2ADLA

Solution structure of the bacterial antitoxin ccda: implications for dna and toxin binding
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
72
structure length
72
Chain Sequence
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKVENQEGMVEVARFIEMNGSFADENKDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nucleic acid and toxin recognition of the bacterial antitoxin CcdA
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords CcdA
total genus 6
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07362 CcdA Post-segregation antitoxin CcdA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.80 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 2adlA01
2H3AA 2ADLA
chains in the Genus database with same CATH superfamily
2CA9A 1OHNA 2H1OE 1PARA 1Q16A 3SFUA 1EA4A 3NO7A 3VW4A 3SFGA 2K1OA 1SIWA 2KELA 2BJ1A 2K9IA 2CAJA 3BSOA 3H5YA 2JXIA 2JBVA 3UPFA 3NAIA 3H87C 2JXGA 3FMTA 4NRUA 2K5JA 2KKEA 4FXEA 4QPXA 1BAZA 2GPEA 4HV0A 3FT7A 3OD2A 2RBFA 3G5OA 1SH0A 2WVEA 2BJ8A 2BSQE 2CPGA 2Q2KA 2BNWA 1MYLA 1SH3A 2K29A 3VEBA 2WVFA 4LRVA 1ARQA 3H5XA 1P94A 1OG7A 3IR7A 2ADLA 2AY0A 3QOQA 4LQ3A 2HZAA 3BSNA 4LQ9A 2BNZA 4ME7E 2HZVA 2CKWA 1IRQA 2WK4A 1MNTA 4NRTA 2A2BA 3NAHA 1SH2A 3VEAA 3LGHA 4O4RA 3LJPA 4AAIA 1QTGA 2BJ3A 1B01A 3UR0A 1NLAA 2K6LA 1U9PA 3QIDA 1BDTA 4MJWA 2BA3A 3GXQA 1B28A 2WVCA 2AN7A 1X93A 3UQSA 1BDVA 2JXHA 2BJ9A 1ARRA 2CAXA 1MYKA 3NNEA 4D8JA 2KOEA 2UUWA 1Q5VA 2WVDA 2WVBA 2CADA 2BJ7A 2B43A 2UUTA 2H3AA
chains in the Genus database with same CATH topology
2CKWA 1OHNA 3G5OA 2WK4A 2AN7A 1Q16A 4NRTA 3SFUA 1SH0A 3NO7A 3UQSA 2A2BA 3SFGA 3NAHA 2Q2KA 1SH2A 1SH3A 4O4RA 3LJPA 1SIWA 4AAIA 4LRVA 3BSOA 3H5YA 3H5XA 3NNEA 2KOEA 3UR0A 1OG7A 3IR7A 2ADLA 2JBVA 2UUWA 3UPFA 4LQ3A 3NAIA 3BSNA 4LQ9A 4NRUA 3QIDA 2KKEA 2B43A 2UUTA 4QPXA 4MJWA 2H3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3A A;  2ADL A; 
#chains in the Genus database with same CATH topology
 2CA9 A;  1OHN A;  2H1O E;  1PAR A;  1Q16 A;  3SFU A;  1EA4 A;  3NO7 A;  3VW4 A;  3SFG A;  2K1O A;  1SIW A;  2KEL A;  2BJ1 A;  2K9I A;  2CAJ A;  3BSO A;  3H5Y A;  2JXI A;  2JBV A;  3UPF A;  3NAI A;  3H87 C;  2JXG A;  3FMT A;  4NRU A;  2K5J A;  2KKE A;  4FXE A;  4QPX A;  1BAZ A;  2GPE A;  4HV0 A;  3FT7 A;  3OD2 A;  2RBF A;  3G5O A;  1SH0 A;  2WVE A;  2BJ8 A;  2BSQ E;  2CPG A;  2Q2K A;  2BNW A;  1MYL A;  1SH3 A;  2K29 A;  3VEB A;  2WVF A;  4LRV A;  1ARQ A;  3H5X A;  1P94 A;  1OG7 A;  3IR7 A;  2ADL A;  2AY0 A;  3QOQ A;  4LQ3 A;  2HZA A;  3BSN A;  4LQ9 A;  2BNZ A;  4ME7 E;  2HZV A;  2CKW A;  1IRQ A;  2WK4 A;  1MNT A;  4NRT A;  2A2B A;  3NAH A;  1SH2 A;  3VEA A;  3LGH A;  4O4R A;  3LJP A;  4AAI A;  1QTG A;  2BJ3 A;  1B01 A;  3UR0 A;  1NLA A;  2K6L A;  1U9P A;  3QID A;  1BDT A;  4MJW A;  2BA3 A;  3GXQ A;  1B28 A;  2WVC A;  2AN7 A;  1X93 A;  3UQS A;  1BDV A;  2JXH A;  2BJ9 A;  1ARR A;  2CAX A;  1MYK A;  3NNE A;  4D8J A;  2KOE A;  2UUW A;  1Q5V A;  2WVD A;  2WVB A;  2CAD A;  2BJ7 A;  2B43 A;  2UUT A;  2H3A A; 
#chains in the Genus database with same CATH homology
 2CKW A;  1OHN A;  3G5O A;  2WK4 A;  2AN7 A;  1Q16 A;  4NRT A;  3SFU A;  1SH0 A;  3NO7 A;  3UQS A;  2A2B A;  3SFG A;  3NAH A;  2Q2K A;  1SH2 A;  1SH3 A;  4O4R A;  3LJP A;  1SIW A;  4AAI A;  4LRV A;  3BSO A;  3H5Y A;  3H5X A;  3NNE A;  2KOE A;  3UR0 A;  1OG7 A;  3IR7 A;  2ADL A;  2JBV A;  2UUW A;  3UPF A;  4LQ3 A;  3NAI A;  3BSN A;  4LQ9 A;  4NRU A;  3QID A;  2KKE A;  2B43 A;  2UUT A;  4QPX A;  4MJW A;  2H3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...