0L 4JO2L 2XA3A 2IPTH 4ETYA 1AHWA 3HE7A 1WWCA 3MRHA 1HH6A 3PWPA 4HIIB 3OPZH 1RULL 4R2GB 1HDMB 4LCCA 2CKBA 5E2JA 4H88L 1H3UA 1QFUL 4XC3H 5K9KB 1JE6A 1I9RH 1JPFB 1IGFH 1LEGB 2CLRB 1EO8L 4MGXA 4HEPG 4EDXA 5D4QA 4LLUB 3V5KA 1A0QH 4F2MB 4OZ4B 2C4FU 5E6IB 2PUQT 4UB0L 4XNUH 3GM8A 5HYJA 1K4CB 4KI5C 3IJHA 1AKJA 3DROB 3FO0L 3VFVB 4CJ1A 2ORBH 1A7PH 1U8NA 4OCMC 1HHHB 1U58A 3Q6FA 4O58L 3O4OB 4YAQB 4N8VG 4JQXA 3KPQB 1MFAL 2H2SD 2FIKB 4YGVA 3OAUH 2DLEA 2GKIA 3VDBA 3UJJH 1ITBB 1T66C 2NY5C 3K74B 4U1GB 3LCYA 5F89A 1O7VA 3QIWA 4JHAH 4RFNC 5DHVA 3DO7A 4BFEA 2DRUA 3BAEH 4JLRA 1C5DA 1NGZB 4F7EA 2AJYH 3H0TA 3T3MF 1G7PA 4OGXH 4JY5L 3BKYL 1FAKT 3JTSA 4ODUB 3HPLB 3ILQD 1JTOA 1OQOA 3QUYC 4ESKA 4TTDD 5JPNA 2YUZA 3RVVD 1F3DH 2VXVH 4JCLA 5FFLA 5HYQA 4NJAH 4DUXA 1JGEB 4FQCH 3ME0A 3MV9D 3TPKA 2RFXA 3ZT7A 4I2XA 1ORQB 1I1FA 1NFDA 2HT3C 3REWA 4C59B 4LPYA 1QSFA 4OLZH 4DN3L 2KH2B 2WQRA 5I15L 2ZUXA 3AFLA 5I1AA 5FV1L 3BDXA 3RDTA 4K3JL 3C60A 4XPFL 2LU7A 2EDHA 1MI5A 5CCKL 2ICWA 1R5WA 3L3OA 5E5MA 4F9LC 3DX6B 1NANH 3SJVB 4AH2B 2D7MA 4FFYH 1YNKH 4C55A 1UADC 5IK3A 1MPAL 3ELAT 2O5ZH 3THML 4CUCA 4Q6YA 5CWSB 2FR4B 1N5AA 3LIZL 2LABA 3L95A 2YS4A 3PWVB 2X4SA 5IOPA 5E8PB 3HAEG 3LQAH 3MRNB 2QSCL 5EZJA 3CX5J 3PHSA 2J12B 3IS1X 2NPLX 3AB0B 3MOAL 5C0JB 4OF3A 1AP2A 3WKNA 1ZHLA 1RZJH 4K7PX 5I1EH 1D7FA 5JW4R 1SY6H 3MRQB 1HZHH 1QQDB 2L4OA 5D2NC 3TH3T 4G9DA 1KBGH 5HHVH 4B41A 4ZXBD 2D7PA 4RQQA 3ILPB 2WLYA 1UKSA 3MLTB 2XNAB 3G9VA 4JKMA 4JFFD 3CFKA 1B6DA 4U31A 3QFJA 4X8JA 2NTSP 1K6QL 5DC9B 2R2BA 2NY4C 3CZFA 3UTSB 2X1OA 4I0PB 3UTPD 2VAAB 5TF0A 1NLBH 1AH1A 1XIWA 4I3SL 5IP4A 2NR6C 4RMTA 3E8UL 3INUH 4M1GH 2ADGB 1XF4B 4RMWA 4DZBB 4R4BB 4L4TE 5TGBB 5IMLA 2PW1A 4Z0XA 1PDKA 2XZZA 4Z76A 1I7TA 1WCBB 3ULSA 3BPNC 5DMGD 3NH7L 3FKUS 1E6OH 1ZWIA 3QDMB 4OLVH 5CIPA 3SDCA 4R7DB 1CD1A 3JV4B 1U0QA 3CSBA 1BBJA 5GISL 4M1CC 4EI6B 1LK2A 1MRCH 1DFBH 4G6KL 2F53A 1JL8A 3MXVH 2DWDA 3LB6D 2N7AA 2BDNL 2MQ0A 3EYOA 3L3HB 1I8MA 2BY3A 2E7LA 3W39B 1CDHA 3MLRL 1QNZH 2RB8A 4HUXB 3FTGA 4KROB 4LGPB 3V52H 3HHRB 5I1LA 3V6BR 2DI7A 1OW0C 1KB9K 4FA8A 5HYJE 35C8H 4PJ8C 5I1HH 3FB5A 1ZA6A 1N6QH 2NY6B 1CICC 3DUUA 4K8RL 4NHUB 3P11H 5FCUL 4GRWE 2IF7A 4U1IB 2EZ0C 3PABB 3QDMD 2KZWA 4IS6B 3KYNB 3VDAA 4IIQC 2XKUA 3D39A 2AGJH 5MERB 3U9PL 3DLQR 4F7TB 3U4EA 1MAKA 2DTSA 1FL5B 1ED3B 3FQWB 3BEWB 2EKSA 3QPXL 1C12B 1HH9B 5GSRA 4N0YL 1DQQA 2VDPL 4KUZL 4N9GA 4OV5B 1IAIL 1N2RB 4EZMA 4CADB 4BZ2H 5ANMA 3TZVC 4NRXA 5E95B 1S3KH 4NJ9H 5IW6B 2CIIB 4C54A 4J8RB 3IXAA 2UVFA 2MJWA 1B2WH 4HKZB 1NAKL 5DK3A 3BT2H 3HMWH 5F9OH 4PB0H 4Y4FD 1HSBA 3I02B 5E94B 1IC7H 2CH8A 4UQ3A 5D6CA 5SV3A 5F88A 5DWUL 1KJ3H 2FX9L 3TFKD 2FHCA 4YHNB 3V6ZB 3EFDL 5F97E 4IJ3B 1AY1H 1RURL 4PGCA 2DTML 3LH2H 2DYPA 4YO0A 4I2XE 1D9KA 4C56E 1NFDE 3LQAC 1TLKA 1QSFE 3OAYK 4JO1H 2G2RB 3VXPB 1BGXH 3MRLB 1RZJC 3DNKA 1OTUD 4M7ZB 4Y5VB 2ZJSL 4MJ6B 2VZSA 1QBMH 3BUYB 4JPVL 1SMAA 3MNVB 1MI5E 1KACB 3WYRA 3TJEH 1C1EL 4N8VA 5EU3B 1FBIH 2X4UA 4JGJA 4HF5L 2R15A 3TWCL 1T21B 1R24A 3O6FB 3D87B 3CPLA 5I8EA 4Q7DA 4RNRB 4PLKC 3HI6H 5CP7B 1I7RA 2Z9TA 1J8HB 4M62L 4M00A 2YRZA 4NQVB 4PJEB 4PRBA 4QHMB 1JTTA 2JK5B 4HCRH 1YECH 1AIFA 4YHKL 2GJZA 1DP0A 2ZUSA 4E42B 4PGBB 1E4XL 4NQCA 4U49A 3TN0B 1AGBA 5TF1L 2YA0A 4OZFB 4RISL 5B8CC 5KSBF 5DFVD 4OCWH 1K8IB 3MRCB 2GCYB 5C0IB 5CFHA 1HEZB 4N8PA 4M43H 5EU7C 5HI5C 1U3ZA 3MBEC 3QFJE 4HGMA 3SCMC 3NCJH 4EN3C 3UCRA 4C4KT 3BRDA 5B38A 1T1XB 3U0TA 5J1TC 5D5MA 4Y19B 2IG2L 3OF6D 1DVFC 3TVMD 4OFKA 1T20A 1RVFL 3RY4A 2CDEA 1RZKL 3SDDC 3OKKB 4G8GA 2IBZX 2B5IB 4RX4A 3NA9L 4N90E 5CEZD 3QI9D 1KJMB 3IDGA 5DI8A 3WJJC 3T0XA 3B9EA 4QRUA 1HSAA 4RMQA 1OHQA 4CRPA 5L0QC 4YR6B 2F53E 3TN0D 1TZHB 1WIOA 3PXHA 3MLYH 2ZSVA 3VFPA 1C5CH 3CDGB 3M45A 3N85L 4NZTL 1G9NL 5KG9B 3QQ9C 3F8UB 4V1DB 3DI3B 4TULL 5CILL 3RAJH 4O2CA 2XN9A 4YDKL 2X05A 3PP4L 1XR9A 4KKBC 4M6NL 2AJVL 2CIIA 3N1QC 4JM2B 2I9TB 5C07B 3O45B 3CMOH 4LVNC 2QJDA 1AXSB 3D25A 1YNTA 4DK6A 1AC0A 3RVTC 1IGYB 4BQBA 3HZVB 3ARTA 5DDHB 32C2B 3GK8L 3RVUC 4M5YH 4MCZA 5EB9A 4Z7VF 3D39E 3VD3A 4KHXL 5E8DH 3O2WL 5DT1L 2L7UA 4GAGL 4WHDA 4POYA 1CK0H 2X70B 1ZS8B 5L8LB 5IM7A 2DOCA 4RDQF 4I9WD 5JZ7D 1ZA3B 1CZ8L 3G5YB 3QG7H 4GO6B 5D7IF 4GG6A 2NLJB 5ANME 1WBZA 2PYFB 4MA8L 3WUWA 4MDIB 3HZYB 4ZUTB 3VXMB 4D9LL 1NDMB 1MELA 4Z7WA 3SJVE 1QLEL 1YUHB 5C07D 2M1KA 2GYSA 2GT9B 4TUOB 2JJTA 3O2VH 4NO3B 3P2TA 2OXHA 4JZJC 4IDJL 3T0DA 3UAJD 1YQ2A 3NZHH 4CU8A 1G84A 3MGOA 3ESVF 1ACYH 2Z4QB 3S97C 1JGUL 3PGDA 3MJ7B 4R7NB 5DQ9B 3F65A 2FBOJ 4WU5B 3UJIH 2P24B 5C0CD 1OARL 2EC8A 3EZ8A 5EOCH 1MWAL 1BFVH 4HXBH 1CDGA 2VN4A 1TJHL 3OKOB 2IGFL 3P30H 5F7KC 4I5BB 4WI8A 3X17A 3WLBA 4BSVB 1NMCC 2CDFA 1MCQA 3PL6A 3FQNA 1F5WA 4NM4L 3HCVB 3G6DL 5BQ7B 4M8QB 2D0FA 2VNCA 1RMFH 5BV7H 3JVGA 1E4WH 5FYKL 5ADPL 5FOBA 4RA0C 4W4OA 1BEYL 4G6JH 4OCYH 5C2BH 4XNMA 5C0FB 3WS3A 1GC1L 4PGDA 3S7GA 1J0JA 1LK3L 4TQEH 4LSRL 1FYTA 2HT2C 3BH8A 3C8DA 1MFBL 1A6AB 5J1AB 4NKMB 2APXA 2IWGA 4G6AC 1DUZA 2EYSA 1Q9WB 1N7MH 3Q1SH 5F1SA 4Z8FL 3P40A 4U3CA 4D8PA 3IETB 4P5MB 4XVJL 2DQUH 2UWEA 1IGIL 5EUOB 4H20L 3FFCD 4Y5YA 4PLJD 3FT2B 3U83A 1CD0A 1G0YR 2QSQA 4NQCE 2BVTA 2BVQA 2Q3AA 5BZDB 4MD0B 1JPSL 3N1PC 3ZT5A 3QCUH 1B0WA 4G80A 1GPOH 2Q1EA 1G7MA 4NUJA 4Q6IC 1HHIB 1HOCA 3UX9B 4F15C 5D5ME 2B1AH 3CVIH 1IGMH 2EDRA 1FNGA 3IB4A 5LGHL 4C58B 5CBEA 4HS8L 2FL5A 1LP9B 4QNPF 3TPUA 5T3ZD 3G6JF 4G8GE 4Y8AA 4GLRI 1X44A 3PP3H 5IB3B 1E28B 3H6JA 5FYJH 4LPWA 2YSSA 2OZ4H 3WNLA 4L9LB 1G7JB 1IE5A 2Q86A 4ELMB 2A6IA 1P5VA 4ERSL 1HHJA 3F62A 1OT2A 3TNMB 4DGIL 2HRPL 2F58H 3B5TA 5AUMA 4H8WL 5CSZA 4NPYA 1P4BH 4M48L 2XPGB 3DMMC 1EJ6A 3F7VA 5E56A 1RUQH 3BFOA 4XWGH 4P2OC 3QWRD 1YEEL 5J1SC 3ARGD 1T80A 4XVSH 1A6VH 2WLZA 4BKLB 1RZGA 1HIML 3RU8L 3C6LB 4AL8H 3RKDC 1S9VB 2ADJB 4RMUA 2H9GB 5HHME 1V3JA 2WIMA 3B9KA 5CMAB 1CYGA 5DMIH 5GGUA 1VESA 2VDMH 4WV1C 3O6KL 5LWYH 5J3HD 1OTTC 2P1YA 4K07A 2VKXA 5DR5H 1OF2A 4BK4A 2X4RB 1BAFH 4JN1H 4XAWH 1C08A 3PJSB 3P73B 3PDGA 1GAFL 3QIBC 1ZGLB 4KRPC 4WI4A 3U30C 5TFSL 5DK2B 3MFFB 2VLJD 4JR9H 4DW2H 5BV7C 2AP2A 1VGKB 3QCVL 3P0YL 1NFKA 3HNSH 4NZJA 3MREA 3QEUB 3X3FL 5LGJB 2P8MA 3RJDA 1ND0B 3C6LD 1WTLA 5KW9H 4ZFFA 3MRDB 2I25N 4NN5C 1MHEA 1KJ2A 4PJEE 1W72B 1MJ8H 4OF0A 2HG5B 1A6WL 1OAUL 3QDGB 3OKEB 1ZLVK 1T04B 3MNWA 1BVZA 3UXFA 5KVDH 4P0DA 2AK4B 2WWKO 4HIHA 4HUVA 1X4ZA 2E7HA 5FYLL 2FSEA 4NQSA 3FQUA 3O3BB 3BMWA 4UT6H 4XHQA 5KANI 4KU1A 4PJDB 5C0RL 2P5EA 2XYCA 5C86A 3TT1L 3O3DA 2Y7QA 4OLYH 5LGKA 1JZ7A 2BERA 3FO1B 5J6HB 3NVQA 2A6JB 2H3NA 2OS7A 3UC0L 4Y19E 4WWKA 3IRPX 4YLQT 4KKCC 2YKLH 3CFEB 1FYTE 3BKJL 5FKPA 1CGUA 4ODBD 5T1LA 5DK0A 4GXVH 3WE6A 4PJ7B 1ERNA 2V5RA 3LKRA 4YHIA 2EDLA 3QDGD 5IBTL 3CSYA 1YNLH 5D7KD 3IU4L 1TMCB 1ZHKA 4E9LA 2PKDA 5AG8A 2AK4D 3BRGC 2UWEE 1FE8L 5EO1A 1MJJB 1F90L 4HXAL 1YEIH 4L8BA 3I6LE 2G5BB 1UWXK 1A21A 5EULV 2ZUTA 2EDNA 1Q1JL 2Q8BH 2Z8WC 2OK0L 4U7SA 5MEPB 4V1DE 3AU1A 3IFNH 1FL3B 5SWQB 2ARJQ 2A77L 2Q6WA 2BSTB 3ARFB 4MXQC 4R96A 5E1HB 4WUKL 4I0KA 1E6JL 5INCA 1NGYA 2HTKD 4UIKH 3VFSB 2R4SH 2QQLL 3O2DA 5H35B 4YIQB 4S1QH 4XNQA 1IC4L 5HGDB 1PX4A 3RI5K 2NNAB 4HJ0C 4OKVB 3UJTH 5GRUL 3HS0B 3GMNA 3QDAA 1HILB 5D1QC 2OR9L 1WJ3A 3QRGH 5FF6A 5DVKA 1A7RH 3AS3A 1DR9A 3WXVH 1RU9L 5F44A 4P4RB 3WFZA 4LSDA 5HDQL 4WW1B 1D6VL 1KPUB 1OTSD 5GRWA 3ARFD 3WO4B 4HK0B 1GGIL 5IB2A 3SGJC 4WFHD 4KZEL 1WLHA 5JW5A 4Q0XL 3RFZC 4OLUL 3HE6D 4L8SC 3VXME 1J05B 1NCCL 1RIVL 2FHBA 3QJFB 2BY0A 2J4WH 4R97B 4NGHH 5J11B 3ARBB 3G5XB 3S37X 5I75C 4U6YA 3JWDL 3BX7C 1OSZA 4JFEB 4NZUL 2ED7A 3REVA 2B1HL 3AXLB 2I9LA 4PD4K 4CMMB 2VXUH 1JWMB 4UUJB 2AXFB 1FVCB 4J3WA 1RUKL 2FEDD 3U7WH 4DUWA 4UOJA 4K55A 43C9B 5JORB 3UZEA 3U46A 5GS3A 5ESAA 1DUYA 3LEYL 4WFGE 1LE5A 1LO4L 4F7CB 4ETQB 1H3PH 2VSCA 1XGPB 2JIXB 3TO4C 1C8PA 4OLEA 4R90H 4JRYD 3RNKA 5DO2C 3IJYB 4YDJB 5B39B 4MA3A 3U48A 4JY4B 2BNQB 3CFCH 3EOBB 4DVRL 1S78D 4P46D 3HB3D 3KPNB 5F1IA 2FZ3A 1F3JB 5ETUA 8FABA 1KN4L 4H25A 4RRPG 3C6SB 2Y06L 1AGFA 1NCWL 3C2AH 4P3CL 1A1MB 3H9HA 4TPRH 1VACA 1LEIA 3GSNL 1UYWL 5IBUB 2OJEA 2YPKB 4OQTL 4BZ1H 5INDA 5ALBL 3BH9B 5FYKU 3S35X 1CGVA 1MQKL 5E8OB 5DJXA 4HWBA 1ZTXL 2E8ZA 2G75A 3UYOD 4BH8A 5D1ZC 4AT6A 1YY9D 4GBXC 4P4KA 2P5EE 2DKUA 3VW3L 4JN2A 1V3MA 4FXGB 4HFWB 1N6VA 3B6SA 2YPVL 3K46A 4GQPH 5DRWA 3BGMA 5ADOL 2IQ9L 2BVEA 2NXZB 4JG0L 1T4KB 3WKMH 2HKHL 4AG4L 1Q0YH 4WHCA 1YY8B 1BZ9B 1RFDL 4ODXB 4HJGB 4HD9A 1NC2A 3DETC 4M61B 4MNGA 3UDWA 1K85A 4Q2ZA 3U36B 4Z7NF 3QPQC 1DLHB 5CHNA 5IMKA 4ZSOB 2XTJB 4DUVA 1BM3L 5DVNA 1S9XA 2JELL 3ES6A 5GRXG 5EIIA 3BP5B 3K1DA 4QF1B 5HHOB 1DBML 3NN8B 3NGBC 2OTUA 2F54A 4HUWB 1U36A 1INEH 3ZYIA 4XC1H 4G7VH 3L7EA 3HUJF 3X3GL 4H1LH 5D70L 1YYLL 1BPVA 3D18B 4AK1A 5EUKA 2X41A 4MSWB 1CFVL 1QLFA 1U93B 1GOFA 2Z31D 4FQHA 4FTVD 3VFOA 1GOGA 4GXUM 4YK4B 1W8NA 4AEEA 4NQDD 3BQUA 2HFFA 4OIIH 3MCLH 5I8CB 3T0WA 4MJIA 5GRVL 4XZUA 4YDLB 5JQ6L 2X7LA 3QDJD 4LHUD 1NGQH 4OF7A 4NNXB 1SM3L 1U8PB 5HHOD 3QO1B 4YFEA 4XTRD 4GKNA 3FN0H 1I8KA 3BZ4A 1KNOB 3C09C 2YD2A 1PG7L 5LCVH 1BVKB 4Y4HA 3RY5A 3MMEB 5D6DC 3CUPA 4U6XB 2LVEA 4PREB 3I9GL 2A6KA 3ZDYF 3VD4A 1U3HA 1KENL 3QFDA 3ULVD 5DZNA 3SQBA 3VFMA 2W59A 3QG6A 4NN7B 1K5NA 4KDTC 2DWEA 3WL9A 3LSOB 4QXUH 5TQ0H 3SOBL 4N0UA 4ISVB 1L0XA 5B4MC 4LCUB 4QY8A 3OV6A 5DA0B 1T03L 2ADFH 1RD6A 3QA3B 1XCQA 3I2CL 1HINH 4GXUN 2A0LD 2DLTA 4RMRA 4QHLB 3CLEH 1CD8A 5CJQH 1TIUA 2IH1A 3MUHL 5E9DB 4H26B 4PJBA 3FAWA 5FO8A 4FNLL 1CBVH 1QZ1A 4Z78B 3WDIA 3W0WB 4H5SA 5IJKA 1NCBL 1XF3B 4X5WB 1M7DB 1CXEA 4O5LH 3RWIB 3GSUB 1IMHC 1S5IL 2IAMD 5TE7H 1RUAH 2F19H 3SE9H 3KJ6L 4GW5B 4LHQB 4NZRH 1UJ3B 4JFQB 2OI9B 4RWYL 4OCXH 3CVHH 3S4SA 1FCGA 5SWZB 2VE6B 1BBDL 1P1ZA 3R06B 2RCSH 2D3VA 4PJ7E 5IFAL 1AD0A 4QRSB 3O3EB 3PQYA 2WAHA 3IDJB 2VLKB 2D9CA 4N1CA 2IEPA 4LLMB 2VQUA 4GS7B 4EIZC 3ZYJA 3W0WD 4NDMB 5FECB 1PQZB 1EJOH 1QFOA 1ZEAL 3NIFE 3Q2CA 4JJ5A 3C5SB 5HGAB 2W60B 4HFUH 5DEFA 3QUZA 5ITFB 1KIQA 2Y36H 1H0DA 2EYTB 3FRPG 1CLZH 4BH7A 2CUIA 3QUMB 4G42B 4PUBH 1JCKA 4TSCH 4LSSL 3ISWA 2COQA 2ZCHH 4PBXA 4JKPH 3EYUL 2ID5A 3KPLA 3GMMB 5HDOA 1N26A 3NTCL 4X4YA 4MNGE 3IGAB 4G8EB 3TYFA 1IGTB 2VLKD 4N8CL 2ICES 1S7VA 1OAKH 1AXTL 4JPIA 4HJJH 1NJ9A 4LIQH 4RRPA 3U6RB 2VMFA 3QYCA 2ATPA 2IADB 1GGUA 2F54E 2AJUH 3DXAA 2D7TL 3FQTA 2ZG2A 4EI5C 5I2IB 4LASL 1FZOB 1G9ML 2IPKA 2H32A 3CFJA 4OCRH 2NX5B 4Y0GA 2O61A 3T4YB 4X6CA 3UTZA 3T1FA 4JPKH 2R1YB 5TE6H 2CLZA 4N5UA 5CGMA 3G6AB 2AQ2A 2OCFD 4M7KL 4KRLB 3HRZB 1GZQA 5AYQA 1CDCA 1YPZB 5HHQB 1NCDL 1DLFL 3RNQA 5A2JH 4GRLC 1I8IA 2HT4C 5IHZA 2R29H 2QQQA 5TQ2L 3OXRA 4M4RA 3MR9B 5FA4B 3RL2A 2GAZA 5FM4A 1Q9OA 2ENSA 3QUYB 4ODTH 5FB8A 3T0BA 3BYTA 2HVJB 1F4XL 4MJIE 1IBGL 5GS0H 2A9ML 2BNUA 4E0RB 3EYVB 3MRBA 3ZKMC 43CAA 2Q76A 1T2QL 3OL2A 5JOFA 4HBCH 1U2CA 5IKCA 2YBRB 2VDRL 1RULH 2AW2A 2JJVA 4I3GA 3BPCA 3HG1B 4IM8A 4NCC1 4F9PC 4Z7OF 5H2BA 3BEVA 2VLRA 4H88H 4P9MH 4JO4L 3T0ED 1OB1B 1QFUH 3CMGA 3KJ4C 4HAFA 2LQRA 4JHBA 4PJAB 1WZMA 4HZLA 5D2LB 1M7DA 4PJIB 3NCFB 5EBMB 2AXGA 2BNQE 3WV0A 4KHTL 3QUKA 4JRWA 3VDCA 4D0CA 1ES0B 1WFNA 2E6QA 4UU9B 1BX2A 4J3UA 4N0UE 4AY0A 1CIDA 3OX8A 1RUML 3QUYD 4UV7H 5HHPB 3TT3H 3G08A 5FO9B 5EU6A 2EICA 4AMKL 1UZ6E 1TTFA 4L29A 4O58H 4U0RC 5T3XE 3CFDB 1TETL 3G5VB 4PJBE 4OFIA 2RQ8A 3F7RA 1FO0H 4L4JA 4NO5B 4O2EA 1MFAH 5T1MA 5GSVB 1KYOK 5TDPB 1K3ZA 5D2NB 1PKQB 4A2MA 1LD9A 1M6OA 3DX9B 2EH7L 2V7NA 4KDWA 4PG2C 3QIUD 3LEXB 3S9DB 3W5MA 2X40A 1U8LA 4U33A 1WEJL 2XOTA 3LN4A 3FB7B 3VXSB 3KLSA 2NY4B 1SYSA 4HUKB 4JKKA 4Y16B 3BGFC 1OOAA 3KPPB 3FB6A 3BKYH 5C0DB 3V4VL 3BOVA 2HYMA 3CH8A 1ORSB 4EDWL 3QO0A 3PQYE 2Z93A 5DURB 3VFNA 4TNVF 5AWNL 3FO9B 3LS4L 1IC5L 3NCYP 2HTLD 1E0OB 3BPNB 4PY7B 2Q8AL 1DQMH 1I4FA 1FAIH 5IBLC 3S96A 5MENA 4YBHA 1A4JA 2NCMA 5I15H 4ZDHA 1F42A 2EC9U 3LKSA 4K3JH 3PGCA 1F6AB 2N56A 3OTTA 2NY0C 2DQCL 2A2QT 4ZFOB 4GRWF 4DVBB 5JTWA 1L7IL 4Y16D 2AAVA 2NR6D 4WO4C 3WIIL 4PJ8B 5KS9F 2HVKB 3MRRB 1R0AL 1IQDB 3ZE0F 1RJCA 1T0MB 3LPGA 5DURD 3LIZH 1A6PA 1CICB 5CJXA 3V95A 4BQ6A 1AI1L 4GFTB 4IIQB 3MJ9A 3V6OA 3MOAH 2Z35A 5GS0C 4RMSA 3VE0A 1M4KA 3DXAE 1UXSA 2XQYG 4XVTL 2X4TA 4Z7UA 2R2EA 4YBQD 4X4MA 5EU4A 2E9BA 4X6CE 5TE4L 2YMXL 3V79C 1P7KA 2QQKL 3UPRA 3TZVB 1DBJL 2P46B 4F9LA 1K6QH 1J1OL 1A14L 1JV5A 2EDJA 4P5TD 2DQDL 4UOW0 5E5RB 3L5HA 1AD9A 1RK1B 1X7QA 2FO4A 4I3SH 4NO2B 3E8UH 2NQCA 2VITA 3Q6GL 4NBZB 1A7NH 4ZXBA 2AJZB 1U8OA 3FOLB 5HYSB 4TSBL 1V7MH 4Y2DC 4RGMC 2JB6B 4JFFA 3NIDE 3KLAA 1JF1A 4YNYB 3RUGF 3RZCC 5GISH 1CGYA 3M07A 4G6KH 4X99A 4J3VA 1SYVA 2VLRE 4LSTL 5TDOB 5EOTA 2R56H 4PRIB 3MCG1 3RTQD 2VABA 3MNZB 4M6OL 1P7QB 1QP1A 1YZZA 3V0VB 1R5IA 3UBXB 2BDNH 5M7QA 3MLRH 2A83B 3VH8B 2DQHL 3GSRB 4OCSL 3STZA 2VZOA 1NMAL 1A3QA 1U8HA 3GJFA 4FQQA 5CLTA 3FT4B 5SWZE 1TCMA 5DRZB 1S7RA 5I1GH 1FG2B 3VWKB 2ADIA 4L1HA 5EU6E 2Z8RA 4BSWA 4ZAKC 1XH3B 1MIEH 1ZVYA 3PUCA 4Z95L 3U9PH 4UV4L 5IR1A 4RBPH 1A6TA 1S5HB 3OB8A 4PRID 5C0AB 5FGSA 1YN6B 5B8CB 3QPXH 3VJ6A 4N0YH 5IJVB 4UQ2A 2BOCB 3SY0A 1IAIH 2PXYB 4WW2C 3BIBX 1FNEB 1RJLA 3KPRA 3MBEB 5FV2A 3SCMB 4EN3B 2XV6B 5IIEB 3D0VB 5IEHA 1T5WA 4PLKD 1DVFB 1N5YL 4U1JA 1NAKH 5IQ9B 5FO7A 3NFNA 3VXRB 4KI5E 3RWHB 2BOBA 2D31B 2V7HA 4W70A 4WI5A 5FGCB 3VWKD 3WLWD 4CNIA 3SDDB 1MCFA 3BP6B 4U3HA 4NUGL 1I8LC 4XMPL 3CCHB 2FX9H 1PZUB 4P57A 1CT8B 3EHBC 3EFDH 4MDJA 2APTA 5L7XH 2AKRA 2DTMH 4KMLB 2H26A 3FZUC 5L0QB 4IOFC 4U1HB 4X4XB 5EOQL 5MENE 1S9WB 1MRDH 4F7MA 1PEZA 1KCRH 3GSXB 4Y4FA 3MXWL 1I9JL 4JFYB 2NX5E 2PXYD 2VZTA 1A4KB 3VWJD 4G9FB 1VFBB 1HXYB 1YYML 1D5ZB 2CKNA 4KTDL 1IAOA 1C1EH 3AS0A 1YPZE 1N4XL 1PY9A 4HF5H 4TVSa 3E6HB 1IKFL 2PW2B 4XCYB 1QG3A 3U7YL 4LVNB 3P4OB 4NKIL 1LVEA 3KS0H 3HA0A 3OG6B 3A67L 2KBGA 4NO0A 4PJHB 4EXPX 2EXWD 3OAZK 3NACL 3VRJB 1I1AA 3WN5A 3CNKA 1BQLL 2ITCA 3V6OE 3C5JB 1P4LA 3DHMA 4LNRA 1JZ4A 4J1UB 4LEXL 4W4NA 5C0BB 4RGOL 2OP4L 3HG1E 4X4ME 1TZIA 1ZSDA 4HSQA 1UVQA 1MHCB 4P2YA 5IVXA 1JPGA 1I3RA 4YDVB 3BE1L 5FOJA 3RGVD 5JPMA 3FRUA 3H7BA 3BN3B 4HKBB 1KPRA 3F12A 5T5FH 1H15B 4WI7A 1YEJH 1U91A 5E2TH 4JZJB 3ARZA 4XCNB 3RWEA 4CDHA 4JHWL 5C6TL 1G1YA 4U1KA 3BO8B 2HLAB 4DZ8A 3NA9H 2F5BL 5H8DA 4NRYA 5DLML 4L8DA 2WIIB 2VLMD 1MLBB 1AHWC 3LRGA 2J88L 1AQKL 4XAKD 4CW1A 3CIQA 2VL5A 2EXYD 3ECBB 1NMCB 3OF6A 4IRJA 3TVMA 3OKDA 5D2NE 1PKQE 4PS4H 2NY2C 4LCCC 4NRZB 3N85H 4NZTH 3SGEH 5A2LH 4ONOA 1VB9A 2G9HA 4TULH 1VADA 4FFWC 4DOHB 3AC0A 4WFED 3DVGA 1J1PL 5CBAA 4XPBL 3QI9A 2DB8A 1G7IB 5BMFL 3KPSD 4KK6D 1WC7A 1TFHA 3JXAA 3UYRH 4ZFGL 3PP4H 3RL1B 5FK9B 1PG7W 1ZMYA 1PFCA 2AJVH 2VXSH 1BJMA 2GSGA 4JGMA 3O8XB 2YA1A 1BVLB 5DJAB 5FAAA 4JY6A 5AZEH 3KYOA 3QEQD 4PJXA 3MA9H 2MNUA 1GZPA 5HPMA 4LQ1A 5CIPH 1PW3A 1U92B 1JWSB 5DS8A 1FIGL 3STLB 5CJBA 2XTLA 3WJJA 5AD0A 1QSZA 2BHZA 1ZLUK 3LD8C 2YD5A 3GK8H 4JQXC 5LQBL 3CSGA 4KHXH 1T1YA 4MA1C 4PV9B 2C7UB 2HJLA 3DX7B 3I75A 3OR7A 3QIWC 1QR1B 3KPRE 3MUY1 4X6DB 5JHLL 5SWSA 3K0WA 3TNNB 4Q6IB 4F15B 3VFRB 3RVWD 1F13A 4D9LH 1A9EB 4X5XB 3LKNA 4OF5A 5DJDB 3GIZH 4NFBA 1BOYA 2E9IA 4XMLH 1MJUL 3O8XD 4FFVD 4OM1H 1JN6A 4FZEH 1N3NB 2UUDK 5EBWA 1AXIB 1FJ1A 4PBVC 1HQ4A 5E2VL 2ZOKA 4HC1A 1Q9KA 1JGUH 1DANT 1G7QA 2DM4A 5KZCB 1DBAL 1VGEL 3ROOA 4UTAH 1WGOA 2HLFD 1MWAH 1QVOB 1TJHH 1NDGB 2IGFH 5DSCB 3IFOB 5EU5B 5C3LD 2FJFA 4N0CC 5I1JL 1Z9OA 3QWOA 4JDZA 3KNBA 4NM4H 3RDTC 3G6DH 4PGJA 2EYRA 4JRXD 4LRIA 3DMMB 1A3LL 2PNDA 5ADPH 4PRDB 1AO7D 5LJYH 5C0CA 4RCAA 2L7JA 3P9MA 4P2OB 5J57B 5I19L 1FFPB 1UH4A 1IAKA 4I18A 4MNQD 4LSRH 1N59B 2P8LB 3VXQB 5I9QC 1DDHB 5BXFA 3RPKA 5L9DL 1H3TA 1MFBH 2EH8L 3V6FB 1T1ZA 4MAUL 4WV1B 4Z8FH 3IDMB 4JFZL 4HX1A 3TJHD 4S0SD 3WFHA 5IESL 4XVJH 4H20H 5TH2A 4U1LB 3GMPB 3PDDA 4LCYA 1BFOA 3UTTB 2J7LA 1D5XA 3QIBB 5EO0B 4KRPB 1JPSH 5DQJB 3B3IA 1PYWA 3JV6A 3DMMD 4PJEF 1F4YH 5IVXE 3U30B 4ELKB 1ADQA 2P43B 3C8HA 4LPXA 2DLFL 4P2OD 5BV7B 4TYUA 3DV6B 4YHML 4EQ2A 4JZNA 4QRPD 3ABZA 3FAXA 1Q9LB 3L5WB 3FFCA 5GJTL 4HS8H 1XIWC 1FL6A 1HXMA 5DHYB 1OAXL 3OKLA 1K8DB 4NN5B 2JJSA 3QQ3A 1LE9B 3LZFL 1U8KB 4YFLI 4KJWC 3VMNA 1GIGL 1OTTD 4LLDB 1SEQL 4HS6B 4AEIL 2DMCA 3DBXA 4JANA 4KZDH 5JW3L 1RJYA 1RK0B 2HP4A 1EGJL 1FFNB 2WWMD 1BJ1H 4PRNB 4NQEB 4RZCB 4ERSH 5C0AE 4LNVA 2DMKA 1GGBL 5JIKA 4DGIH 2N7BA 2HRPH 2P44B 5IFHH 4K7PL 3M8OH 1D6EA 5EU7E 3QZWA 2E7LC 4M48H 2B4CL 5L88H 4I8DA 3D2UA 5IF0B 2YZ1A 5IEKB 3BIKA 5E8EB 3S98A 1MFEH 2I60H 3U9UB 1GXEA 1YEEH 4QXTB 1DN0B 5DEZA 2IC2A 1J0ZA 3M17B 1HIMH 3RU8H 3HNTL 3S36L 3VXOA 4WI3A 3MQIA 4X9BA 2F5AH 2BY2A 4P59L 1CGSL 2A6DA 2IMMA 3QJHB 3V7AG 2JCCA 4JM2F 4MJ5B 4H0IA 3PGFH 3QUXD 3QWRA 4ORGA 1KB5B 3ARGA 1X9QA 5CEZL 2LVCA 3DGCR 3TA3D 2DD8H 1GAFH 5SWSE 5BVJA 1OAYL 1G0XA 5C08A 1L7TL 5IB1A 5TFSH 1JHKL 3LHPL 5B39G 1TCRB 5D7LD 3HC3H 5D1XD 3O3AB 1RY7B 2IFFL 2VQ1A 2NY1C 3BXNB 4DN4L 2OL3A 3P0YH 2ED9A 3BSZL 3H9SD 1EIBA 2BP3A 1UZ8B 5ICYA 5HGBA 1INDH 4PTUB 2RGSA 1H8NA 2EDBA 1IM9B 2UYLA 5HJ3B 4Z77A 2HN7A 3I84A 5D1QB 3IKCB 3OJ2C 5ICZA 3P77A 3EUUA 3D3VA 1C16A 1KXVC 1A6WH 4QHNA 1OAUH 4IHOA 5DGQA 3VRLE 2PYEB 2EDFA 4PJGB 5FYKD 4KY1L 1UQSA 1D9KC 2YOCA 5C0BE 2NXYC 5FYLH 4WNQA 4G6FB 1JWUA 3H3KA 1AR1C 1J0IA 3MV8A 1A6UL 2W0KA 2VAJA 4X7TA 5C0RH 3HZMA 1EX0A 3S5LB 4PRPB 4J6RL 4L5FH 3VFUA 4NSKA 1S7UB 5IMMB 1Y0LB 4L8SB 4DCQA 5I8OL 3CXHJ 3KAAA 3L7FA 5J9PB 1MVUA 1TZGH 3UC0H 5I75B 1MCSA 3ZE2F 4F33B 3BKJH 1E27A 1IM9D 2XKNA 3MCKA 3WNNA 1R3HA 2P4AB 1QSED 5DMJB 1B4JL 5E00B 3NOIA 5L2JA 1R3JA 5IBTH 2ICEA 2GTWB 2ARJA 3AAZA 3HRPA 1J1XL 5T5NG 1FFOA 1FE8H 5F7EL 3KPMA 1LO5B 1F90H 4LHUG 1T6WA 4X6EB 5SX5H 4XCCH 1QHOA 1Q1JH 2GW5A 4P2CG 3UYPA 3TO4B 2I07B 3MOQA 3E3QE 4MD5B 4PRPD 3RZWA 2CIKB 2YD7A 3R0MA 4ZOCA 2A77H 4DOHE 1U3YA 4KK8D 1AFVH 7FABL 1X5AA 4P2RD 2QHRH 4WUKH 4ZQKB 4M6AA 1E6JH 1MNUL 3O41A 4ODVH 3IF1B 2VISB 1KJVB 5EUOF 3MBXL 2QQLH 5B21A 4XBEL 4LEOB 1IC1A 3GSVA 1IC4H 3GDBA 2FHFA 2KZ1B 1XGQA 1CXHA 3X13A 2OJZL 4OF8A 5GRUH 1U6AL 5I73C 3K8MA 5IVNA 2YD6A 1R5VA 2CLVA 5HYEA 2C1OA 5HY9A 4MXWL 4APQD 3VXUB 1RU9H 4FN0A 2OZ4A 5HDQH 3V5HB 5DEGB 2UVEA 5D1ZB 4UTBL 3IDXL 1D6VH 1LP9F 4GBXB 5T3ZE 2G5RA 4HKJB 2WWKT 2E7CA 3MUZ1 4Y88A 2ZZUT 4XX1E 4PJFB 3HMXL 1VFMA 4PFEA 2FECI 2E27L 1NCCH 1A7OL 2WANA 1RIVH 3DWTA 4XBPA 1EEZA 2WINB 4ELMF 2XXMB 3K8KA 3JWDH 4NZUH 4GAYB 5ILTL 5J12C 3PG2A 3R1GL 4NNYA 2B1HH 1YEHH 3GJEA 1EVUA 5B3NA 4OI8A 4Z5RA 4KI1A 3DV4A 1RUKH 5GGTL 3HE6A 2BSRA 3DPBA 5FUZH 3SGKA 3VXUD 4LOUD 4PJGA 3VCLA 3BHBA 3NGBB 1OGTB 4G6ML 4KC3B 4FQIL 4JFOA 1XZ0B 4UDUB 3L3GA 2FBJH 3KG5A 1LO4H 2OM5A 1EBAA 5F6IC 3LQZB 4XPGH 4NYLA 3T3PF 5EO9A 5C08E 5DMKB 3O9WD 1LDSA 3SGJA 3RVXD 1FP5A 1QO3A 2A9NL 3GI8H 4U1MA 1QA9A 3WFBL 3VA6A 1I1YA 4M1DH 1CTNA 1KN4H 2JJTC 4KXZI 3KYMA 4LSUH 3LY6A 2Y06H 1NCWH 2I26N 4W68A 1XGTA 3MLUL 3ARVA 4OZHB 4P3CH 1SBSL 3IKKA 3GSNH 1AC6A 3D3VE 3QXDA 4YPGB 5A16A 5F93C 4PJCB 2BMKA 3M1BA 4FQXC 1KCKA 1MQKH 4P46A 3AM8A 3OB0K 3C09B 2W91A 3MRKB 5JO5B 4KJYA 3MV8E 5T33L 1A1NA 2O5YL 5MP6L 5ID0A 3PL6C 4BQCA 3Q3GA 5CEXA 3CK0L 3MV7B 2XZCL 1KXTB 3JVGC 5EZLB 3HTLX 1U8JA 1CVRA 4LLYA 5ADOH 3Q0HA 2IQ9H 1H5BB 4NKDA 3L5JA 4MD4A 3EFFA 2OTWB 4JG0H 3LAFA 2HKHH 4AG4H 3BIAX 1JGLL 3DRQB 3JSSA 5CLWA 3OKMB 1MHPL 2XY2A 2GTZA 4PJDF 4HGWA 1EFXB 4LBEB 4KV5E 5L2KB 3FQXA 5BRZB 5DZLA 3B83A 3BKML 4XRCA 5F7DB 3V0WL 1HKLL 1BM3H 1MY5A 2JELH 3IVKB 1ZGLM 4Y5YC 1DQLH 3W9EA 1DBMH 4LQFH 2XQBH 3HN3A 2G60L 3G9AB 1NEZG 2SEBB 1EZVX 4HPYL 1BF8A 2AJSL 3X3GH 1MH5B 4QRTA 2ZCKL 4PJ7F 1DZBA 5BJTB 1ETZB 1OD9A 4LDEB 5D70H 1YYLH 4GRMA 5J8OA 3ZSTA 5C09D 5ESVA 4AIZB 4MQXD 1CFVH 2OSLA 5CGYC 4OD1H 2IPUG 2BVOA 3V8OA 5I6XC 1JMXA 1YJDL 2ZSWA 4QGYA 3GJFK 4M7JL 4MHHG 5F3HB 5I66B 3L3JB 1EFXD 3RX7A 3ARED 4Q9QL 5L2KD 4GLRH 4DEPC 5BRZD 3NIFF 4LCWD 5DD3H 3VXTB 5HD8D 1INQA 4W6YB 3BP4B 1CU4H 3JWDC 3IU3A 3QISA 3CH1B 1CFSB 2A73A 3B2VL 5FUOL 1CL7I 2RJMA 2XWTA 3WNMA 2ZKHH 5IQ7H 1SM3H 5DVLA 5FUCC 3MUGA 3RX8A 2Z31A 5DD0H 4FTVA 5E6ZA 4JG1L 5HVFB 1PG7H 3PNWB 1W72L 3WFDL 4HH9B 4FXKB 1YMMD 4NQDA 5F7MC 4Y2OA 2ZG1A 4WDIB 3OJDB 5IFJB 4GMTL 4CN1A 3QXAA 4JB9H 3F58H 1EO5A 3TBTA 3F5WB 1WBYA 1S7TA 1FCCA 3NPSC 4C83A 4GKSB 3TH4T 5BZWB 3UROR 1KENH 4QYOA 1MEXL 1EPFA 3QNZA 3QDJA 4H1LB 4XP4L 3VFGL 5KVEL 4LHUA 5MEQB 2P7TB 1J10A 2CMRL 5K59E 3SOBH 5C0EB 4HW6A 1I85A 3KPOB 4L4VB 4WUUB 5K9QG 4HKXB 1A7QL 4N9OB 1T03H 5EA0H 1Z0MA 4ZYKA 2FATL 1FVDA 5GS1B 3I2CH 3U0PA 4FFZH 3ARSA 1FYHB 5EDXA 3T2NL 1BQHB 1ZGLP 4LSVH 4PJGE 4R3SA 4EI5B 4AEHL 3MACL 5EPMB 5GRYA 1ZLSH 3CGTA 5KSAD 1YDPB 3T4AA 5CINL 3SKOB 1UB6B 3IXTB 3EJJX 1NCBH 2WUCL 5I17A 1IGCL 3GSWA 4GRLB 2OMBA 3IDIA 3FB8B 4KDTA 1SEBA 3L1OL 2BVPA 4RWYH 1KF9B 3ZDZE 2EE2A 1NAMA 4D9QD 2BNRB 4L4VD 3SGDI 4WUUD 1KLGB 1HNFA 5JHDB 4M6ML 1NBYA 5GZOD 1BBDH 3PXJA 4TVPD 5IFAH 2Q7YB 4X9HA 4ZTPL 2IALA 5ESQA 2YD9A 4N5ED 1Y6KR 1MFCL 1EEUA 4MHHI 2IAMA 3B9AA 5DJZB 4M8VA 3WJLA 2R1XA 4X0KB 3EOAB 3HR5B 4OLXL 5JOPE 4R9HA 4X7FC 3KJ4B 3EYQC 5DZOA 1U95B 3CU7A 5EFIB 5BW7A 2P47B 5AZ2H 2W65A 3S8WA 1SVCP 4QCIB 4Q97A 3DX8A 4QHUA 5CD5C 4WWKC 2IQAA 4ONHA 2R0KL 2NMSA 4LSSH 2GFBA 5IMOB 4F3FA 4BZYA 3LRSB 3FJTA 3EYUH 5EWIL 3LV3A 4HUUB 3L3JA 2QR0A 2E9JA 4DTGL 1AGEA 2B39A 3CVHB 2VO5A 5JNYA 4JPWH 3B9DA 1OGAB 4MVBC 2QLVB 3VGAB 4HWBH 4CVZA 1CCZA 2H1PL 4U0RB 2YD3A 3CJJA 5K9QI 1FZKA 4JQVA 4WWID 5CJOH 4ZFZB 3GUTB 1EO7A 1W0VB 4KUCF 4HWZB 2D7TH 3L9RA 4LASH 5EBLA 2Y5TB 1G9MH 4PJ5D 4NZDA 5IROA 1EXUB 2B0SH 4HWUA 3BZEB 2WUBH 4P48A 2EIBA 5HGHA 1LEKA 3P0VL 5B22A 4XI5C 4M7KH 4PJFE 4TNWK 4ENED 4XHJC 2DBJA 2HKFL 4TSAH 3WNOA 4DAGL 5CSBA 1G7HB 4PJ9B 1FSKB 1T7XA 1UXWB 3BGFB 1Z3GL 4EXKA 1W8OA 3ULUF 1HWGB 2GUOA 3QHFL 3MRPB 1P84K 4XPTL 1DQJA 3ROLA 3L6FA 3SDXB 2IAND 2FYYB 5DYOA 2FLBT 4Z0BH 4HG4K 1ZHBB 1IBGH 1BP3B 3S3PA 4UINH 3PIQA 5HYSG 5I1DA 3SKNA 4L3EB 3V7MA 1S9YB 1T2QH 4U0QB 1KIRB 3MRGA 3OKNA 4AENB 2V5MA 4FTVE 1MCRA 4YX2L 3KLHD 1I1CA 3QCTL 1BIIB 4NQDE 4GH7B 1ZT4B 2VSDA 1ONQA 1I1RA 5DUBB 2NY0B 2J8UB 4BUGA 1X3DA 4JFDA 2VDOL 1F45A 1CFTB 3DRTB 4LSQH 3QDJE 5BO1H 4KHTH 2YR3A 3VH8G 5DJYB 4PJ9D 3A6CL 3QULA 4R4NC 1XFPA 3G5ZB 3G04B 1NEZA 1JGDA 2X4NA 5FHAH 5BS0B 1FH5L 3GHBH 4BFIB 4YJZL 3DIFA 3WIHA 4OT1L 2MMXA 3T0EA 1JZ3A 2V2TA 5J13C 1WWWX 4JZOA 4PRHD 5F6HJ 4BA8A 3X14B 2BCKA 3ZKND 4IRSD 3N06B 4L3ED 1TVHA 4D2NA 4PTTB 4L8CB 5GRJL 3ULVE 1T83C 4QOKB 5DTFA 4Y5XA 1OSPL 3DSFL 3VFWA 4LFHD 1F3RB 3HI5L 4HQQH 3KDMA 4QRRB 3IAPA 2EKJA 1I75A 1JYVA 5JW4M 5DVMA 4DKEL 1GGTA 1JFQL 3QWQB 1MUJA 3O4LB 3MV7E 5DJ8B 1WEJH 4XGZB 3ULUL 5ICXA 4U1SB 2VIRA 3B2UD 3FCTB 1JYNA 5F1NA 4PG9A 5IB4B 2NW3B 2C3VA 3ARDA 3VG0L 1NSNL 5D7JD 3V4VH 4XWOD 1MY7A 3ZLQC 4RIRB 3QIUA 4EDWH 1URLA 5T3XH 4XCEA 4Y2DB 2LU3A 5AWNH 3S37L 4RGMB 1LO0L 1IC5H 5SX4I 1FVEB 4HIEB 1T22A 3SDAD 2J6EA 3D0LA 1J0HA 4K71B 3RZCB 4HH8A 1P9MA 2MHAA 5IV2B 1MAJA 2M2DA 1FO0B 4FRWA 1IEBB 3PHOB 1IEAB 4P4KC 4QRQA 1P6AB 1KIPB 4DGVL 4AZ8A 4HLJA 1G9MC 4DKFL 4ZPTB 4N0FA 4HPOL 4YC2C 1NAML 5H94A 1I7ZB 1S7XB 3GMRB 1L7IH 2DL9A 2VZ1A 4OD3L 2PTTB 3J8F7 1JMZA 4I4WB 3D5OF 3CFBB 4POUB 1B6UA 3BDBA 4WGWB 4CJ0A 4J23A 4QTHA 2R1WA 3UDWC 1JUFA 1AI1H 1BWWA 3CD4A 3GIVB 5KSVB 2PCPB 4KMQA 4E41A 2WBJD 4QT5B 1T0NB 1HHGB 3U7AA 1A2YB 1HYSC 2QADC 5DJ6A 4GG8B 4XVTH 2BXZA 4JHZA 4P23A 4S1SL 1OPGH 2F8XC 1C7TA 4Z18A 3S35L 1H3VA 5EZIL 3QDHA 5TE4H 2YMXH 2C4FT 4WW2B 4WU7A 4P5KA 5HYIA 2VTFA 3NZ8A 3NIGF 1DBJH 2P5WB 3MC0A 2Z8VC 1T1WB 3DVIA 1J1OH 1CG9A 3B43A 1UH3A 4PR5B 3MRFB 2DQDH 3RWJA 1FORH 4WO4A 1KEMH 1VFAB 2Y1VA 4NKOB 4PB9H 1MCPL 1MRFL 3OXSB 4GW1B 3Q6GH 1LHZA 1KG0A 3QT2A 4OZIA 1QLRA 2I27N 2DLIA 2XI9A 1CL7L 2AK1L 4LLWB 5E99H 1D5MB 3D85B 1YPZF 4MNHB 4L8CA 3BD4A 2IJ0C 2W0LA 2H32H 4P5TA 3MLVL 4GUPB 2AV1B 3FOMA 3K4AA 4XNXH 3R8BB 3EYSL 3S3SA 4Y4HC 3SDYH 4OV6F 4M6OH 1T5XA 2R0WL 4JFDE 4OBRA 3TBWA 2GSIB 2HFEA 1Q0XL 1U3HC 1JHTB 1I7UA 3TESA 1QFWM 4P3DA 4NQXA 1NMAH 1SJEA 2Q20A 1OM3L 2BNRE 3MROB 1FGVL 2V2WB 2V9TA 3HNVL 3T0EE 2FRGP 2HH0L 4HIXL 4ODSH 1JZ2A 1GHFL 4HAGA 4RAHA 2C1PB 3RTQA 3HKFA 4PJAF 4JE4B 5D2LF 4PJIF 2F74B 3QXWA 4IOFD 4MAYD 2DM7A 4WTWA 4G8FB 3TIDB 4Z95H 3WEXA 1N64L 3CZJA 4XH2B 5I76B 4UV4H 1MCWW 2NW2B 3DUSB 5H37G 1NCAL 3H42L 5MEOB 1CF8L 2V2XB 3N1GC 4RAVB 4WEBH 4X6BA 1R3LB 4XP1L 3K80A 3TBVB 5IJKC 2AV7A 5FHBH 1ODAA 3EO1B 1JP5A 2W9EH 3OHXA 1Q94A 3HLAB 3MFGB 1T7WA 4PP2A 5HHNA 3X12B 2ESVA 3WIHL 1Z5LB 1N5YH 4FMFA 3KXFD 1VFUA 4OZGA 1G7LB 3T2QA 4YEEA 1MJ7H 1AGCB 2GY7B 4NUGH 4XMPH 1LNUA 5JUEL 4ZAKA 4M7LL 1GOHA 2GY5A 1AHWB 4A6YA 3HE7B 5KOVC 4KK9D 4LRNL 3MRHB 1HH6B 4KKLC 3PWPB 5DQDL 2CO6B 4M4PA 5GZND 3NPZB 3EJZC 2NY2B 4LCCB 2CKBB 2F15A 5IB5A 5A3IC 4QXGL 1I9JH 4UOW1 3CSPA 1K2DA 5KOMC 1YYMH 2D7OA 4KTDH 3RHWF 3OGCA 5ACLA 4EDXB 2BC4A 3QUZC 1QPPA 3V5KB 4RFEA 3DURA 1IKFH 3EZJB 4PLNC 4NKIH 5HYJB 1CFQA 4YQXL 4PRAA 3A67H 3IJHB 1AKJB 5K9OA 4WGVB 3SDXE 4L4TD 3T65A 3B5HA 1U8NB 3NACH 1CDBA 1U58B 3VWJA 3IJSA 3Q6FB 1BQLH 3HC4H 1YMHA 5DRXA 2ZPKH 1LWRA 5I74C 1WZKA 3LD8B 4E41E 3HE7D 1KEGL 1NGXA 2Y6SC 3PP3K 4LEXH 3BUTA 5EG6C 1ACZA 1X4XA 4YGVB 2NY2D 4OUOA 2DLGA 2OP4H 4KTEH 3MPCA 2DDQL 3PV6A 3EDKA 1NMBL 1FGNL 4WHTA 1LO2L 5F89B 2AJ3A 4F58L 3QIWB 1FN4A 5DHVB 5F9WB 3DO7B 3HC0A 1AJ7H 3JUYA 2VR9A 3BE1H 2EECA 2FEEI 4UT7L 3DUHA 2FX8H 4JLRB 4LVOC 1C5DB 1JHTA 5HYJD 5FIEA 4F7EB 5KSUA 2XACC 3H0TB 4NN6C 4E5XA 1G7PB 4JHWH 1QHPA 3MO1A 2EO9A 3JTSB 1BHGA 5C6TH 1HWHB 2FH8A 5A1AA 3MJ9H 4GAFB 5JPNB 4D3CL 4OZIE 1IGFL 5DLMH 1KV3A 2E6JA 4LGSB 5HYQB 3OB0H 2CJUH 3RGVA 2JE8A 1A0QL 2RFXB 2J88H 1AQKH 4I2XB 1I1FB 1NFDB 3REWB 1QSFB 4TTGA 2E7BA 3PDOA 3BWAA 4B7IA 1NC4A 4YEFA 5LAXA 1E4XI 1SMOA 3RDTB 1VA9A 3OR6A 3C60B 3D69A 2CO7B 4FQ1H 5ENWA 2D03H 3O4LE 2FWOA 1MI5B 1JRHI 2ICWB 1MF2H 4QWWD 4XPBH 1R5WB 3L3OB 5E5MB 4ZFGH 3AVEA 2HWZL 4YBLB 3OAUL 1A22B 4MB3A 4JDTH 1WFOA 5IK3B 3W81A 5GGQH 1T3FA 1WAAF 5D9SA 1VERA 3Q5TA 4JHAL 2WBWB 1N5AB 3L95B 2VUOA 2X4SB 4KJPD 2V17H 1QBLL 5IOPB 4OTXL 3BAEL 1M05A 1PZ5A 4LSPL 4DK3A 1FIGH 1NBVH 5EZJB 4OLWH 4CVUA 3WHXA 1QRNA 3KPSA 1AP2B 4P3WA 4C56D 5LQBH 1ZHLB 2DLHA 1QSFD 1KXQE 3GBMH 3I6KA 1V05A 2DI8A 3I50L 3SPVA 2PO6A 2Y4SA 4G9DB 3ZSSA 1N0XL 3V5DA 3C60D 4JGUA 4RQQB 4GQ9L 3QEQA 3SGEI 2VXVL 5C9JA 3CFKB 3QFJB 3GJFH 4FQCL 4X8JB 2R2BB 5F72S 2R9HD 2DQGL 3CZFB 2XZAL 1GGCL 1KCUH 1T7ZA 2ESVE 1WFTA 4Y4KD 1MJUH 2D0GA 2H2SC 1JF5A 1XIWB 2DJ4A 4OZGE 4LMQI 1Y6MR 5A2IH 2DQIL 5K93A 5IMLB 4RDQG 2PW1B 4Z0XB 4Z76B 2MKWA 3TIEA 5JMOC 4TNWF 1I7TB 1VGEH 3ULSB 4CU7A 5AAWA 1ZWIB 5GGRA 5CIPB 3SDCB 1CD1B 5GGSA 4NNPH 1BBJB 2N1KA 4R2GD 1LK2B 1MLCA 2F53B 1X5GA 5I1JH 2B20A 2DWDB 4OD2A 3ILQC 3EYOB 1I8MB 1A3RL 3H3PH 4TTDC 4YE4L 3S5LG 3RVVC 1A3LH 3FTGB 2P5WE 4Y1AA 3ARRA 4OFPA 1B88A 5I1LB 1RZJL 5E6ID 1ZKAA 1EEQA 5I19H 3FONA 2XWBA 1BLNA 3LKQA 5LG1A 4QLRA 4ZPVA 3FB5B 1B90A 1ZA6B 2N4IA 3VFTA 4N90D 5L9DH 1QBAA 3OJMB 3DUUB 2Z91A 4A6YL 5CJXC 2EH8H 4JRXA 3PHQA 3IDYC 5F71A 3SDCD 4JFZH 2C5DC 1AO7A 3V6OC 1G9EA 4DJMA 3D39B 1U8MA 2R69L 3LKOA 1ZVHA 3RWCA 1YN7A 1CDYA 3U4EB 1B0RA 1CE6A 2EKSB 4M1GL 4PJHF 4MNQA 1JK8A 5GSRB 1DE4A 1DQQB 3T77A 4N9GB 1HYRC 3LN5A 5CD3A 3RIAK 5ANMB 4YHYC 1IVLA 4NRXB 1E6OL 2DLFH 4OLVL 3NBNA 2NY1B 4FZ8H 3IXAB 4ONFL 4YHMH 1DFBL 3T3ME 4NC1C 5GJTH 3DECA 1DJSA 1HSBB 4UQ3B 5JR1L 1OAXH 4LPVA 3H2WA 5D6CB 2VXTL 5F88B 1DBBL 5E24E 4ZXBC 3CXDH 4WJ5A 5CJ8A 1GIGH 4CVWA 3V52L 4LLVA 4EOWH 4J3XA 1F11A 3UO1L 4PGCB 4AEIH 2DYPB 4YO0B 1D9KB 2LU4A 4FOMA 1B3JA 1EGJH 3U1SL 35C8L 4QRPA 5E2WL 3UEZA 4ODHL 3WDJA 3MYJA 1N6QL 3QH3A 5CJ5A 3NA4A 3RJQB 4K7PH 5CUSL 4EVNA 5J06A 4N8VB 1TPXC 4ZUUA 5KAQF 2X4UB 3T2PA 4ZUVA 4WVRA 3SJVD 2NY1D 3S36X 5DMGC 3S6CA 4XP6H 1R24B 4K7PY 4DQOL 4XAKE 5DRNA 4F37K 3CPLB 3GMOA 5I8EB 4D0DB 3NCYS 1I7RB 4C4KO 3ALWA 3U0WL 4B5EA 3QNYA 2IH3A 4HHAA 1GSMA 4FMKA 3LB6C 4U1NA 4BZ2L 2X4PA 4PRBB 4S2SA 5IUSA 1EEYA 1OL0A 3D9AL 1QOKA 1QRNE 3KPSE 3SKUD 4P59H 1CGSH 4QGTA 1AIFB 4MWFA 2GJZB 3PWPE 5F9OL 4NQCB 3EO0A 1AGBB 3JTTA 2FJHA 4WFFE 4CMHC 5CEZH 3WMSA 5KSBA 3P0GB 3QEQE 4S1DD 3GMLA 1OAYH 1IL1A 5KVGH 1U8IA 1L7TH 5TDNA 1AY1L 1JHKH 2KQNA 5B38B 3LHPH 3U0TB 5D5MB 1WUNT 2GJ6A 3UTSD 4I0PD 2IFFH 4JO1L 5JIIA 4LF3A 3CDYA 3FFDA 3GZKA 1T20B 5EIVA 3QUXA 2CDEB 4JDVA 3BESR 3CX5K 4HS3A 1RUPL 3MLSL 3FT3A 4G8GB 3TA3A 4PP1D 4X6DF 5I73B 4GT7A 2DM3A 3IDGB 1KLFA 4KWUA 5DI8B 5ERWA 4M5ZL 2ZUVA 4QRUB 1HSAB 1J9CT 3NABL 1DQDL 1RHHA 5D7LA 1ZANL 4KY1H 2LE9A 5D1XA 4NQCD 2E3VA 3TYGH 1CR9H 3H9SA 3PF2A 2ZSVB 3VFPB 1A6UH 1MWAA 3V4UL 4Y4FC 1W0WA 2HJFA 4O2CB 4J6RH 4KROD 4HCRL 4BQ8A 3IFLL 3TFKC 2XN9B 1YECL 5I8OH 4Y1AE 1XR9B 5IWLA 4HBQA 2GITA 4HIJA 4N68A 4HC1H 5F3BA 1NPUA 1FV1A 2C3XA 5J12B 4RX4D 3D25B 1QR4A 1OTUC 1YNTB 2NY6D 1B4JH 1I1AC 3WN5C 4FQPA 5HHMB 5CKAA 2HMID 2MCPL 5GPRA 3NCJL 1IJ9A 1CD9B 4KKNA 4Z7QF 5CEYA 1AO7E 2FH6A 5DD5H 1VPOL 4MCZB 1J1XH 4Z7VA 3BZFA 5F7EH 1XCTA 1NUNB 4MNQE 3DTXA 4X6FA 5IM7B 4F7PA 3TCLA 1QEWA 1HE7A 4LAQL 5F6IB 3C08H 1QSEA 2QV2A 1QFHA 5D7IA 4GG6B 1WBZB 2FEEL 7FABH 3F7QA 1O5DT 3IFPA 3WUWB 4CDGC 1UEYA 5JQHC 4Z7WB 2YA2A 2D7QA 3LS5L 1J0KA 3MBXH 4RMVA 3RA7L 4XBEH 4D0DA 1C5CL 1D5IL 3MGOB 4MQ7A 3W2DL 3GSQA 4XXDA 1IM3A 3PGDB 4NBYB 1UM4L 5DFVC 1KT2A 1U6AH 4IEFB 3MYZA 3K81A 4YZFF 4P2RA 1IFHH 5IHUH 5GGVH 1UENA 5IW3A 1VEMA 4MXWH 1BREA 4QRPE 4ZOBA 4NFDA 3WLBB 4BK5A 2CDFB 4IRJC 3TVMC 4UTBH 3IDXH 4TUJA 3PL6B 3FQNB 1IILE 5GGVY 5C6PB 1ADQH 4ZODA 5FKAA 1X5FA 3L3DA 4KV5F 3RKPA 1JRHL 4M93C 4RAUA 2VQTA 4M03A 2VDNL 3PWNA 3QI9C 4YUEH 4XPHL 3HMXH 4M5YL 5FOBB 4XNMB 3O6FD 3WS3B 3RIFK 4PGDB 3BPOC 3HI1A 4R26H 4APQA 1FYTB 3TN0C 3BH8B 1J8HD 3ZTJH 2XICA 3BW9A 3QG7L 3R1GH 4IMLA 4NCC2 3GBLA 1DUZB 2EYSB 2AEWA 4OCLC 4TUKL 4D8PB 2UWEB 5I0DA 3O2VL 4Y5YB 4HLZG 3MGTA 3HR6A 1XF2A 5T3ZH 3NZHL 4D94A 4M3JA 4FQIH 2ZOLA 2BVQB 2HJKA 1NCTA 5KSBE 1MCBA 1H8SA 4A2LA 5F9AC 1CLYH 4NOBA 2IBZY 3HAEA 4G80B 1JTPA 3UJIL 1G7MB 3NCEB 4NUJB 3VA2C 5C70A 1HOCB 1CFNA 5EOCL 1WICA 1WF5A 2GJ6E 4Y19D 2A9NH 4HXBL 5I6XB 1FNGB 1X5IA 3WFEL 4LARH 1FYTD 5CBEB 2FL5B 3P4NA 4OAWA 1F3DJ 2NZ9D 3MLUH 3TPUB 3G6JA 4OIAA 2KPNA 2YXFA 1SJVA 5IVZA 1OLZA 2R0ZL 3MA7A 4RFOL 5JZ7C 4BUHA 3W11D 2YSSB 3O9WA 4OIBA 1M1SA 5F7NC 4OCYL 4R0LA 1KCSH 5C2BL 3QQ4B 2ITDA 5D7LE 2GEEA 1M7IA 4TQEL 5EORL 2Q86B 3I6LD 5JOEA 5MHSD 3H9SE 4X80L 1IZJA 2A6IB 5K59F 4AYFA 5I71C 1HHJB 5T33H 3UAJC 4OB5H 4V1DD 5AYUH 3LKPA 1GH7A 5AUMB 1CXIA 4LRIC 3CK0H 2BY1A 5CSZB 3NPSB 4NPYB 3T1WA 1U3JA 2YUXA 4K3EH 3Q1SL 2OL3H 5I30L 5CGYD 5C1MB 2DQUL 3F7VB 4JM2D 4CU6A 4PJGF 5FYKE 4MS8D 3VGDA 3PWUA 1JGLH 2ARWA 1RZGB 3NFPA 4I18C 5HDBF 1UH2A 2AEQH 1MHHA 1JI1A 1FPTH 5GRZA 4XVUD 4KVCL 4AQ1B 1GPOL 5EC1A 5DFTA 1YEFL 4U7KA 3B9KB 5DUPH 5GGUB 3ZDXE 1GYAA 2H6PA 2B1AL 3BKMH 3BWUC 4K3GA 4EIGB 1CDJA 1RIUH 4Z7VE 3V0WH 1H3WM 1HKLH 4ODWA 2OQJA 4FQXA 2D9QB 4KVNH 1ZT1A 3SEPA 2CD0A 1OF2B 2ZG3A 1XGUA 2Y07L 3K7UA 2UV3A 1C08B 1AE6H 2AI0L 2G60H 3WFCH 5JDSA 1BJ8A 2AJSH 1QSEE 1N0LA 3E3QC 1ZXQA 5FYJL 3VXMD 1HI6A 3EOTL 1KB5L 3EJYD 1NQBA 1WBXA 3MREB 1BMGA 1EA9C 1YJDH 2P8MB 2EE6A 3HPJA 1FDLH 4M7JH 4PLJC 3CC5A 4ZFFB 2MPAL 2F58L 1A1OA 2I5YH 2JJSC 1MHEB 5DUML 1KJ2B 3B9KD 3L3KA 4P49A 3DYOA 5C7XH 5HI3D 3MNWB 3B2VH 4P99A 5FUOH 1UWGL 5C09A 4XWGL 2OR8A 2MSPA 4HIHB 4WEUD 1BECA 4HUVB 2IMNA 2FSEB 1A6VL 4NQSB 4J3SA 3FQUB 5KBNC 4AL8L 2X89D 3WFDH 1QACA 3HZKA 4LFHG 3I3BA 2P5EB 1G6RA 5D7SL 1OP9A 3O3DB 2Y7QB 3ARPA 4LCWA 5DMIL 5GJSH 3GSOA 2H3NB 1MQ8A 2VDML 5F9DC 4GKZA 1HCFX 1PX3A 1VEOA 4LVHC 1MEXH 3VFGH 5KVEH 1P2CA 3I6GA 4WWKB 4HG4J 2FJGB 5DR5L 4PGEA 4JVUA 2FB4L 1GGYA 2CMRH 5I1CL 4XAWL 3KYAA 5FKPB 5T1LB 1YMMA 5DK0B 3WE6B 1U9KA 3LKRB 4YHIB 3CSYB 1SJHA 2FATH 1ZHKB 4PJFF 4MB5A 2YPLA 4ZG1A 1NCNA 5EO1B 3T2NH 3QQ4A 4G7YH 4L8BB 3F6LA 4AEHH 2E9WA 4K9EH 3FQRA 5GHWL 5KW9L 2V6HA 1CLCA 3ARGC 2P5ED 2CR3A 1S8DA 3T04D 1UM6L 2R2HA 3AU1B 4OUUA 2Q6WB 2PTUA 4R96B 5DD6A 3CDFA 2IBBA 3S88H 1M71A 2XN9E 4YWGL 5INCB 1NGYB 4OCNC 4L9LC 5E8NA 4LLQA 5J3HC 3ZTNL 3L5XH 2FX7L 3L1OH 1RIHH 1JPST 1RAMA 4XNQB 4QNPE 3Q5YA 3TBSA 1V5JA 4M6MH 3G6JE 1UM5L 2DQJH 2WNGA 3GMNB 1OWRM 3RIAF 1CQYA 3GB7A 3ZHKA 1LILA 5FF6B 3PWJA 2FD6L 4NIKB 1RZ8A 2BJML 3GSNA 5JMRA 2YKLL 3L3IA 5HHXL 4OQTA 4UIMA 3GNMH 1NH6A 1WISA 2K1MA 5BVPL 4GXVL 4OZHF 5FYLE 4FG6D 4XI5D 3ZKSD 4NM8H 4GG6E 1XR8A 1V8HA 5IB2B 1T7VA 5JW5B 3EAKA 4GAJL 3DVNA 4Z7WE 3UTQA 4PJCF 1IGJA 1J18A 3LEVL 2CPCA 2R0KH 1YEIL 3L5IA 3QEHA 1CLOL 1A64A 4U6YB 2ZUYA 5EWIH 2JF1A 1WIUA 2AEIT 1OSZB 5DJ0A 5E7FA 3REVB 1YJDC 5J13B 4DTGH 2I9LB 1X5HA 1FNSL 3VI3E 4G3YH 2X10A 1U8QA 3MODL 5KN5A 2H1PH 4LCIL 1X5ZA 3U46B 1DQTA 4F37F 3ZL4L 1H8OA 4MXVF 3UPCA 5ESAB 2K9UA 1DUYB 4IRZL 1X5JA 2DQFA 1MCIA 1LE5B 2UZIL 4EQ3A 1YEKL 3UJTL 3P0VH 3RNKB 4MA3B 2YEZA 5A2FA 1J5OL 2HKFH 5F1IB 1A7RL 2FZ3B 2VLLA 2FJGA 5ETUB 2I24N 3WXVL 1NBZA 8FABB 4H25B 3CAFA 4XP5L 1KN2L 4J4PD 5I18L 1Z3GH 4KMTH 1F58L 3QHFH 1AGFB 2P48B 4YDIL 4XPTH 4PJ5A 5F70A 3H9HB 1VACB 1LEIB 2PR4L 4G43A 2YD8A 2OJEB 1JI2A 5GIRA 5INDB 1KTDA 3TM6A 5JA9A 4U6VL 2HTKC 5DJXB 1AGDA 4OSUL 3BYYA 1J11A 3KR3H 2G75B 3TV3L 4BH8B 1TQBC 1FNLA 4AT6B 5KVFH 4P4KB 3SE8L 2W92A 4PV8A 3MRJA 2H8PA 4JN2B 4UILL 4K9EC 2IANA 2CK2A 2VXUL 3B6SB 4RBPK 3RWDA 1YC8A 1A47A 5DRWB 3BGMB 2EDDA 1AR2A 3BN9D 5DD1L 4YC2B 4PIRF 4CGTA 2MQCA 3KWWA 5IW1A 4EUPG 3V2AR 2WSKA 3A6CH 2YRLA 4KQ3L 1EMTL 4ONGL 2QKIA 4J2XA 2HFGL 4O02L 1FH5H 1YMME 1NC2B 4MNGB 1OTSC 5C0ND 4Q2ZB 4ZUWA 2WQ8A 5CHNB 5IMKB 3EGSA 5CZXC 3U4BH 3JWOL 5ISZA 2ATKA