2ADPA

Nitrated human manganese superoxide dismutase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
196
structure length
195
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Crystal structure of nitrated human manganese superoxide dismutase: mechanism of inactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 70
structure length 195
sequence length 196
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2adpA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2adpA02
1XREA 1D5NA 4FFKA 1BSMA 1PM9A 1SZXA 1AP6A 1GN6A 1VARA 1PL4A 2RCVA 1BS3A 2GDSA 1WB8A 1ZLZA 1GN2A 3TJTA 1JR9A 1EN4A 2QKCA 3CEIA 2CDYA 3MDSA 4JZGA 1GN3A 5A9GA 3OT7A 4YIPA 1ZTEA 4JYYA 1EN6A 1I08A 1XILA 3DC6A 1LUWA 3BFRA 1IX9A 3AK3A 5AG2A 1ZSPA 3RN4A 4GUNA 4C7UA 1IDSA 1VEWA 3QVNA 2AW9A 4F6EA 2CE4A 3K9SA 1I0HA 1IXBA 2ADPA 3AK1A 3EVKA 4BR6A 1B06A 1LUVA 1MA1A 1P7GA 1QNMA 3AK2A 1N0NA 1Y67A 1XUQA 1AR5A 1JA8A 3C3TA 3C3SA 1N0JA 1XDCA 3IC9A 1ZUQA 2P4KA 1AP5A 1EM1A 1BT8A 4X9QA 4YIOA 1MMMA 2ADQB 3DC5A 1AVMA 4E4EA 1EN5A 1KKCA 1MSDA 3KKYA 1GN4A 1MNGA 4JZ2A 1WB7A 3LSUA 2QKAA 1AR4A
chains in the Genus database with same CATH superfamily
1WA8B 4L87A 2KQXA 2OIGA 1GN6A 4XDJA 3AG3C 2JRIA 4X88A 2ZIMA 4JI2B 4HYOA 1JR9A 1GN3A 1XHZA 4B3TB 5B1BC 3OD4A 4JYYA 3J81N 2PYJA 3LDDA 1K92A 3H1JH 3JASB 1SRYA 5KA6A 4O4HB 4LFCB 4I4TA 3I55V 3ZHTA 4JI2O 2E5LB 3A0RA 3ZIAG 5CBHA 1BQ0A 4U7OA 4B3TO 1JJ2U 2QWOB 3OAAG 2QM4A 4PDVA 4WFHA 5HFLA 2CUGA 2YEVA 2N74A 5L3FA 1OV9A 3F7VC 4LFCO 1QR8A 1GO3F 1WN7A 2E5LO 2NN4A 2QKSA 4H37A 3STZC 1Q7YW 3ZN1A 3DTUB 2RN9A 3G6EV 3RYHB 3IFXA 2JS5A 3JARA 3Q4HB 1D2DA 4D6TH 2VWKA 4ZHQA 1KKDA 4DR2B 4OX9B 1BZKA 3K0DA 2P22C 3IGAC 1R6TA 4PJ0Z 3BHPA 3K5NA 3L73H 4GX1A 4JZ2A 3OMIB 1DGSA 4QNHB 2D3OW 4DR2O 4X8AA 3DXRB 4OX9O 5B1NA 3BABA 3ETDA 4G2KA 1PNMA 4AILC 3OGIB 3NXSA 3CC4V 1AI6A 3EFFK 2QKCA 3KCYA 2YS8A 2K1EA 5IY5B 3RFRA 4HZ3A 2CTWA 1J5EB 3UKMA 3ZCCA 1NR1A 3PN1A 1K34A 2JGDA 3I5DA 1W2BU 3ETQA 2ZR3A 1GTOA 1F23A 3ZS8C 2DJVA 4JASA 3AG4C 1AR1B 1NVPD 3PJSK 2WLKA 3N2KB 1S76D 1YJNV 2GUZA 4LF5B 1NI8A 1IXBA 4Z2WA 1J5EO 2HFEC 4K3AA 1G6UA 1M57B 5KX5B 1HP8A 5FPRA 4H0LB 1EBOA 1MA1A 1VQOV 2Q68A 2MK3A 4YHHB 1VF5B 2DW4A 5EYPA 4OPHA 1KP2A 1RPRA 2Q7EA 3HKEB 2CH7B 4LF5O 2RDCA 2Y69B 3RWRD 1SQFA 4BIOA 4FZ0A 1ROPA 4DV4B 5FNVB 2EINC 1VQ7V 1OCZB 2QM7A 4JI5B 4DUZB 1NJIW 5J2UB 1TUBB 4YHHO 1Y6XA 4JAVA 1YTFB 2PY5A 3TK1A 4B7EA 3U10A 3T1YB 5LHGA 2VQFB 5GTHZ 4J10A 3OR7C 4JAAA 4NYKA 1Y74A 4DV4O 2YXYA 5EBLC 4PELA 2Z0AA 4X64B 3LSUA 4MVSA 4JI5O 4DUZO 1SQVH 3FB5C 1VP7A 1IXMA 5LOVA 1N33B 1AI5A 3AG2B 2IJJA 3VQYA 3TETA 1Y76B 3E8BA 4DRXA 3T1YO 3E86A 4I55A 1FAFA 2VQFO 4XBFA 4W4KA 2XHBA 1NQTA 1R3LC 1VQ5V 1AJPA 4X64O 2H94A 3OM3B 3T1CA 1WA8A 4FLXA 1L1FA 2DMXA 1S72V 1N33O 3F5WC 1BMFG 2IW5A 2ZDIC 3OW2U 2A9HA 4O4IB 4H13B 4BW9A 1DTOA 3BA9A 2W0XA 3SPCA 1I5YA 2AZ2A 2BOCC 4EFBA 4D7SA 4A5UB 4GUNA 3U11A 3JCUZ 1OZ0A 4FLZA 3P32A 1BQZA 5IWAB 2HVKC 4HBNA 2VS0A 2IM9A 3JASA 1M4UA 1LUVA 3AK2A 3SJQC 4CH6A 3IAYA 2QEXV 1Y67A 3E8GA 1RSOB 3U0ZA 1BL8A 1XUQA 4FLTA 4IHJB 1R1BA 1XDCA 1EZJA 3CPWU 5IWAO 1KUQA 5LXTB 2E74B 2E75B 2QGNA 4JPRA 5CBGA 4FLUA 2P5OA 4NTWA 4X9QA 1JNBA 2NLJC 4MTGA 3LNNA 5H2FZ 1QQCA 4KL1A 2EIJB 1VQLV 2ZINA 1P49A 3DC5A 1KECA 3OE7G 1VQ4V 5CN0A 1LNQA 1OCOB 5K1PA 1JPXA 3RYHA 4BR6A 4L8JA 5IY5C 4MVMA 3OFNG 1XNQB 3ZRXA 1PM9A 4O2BB 1GAXA 4O2AB 1BS3A 1H8HG 2JVDA 1GN2A 3B2EE 1QLEB 4WFGA 4LFAB 4MW8A 4IYHA 1VQ9V 2CDYA 1KB9F 3OT7A 5BXZA 1EZVH 4DO2A 1TA8A 1XNQO 2QJ1A 1RM1B 2WLLB 3BAAA 1M57C 3S3XA 4JGSA 1P7BA 3E8HA 1WPBA 3GWKC 4LFAO 2LP7A 2DN9A 2Q69A 4X1YB 4U7NA 2UXDB 4U3JB 4B3MB 3IC7A 1Z5WA 3SR2C 5JWPA 3A8TA 3QO5A 2Y69C 2YIDA 2Y4TA 4ABMA 1AI7A 2A0LA 1P7GA 1OCZC 3CXHF 4YXWG 2L6LA 2EBOA 4GYCB 5IT9N 2UXDO 4X1KA 3HPLC 3N2KA 5H9CA 1Y66A 2IH1C 3ZN0A 3STLC 5LP6B 1BT8A 1M5IA 5JVDB 2LW7A 1JVMA 3UCSC 2QTSA 5KX5A 4Z1MG 4DV1B 2Q7GA 5ITZB 2KG7B 4FJCC 3CXCU 3OEEG 3AG2C 2OTLV 3WFVA 1QCEA 4X1IB 5KLVH 1NS1A 2CH7A 3ETEA 4CC5A 3FB8C 4PA4A 1XMQB 5FNVA 4R50A 1DLBA 5J2UA 4PHZA 4DV1O 3HKBB 1BSMA 2PF4E 3ZRVA 1AP6A 5B66Z 4ZI7B 1S77D 3JD2A 3TXSA 1K33A 4RWUA 4U3FH 4GX2A 3FFQA 3ABMB 4UCSA 1FKAO 2IH3C 4J7JA 4JF3A 5BR8B 1VQ8V 1GK9A 1XMQO 2V7QG 1L8DA 5C93A 3SJCC 3MDSA 3J7AU 4DR3O 2ILMA 2ETNA 2HJFC 2WA3A 2WLJA 1AI4A 1QLNA 3HKCB 5FLXN 3H01A 4LWSB 1H2GA 5EZYA 5D5PA 1I7FA 1Y76A 4DR1B 3JATB 5GTIZ 1SERA 2YI9A 2AHZA 1YHQV 5LHHA 5BR8O 4UV8A 1W59A 4YJ3B 1NVPB 2PYLA 1ZX3A 1U96A 4F6EA 2XNDG 1H38A 1VQNV 3CCEV 1PKXA 2WAMA 4DR1O 1CPYA 1SA0A 2OCHA 3K03A 1NT2B 4O4IA 2Q9LA 4QPKA 2FMLA 4HAMA 4UVCA 2K9PA 2Q0AA 1KYOF 2C2AA 3C3SA 4AQYB 4I50B 2EIJC 1H2SB 2FL4A 4UCRA 4UCTA 5LBQA 3LSSA 4P9PA 4TQFA 5KA5A 1AP5A 1EM1A 1OCOC 3OR6C 2JGUA 1YJWV 1E1RG 1U97A 2N04A 2JK5C 2YSUB 2YXHA 4J7KA 3K58A 2ADQB 1RSOA 3ZMVA 4X65B 1KBHA 5EC1C 4AQYO 1BCCH 4F6RA 2Q4PA 1HDJA 3E2EA 1KKCA 5EBMC 3BA8A 2JDIG 2PI4A 2DWDC 5LXTA 1M56B 1QLEC 3JD3A 4PA9A 4MW3A 4CH4A 4NB5A 4WFAV 4J42A 5LA6B 3L9DA 4X65O 1IBLB 3CCQV 1RM1C 2WSSG 1H5WA 2XAHA 4YJ2B 4O4LB 4WFBV 4JI8B 4B3SB 3L70H 2P67A 5JH7A 3D8CA 1OCRB 3FD9A 5B1AB 3ZX6A 2LGWA 1K4DC 5A9GA 1S3JA 5KAFZ 3APOA 4TUYA 3WB2A 1SQGA 1IBLO 2GSMB 4UB6Z 5EK0A 2FYUH 4O2AA 1B6QA 4JI8O 4B3SO 1V9PA 4TOIA 4GZRB 3K5OA 3ABUA 2WLLA 4BIUA 5JQGB 3BEHA 1AJQA 5LP6C 1M9NA 2L35A 2F43G 3K06A 4KFMA 3K57A 1E79G 4PA6A 2Q5ZA 3G4SV 4UCUA 2PI5A 4MVZA 1CEZA 3IC9A 2RMKB 4X1YA 4TV9B 1D5AA 5IYZB 2EJRA 1Q82W 1XI1A 2Q6AA 1NH2D 2XASA 3OUFA 4FM2A 2QWQB 1R3KC 3MD0A 1VMGA 1S5JA 3K04A 2H3OA 2YIBD 2LO1A 4I7ZB 3RYCB 4P30A 3CRMA 5H6QA 2ZR2A 2ZE7A 3ABMC 1YJ9V 3SYOA 5JVDA 2EULA 3RYIB 1HNXB 1G8MA 5J2TB 3N2GB 4JV5B 2F4VB 3MHHC 3BRCA 4DXWA 3JAKB 1B04A 4FFKA 5ITZA 2KG7A 1TVKB 2BTQB 4MVUA 3CCSV 1LR1A 2RCVA 4X1IA 5JJEB 4KXRA 2CTRA 2IBZH 2ZD9A 1QVFU 1L0NH 2Q67A 4FIPC 4WFFA 1FXHA 1HNXO 3AEIA 4JV5O 2EIMB 2F4VO 2UXCB 4PDRA 3G80A 2X6AA 3HKBA 4JTAB 4IIJB 4FLVA 4ZI7A 1V54B 2RQ6A 4AI8A 5B5EZ 1SZTA 4F4LA 4NTXA 3ZMSA 2QR4A 3VQXA 3AG1B 2GV9A 1TAEA 1BHAA 1IDSA 2BSKB 4CH3A 5CA3A 2UXCO 1FXKB 3FAVB 3RYFA 4LWSA 3RGBA 3JATA 4DR6B 3ABTA 3B09A 4TWKA 3KDRA 3DGEA 1BGYH 5IE9A 2KB1A 3OTFA 3CCMV 1I5XA 1HNWB 5IJ9B 2DE0X 4GX0A 3UQ8A 5JJJB 2XAJA 3RVYA 3HKDB 3FYIB 4DK1A 4CH5A 1JX9A 4RQFA 4I9QA 1M56C 4DR6O 2YDEA 1AROP 3CCVV 3K59A 2QWRB 4JI3B 3KG2A 4ZOLB 3ZRSA 2ITDC 4DR7B 1HNWO 4I50A 1O9GA 2CTPA 3ASNB 3T4DA 5D5QA 1OCRC 1GKFA 5CMUA 5B1AC 1EN4A 4KP4A 3JD1A 3ICXA 4JI3O 1XREA 1D5NA 3G71V 4DR7O 3NR7A 1X59A 2HR3A 2CAZC 2NNUA 3HB3B 4OPAA 3K3WA 1R6NA 1YI2V 3QTCA 1K3EA 5KHJA 4JI0B 5KAIZ 3ZMUA 3B8MA 2F93B 2W6JG 4Z1VA 3RW0A 1YSCA 5BMVB 3DC6A 3MHSC 4MVOA 2AZ0A 1VQKV 3AK3A 4EB6B 4JI0O 2A79B 3QVNA 3RVZA 2DYSB 3I56V 4LNUB 3LUTB 3K9SA 1KQSU 3D3QA 4GCZA 2R70A 5EC2C 2WPDG 1SQQH 3ETGA 5LGNA 1VF7A 5DECA 4JAUA 3C3TA 3L74H 2ZQMA 3R65A 2PZSA 1NR7A 1US6A 1V55B 1UJWB 3ZHVA 2ZNJA 2B1IA 3JSLA 1X4TA 1VQMV 5JQGA 4J11A 3ABLB 4J7ZA 1G4YB 2QWPB 4LP8A 1FYJA 4DV0B 4O4HA 3K08A 5LL6Y 3ZRWB 3JD0A 3SPHA 2IJHA 1AVMA 2QWNB 2Q73A 1BHBA 4MT8A 4TV9A 5IYZA 5IYCO 2ZIOA 1MNGA 5LMUB 2A06H 3JSNA 2YICA 3CRCA 4RQEA 4DV0O 1Q43A 2ZDIA 2IJKA 2EIMC 2ZE5A 2KSDA 2HEPA 2QM8A 2UUCB 2RJZA 4DW0A 2JS3A 1V54C 5BZBA 1N32B 4FVMA 1PNLA 1WB8A 2BE3A 5LMUO 5JCOC 4EEQA 2UXXA 3SYQA 2DYRB 3RYIA 5J2TA 1UFIA 3AG1C 3N2GA 3JAKA 3Q4HA 1FXKC 1CXZB 2Y48A 2UUCO 3FB7C 4XDKA 1IURA 1XHXA 1N32O 1B3QA 2W6IG 5LHIA 2CGNA 3H1KH 2UXNA 1R73A 1SF9A 4LF7B 3B4SA 2CK3G 1RFYA 4C7UA 3ZBHA 2ZKOA 1DF4A 1E1QG 1QR9A 5JJNB 1RPOA 2F66C 1W0JG 1S5HC 4B7KA 2QDOA 5KMGB 4IIJA 2EZPA 4R8CA 1N8RW 1YVWA 3CWBH 3DXRA 4LF8B 1SESA 1AB3A 1YEWA 5JCOA 2OYQA 4JI7B 1Q3EA 4LF7O 1ZWIC 2FKXA 4N21A 2WA4A 2OCCB 5CA0B 2BSKA 2XUMA 1FXKA 2LFSA 3L71H 4LC1A 2A3QA 1NH2B 1QHTA 4CC6A 4LF8O 1SQXH 5FPOA 4DW1A 1AILA 4JI7O 3P3NA 1PV0A 3ZEDA 3D36C 1K7DA 3HKDA 4CS3A 1GM9A 4B3MO 1M90W 1MOFA 1P84F 4DV3B 4FM1A 1N34B 4ZOLA 4UB8Z 4I9WA 1SZXA 2Q0OC 1WLEA 3SPJA 3L75H 3QO8A 3A0HZ 1VQ6V 1ZLZA 4JYCA 3ML0A 4UCOA 3SJAC 3HKEA 1WNSA 2UU9B 3CEIA 4DV3O 3E35A 5DM6V 4PD4F 4Q20A 2DYSC 4N23A 2OT5A 4MVQA 3ZHSA 4FLYA 2F95B 3B8NA 3ZMTA 1TUBA 1EN6A 1KP3A 3CHXA 2ZE8A 4G28B 3ZHUA 4ZKIA 2AGAA 4ZHQB 4LFBB 4X62B 1LUWA 3LDEA 2R9IA 3WU2Z 5C8YB 3CCUV 4AHCA 1UPGA 2EJ7A 1OJHA 2UU9O 4KUMA 4RAIA 1M1KW 1Z2GA 1V55C 2ODMA 4JYBA 2Q7HA 4LFBO 3ABLC 4PDLA 4X62O 4H33A 1DF5A 1YTFD 3O9OA 2RNBA 1KC8W 4PA7A 2ZT9B 4JI6B 3CRQA 5IJ0B 4CS4A 3SYCA 5F2VO 2F23A 1XL6A 2HVJC 4X66B 4OXSA 2WLIB 2R72A 3OMNB 1K4CC 1MZEA 4E4EA 2IU0A 1EN5A 1MSDA 1FS0G 1KD1W 5BY1A 4LCUC 4K0KB 5J9PC 4CZZA 4JI6O 1IBKB 2NR5A 2DYRC 2GUZB 2QKAA 5LMNB 2M6YA 4X66O 3JCZA 2IU3A 4CS2A 3ZRWA 2XAFA 1NU1H 5IYBO 3E8FA 4IHJA 2WWWA 5KHIA 3R66A 3E22B 4XDLA 4K0KO 1GRJA 1H2KA 1YCIA 1Q8IA 3RBZA 1IBKO 3CSXA 4TV8B 5LMNO 4LF4B 1PPJH 1Q6IA 5H5NA 1S5LZ 2JEXA 1J95A 3M7MX 3BFRA 2KKWA 1NBMG 2BTOA 3L72H 3T2MA 4G27B 1VEWA 3GWOA 1VF6C 2AW9A 4LF4O 2OCCC 1Q81W 4RUEA 2IJIA 3JAWB 4WFEA 4LF6B 4IGGA 1B06A 1K97A 3W7SA 4O2BA 1HNZB 2WLMA 1N0NA 2E76B 3H1HH 4DRXB 3FYEB 1SS3A 3THOA 4I55B 3BVOA 4TT3G 4ZIBA 2LQTA 3ASOB 2OIEA 2P90A 1XNRB 5KMGA 4LF6O 1TGOA 2QE7G 4O4JB 1HNZO 3WG7B 4TSFG 3FX7A 1R3JC 1CP9A 3M99B 4QJFB 2FB5A 4QIWF 4W4LA 5KHHA 5TISZ 1VF6A 3TGUH 3K0GA 5CA0A 1WPXA 3JALB 2ATKC 2QTOA 1XNRO 4UV9A 4UVBA 3K5MA 3K5LA 4UCVA 4U3JA 4B3RB 1K5QA 5KUKA 5EIBD 1AR4A 1FFXB 3CMEV 2P06A 3J80N 4MSWC 1SQPH 2YIBA 2BCCH 3KZIZ 4J9ZB 2MW2B 3SYPA 5CA1B 1Q5OA 2CTQA 5LGUA 2GDSA 4IT5A 2CGOA 4FM0A 4B3RO 3TJTA 1Z5VA 1XQ8A 3SDLA 5LP6A 3O65A 1HWYA 4J9YB 1WP7A 4ICGA 1R6KA 5IYDO 3W7XA 2EIKB 2E3CA 1I08A 1XILA 1F7YA 4FK5C 1WAZA 1VQPV 4CBCA 2PTMA 1G1XB 5LYJB 3LDCA 3K79A 4X20B 4MTFA 1PL0A 4I0XB 2CE4A 1M93A 1MZFA 1I0HA 2HG5C 4DV7B 4FLWA 2WLHA 2ARHA 2GBOA 4QE9A 3P3PA 5C8YA 3BY6A 4RUFA 1AR5A 1XBLA 4EKWA 5B3SB 1ZAUA 2X7RB 3OGCC 4NTYA 2XTAA 1ZL8B 2BOBC 1MABG 5E1AC 1IBMB 1MSWD 2Q8VA 4DV7O 4TQDA 2JJ2G 4ZBMA 1A32A 3HKCA 3UM7A 1F4MA 3G6BA 2XT9A 2EILB 2HP8A 2UUAB 3OTOB 4YJ3A 1T5EA 1K5SA 1HW7A 1IBMO 3FB6C 1GN4A 3CRAA 4MTXA 4NVPA 3M8AA 3LSQA 1IZ3A 5IJ0A 1F51A 2ZXWB 2Y0IA 4WBNB 4DV6B 2PGGA 3HR0A 3BPZA 2WLIA 2FTKA 2UUAO 2X6BA 3OUSA 3OTOO 4UVAA 1JQ0A 1F4NA 2B5UA 1NTMH 4PI2A 4D7TA 4X1KB 4JZGA 4DV6O 2P6JA 1W0KG 3A2FA 3W7TA 4I5SA 3MAQA 1KU9A 4H44B 4QGPA 2LW1A 3E22A 3VQVA 2HJDA 1XEQA 2B1GA 4BWAA 1QU7A 4TV8A 3ASOC 1N36B 1SQBH 5FL7G 3QG5A 5LA6A 2UUBB 2HLDG 5KHGA 4K35A 3EVKA 1ENVA 3CYOA 4UFZA 3UT5B 4YJ2A 3WG7C 4O4LA 4NXNB 1R3IC 3VQWA 4R6ZA 3ZMZA 1N36O 4DUYB 1COWG 1SC5B 2Z5UA 1K9MW 2UUBO 4K8ZA 3JAWA 5L3EA 2GTSA 2YIAA 4IL6Z 2ZM6B 2QA4V 1XMOB 4YIOA 5IDJA 5KUMA 2N05A 3CCLV 1JOYA 1WP8A 4NXNO 5EZYB 1WJZA 1TUEB 4NKGB 4DUYO 2F1MA 2B9ZA 4Q6GA 5DEDA 4JI4B 2H8PC 2ZM6O 1XMOO 4FPPA 3CD6V 1FPOA 4O4JA 2JJ1G 1ORQC 1Q86W 5CB4B 1SA0B 2XOKG 5L3BA 2ITCC 3GVMA 2VWJA 1PL4A 3B77A 1FJGB 2EIKC 4FFBB 1JMKC 1IVSA 3JALA 3C90A 3X2QB 5KHKA 3ZJZA 4GKKB 1YDXA 3E83A 4X89A 3VBBA 4JI4O 3ZHQA 1FFTB 3QF7A 4MTOA 2P4VA 4UUJC 1OCCB 4J80A 4YIPA 1FFXA 4J41A 1GM8A 4DR4B 1AJNA 4MS2A 1DK1A 2EZOA 1FXVA 5CA1A 3QO7A 2Y4UA 3SPGA 1FJGO 3CC2V 4MVRA 4LH7A 5DN6G 4GKKO 3RYCA 1K8AW 4ASUG 4F6RB 5B3SC 1H2NA 5AG2A 3F5TA 3IJ4A 3E89A 2DOSA 3RN4A 1N4CA 4IYIA 4DR4O 4HNAB 3CJHB 3RT3C 1XOUA 4WF9V 1JFFB 4KHPB 1PNKA 1Q6UA 2ZNIA 1TVKA 2BTQA 5L3GA 5LYJA 2EILC 5GONB 4X20A 2LJ2A 1ZUQA 5JH7B 1YZBA 3BCCH 2HHHB 4I0XA 2P4KA 3S3WA 4PI0A 4GX5A 2WLNA 4KHPO 4TUYB 4B08A 2ZXWC 2VQEB 4P2ZA 1MG1A 2VRZA 5EBWC 2P7TC 1I94B 1GH6A 1H2MA 3CC7V 1ZL8A 2HHHO 1NTZH 4JTCB 5B1OA 2R9RB 4PV1B 5K1XA 3JAMN 3FAVA 3P30A 3SGIA 3CX5F 2EX3A 3ASNC 3CP1A 1Y4MA 1FD9A 2JEUA 2VQEO 4EFEA 3ABKB 2W0FC 2ZCEA 4JTDB 4OGQB 1SETA 1VARA 4UXNA 3SPIA 1I94O 5IJ9A 4I4TB 2DQ0A 4GLXA 3W7UA 4DYLA 4LF9B 4WBNA 2XAGA 1ZTEA 3CCRV 1JJOA 3T1HB 4NXMB 2X6CA 4LR3A 4GKJB 2YEVB 2O57A 3AG3B 1QVGU 3SJBC 5LGTA 4PA3A 4QPJA 1IX9A 2YI8A 2OTJV 1ZSPA 4LF9O 2DWEC 5B1BB 3T1HO 2ADPA 4NXMO 3UO2A 1O9HA 3SYAA 1N34O 4GKJO 3DSQA 1Q90D 3K9AA 3JARB 3TXQA 1EFRG 4FMTA 3D36A 2A7WA 1S0VA 1QNMA 4NR1A 4BAYA 1JA8A 1NZ6A 4DK0A 3WB0A 2YUAA 3CRRA 5H6RA 3QNEA 2G38A 2DQ3A 4GT1A 4E2LA 4K8XA 4DR3B 1KMIZ 3G67A 3OMAB 5CBFA 2YXLA 3UT5A 5BMVA 3A0BZ 3N27A 1BE3H 4P9OA 5L3CA 1VIBA 4LH6A 4EB6A 3CB2A 1Q6HA 2LGQA 3KKYA 3X2QC 3AG7A 4BIZA 3T4ZA 4LNUA 1HR0B 5A2QN 3JYCA 4BW5A 4RO2A 3RYFB 3W7WA 2HKOA 4DV2B 1YIJV 1OCCC 5GW7A 3FKSG 4YY3B 3H9VA 1NKDA 3ZHRA 3B40A 2YC0A 2M7WA 3UO3A 3D3IA 1GM7A 5L3DA 2JGDB 2XAQA 4JI1B 1QBZA 3LNMB 1XL4A 4R7CA 1HR0O 5E79Z 3EHBB 1YF2A 3H1LH 1YITV 3EXAA 4DV2O 2JIZG 3VOUA 5CB4A 4YY3O 1RP3B 3WB1A 2AXTZ 2Y0PA 2QSAA 2PUSA 4DV5B 4FFBA 4JI1O 4QE7A 3TCUA 2R9AA 2X0LA 2Z3YA 3OEHG 4JYAB 1GMGA 1P4RA 5EYPB 1IJGA 4PDMA 2OWOA 5HFMA 3CE2A 1FOUA 3CCJV 3CS5A 3AK1A 1NTKH 2UXBB 2V1DA 4DV5O 2LFRA 1H2LA 4WCEV 2AHYA 1H8EG 1PP9H 4JYAO 3AG4B 1N0JA 2ZE6A 3KCXA 4HNAA 4DR5B 3CMAV 1JCHA 3CJHA 2V4DA 4FZ1A 1Y74B 1JFFA 2UXBO 2GTAA 3APQA 1L0LH 5EIBC 1URFA 1MMMA 5LOVB 4LBEC 1PD3A 3JD4A 3ABKC 5GONA 1OHHG 1THZA 2GHYA 3H1IH 1YXBA 3GB7C 3F7YC 4DR5O 2EINB 2D2CB 1K73W 1WB7A 1SKVA
chains in the Genus database with same CATH topology
1XREA 1D5NA 4FFKA 1BSMA 1PM9A 1SZXA 1AP6A 1GN6A 1VARA 1PL4A 2RCVA 1BS3A 2GDSA 1WB8A 1ZLZA 1GN2A 3TJTA 1JR9A 1EN4A 2QKCA 3CEIA 2CDYA 3MDSA 4JZGA 1GN3A 5A9GA 3OT7A 4YIPA 1ZTEA 4JYYA 1EN6A 1I08A 1XILA 3DC6A 1LUWA 3BFRA 1IX9A 3AK3A 5AG2A 1ZSPA 3RN4A 4GUNA 4C7UA 1IDSA 1VEWA 3QVNA 2AW9A 4F6EA 2CE4A 3K9SA 1I0HA 1IXBA 2ADPA 3AK1A 3EVKA 4BR6A 1B06A 3KDRA 1LUVA 1MA1A 1P7GA 1QNMA 3AK2A 1N0NA 1Y67A 1XUQA 1AR5A 1JA8A 3C3TA 3C3SA 1N0JA 1XDCA 3IC9A 1ZUQA 2P4KA 1AP5A 1EM1A 1BT8A 4X9QA 4YIOA 1MMMA 2ADQB 3DC5A 1AVMA 4E4EA 1EN5A 1KKCA 1MSDA 3KKYA 1GN4A 1MNGA 4JZ2A 1WB7A 3LSUA 2QKAA 1AR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRE A;  1D5N A;  4FFK A;  1BSM A;  1PM9 A;  1SZX A;  1AP6 A;  1GN6 A;  1VAR A;  1PL4 A;  2RCV A;  1BS3 A;  2GDS A;  1WB8 A;  1ZLZ A;  1GN2 A;  3TJT A;  1JR9 A;  1EN4 A;  2QKC A;  3CEI A;  2CDY A;  3MDS A;  4JZG A;  1GN3 A;  5A9G A;  3OT7 A;  4YIP A;  1ZTE A;  4JYY A;  1EN6 A;  1I08 A;  1XIL A;  3DC6 A;  1LUW A;  3BFR A;  1IX9 A;  3AK3 A;  5AG2 A;  1ZSP A;  3RN4 A;  4GUN A;  4C7U A;  1IDS A;  1VEW A;  3QVN A;  2AW9 A;  4F6E A;  2CE4 A;  3K9S A;  1I0H A;  1IXB A;  2ADP A;  3AK1 A;  3EVK A;  4BR6 A;  1B06 A;  1LUV A;  1MA1 A;  1P7G A;  1QNM A;  3AK2 A;  1N0N A;  1Y67 A;  1XUQ A;  1AR5 A;  1JA8 A;  3C3T A;  3C3S A;  1N0J A;  1XDC A;  3IC9 A;  1ZUQ A;  2P4K A;  1AP5 A;  1EM1 A;  1BT8 A;  4X9Q A;  4YIO A;  1MMM A;  2ADQ B;  3DC5 A;  1AVM A;  4E4E A;  1EN5 A;  1KKC A;  1MSD A;  3KKY A;  1GN4 A;  1MNG A;  4JZ2 A;  1WB7 A;  3LSU A;  2QKA A;  1AR4 A; 
#chains in the Genus database with same CATH topology
 1WA8 B;  4L87 A;  2KQX A;  2OIG A;  1GN6 A;  4XDJ A;  3AG3 C;  2JRI A;  4X88 A;  2ZIM A;  4JI2 B;  4HYO A;  1JR9 A;  1GN3 A;  1XHZ A;  4B3T B;  5B1B C;  3OD4 A;  4JYY A;  3J81 N;  2PYJ A;  3LDD A;  1K92 A;  3H1J H;  3JAS B;  1SRY A;  5KA6 A;  4O4H B;  4LFC B;  4I4T A;  3I55 V;  3ZHT A;  4JI2 O;  2E5L B;  3A0R A;  3ZIA G;  5CBH A;  1BQ0 A;  4U7O A;  4B3T O;  1JJ2 U;  2QWO B;  3OAA G;  2QM4 A;  4PDV A;  4WFH A;  5HFL A;  2CUG A;  2YEV A;  2N74 A;  5L3F A;  1OV9 A;  3F7V C;  4LFC O;  1QR8 A;  1GO3 F;  1WN7 A;  2E5L O;  2NN4 A;  2QKS A;  4H37 A;  3STZ C;  1Q7Y W;  3ZN1 A;  3DTU B;  2RN9 A;  3G6E V;  3RYH B;  3IFX A;  2JS5 A;  3JAR A;  3Q4H B;  1D2D A;  4D6T H;  2VWK A;  4ZHQ A;  1KKD A;  4DR2 B;  4OX9 B;  1BZK A;  3K0D A;  2P22 C;  3IGA C;  1R6T A;  4PJ0 Z;  3BHP A;  3K5N A;  3L73 H;  4GX1 A;  4JZ2 A;  3OMI B;  1DGS A;  4QNH B;  2D3O W;  4DR2 O;  4X8A A;  3DXR B;  4OX9 O;  5B1N A;  3BAB A;  3ETD A;  4G2K A;  1PNM A;  4AIL C;  3OGI B;  3NXS A;  3CC4 V;  1AI6 A;  3EFF K;  2QKC A;  3KCY A;  2YS8 A;  2K1E A;  5IY5 B;  3RFR A;  4HZ3 A;  2CTW A;  1J5E B;  3UKM A;  3ZCC A;  1NR1 A;  3PN1 A;  1K34 A;  2JGD A;  3I5D A;  1W2B U;  3ETQ A;  2ZR3 A;  1GTO A;  1F23 A;  3ZS8 C;  2DJV A;  4JAS A;  3AG4 C;  1AR1 B;  1NVP D;  3PJS K;  2WLK A;  3N2K B;  1S76 D;  1YJN V;  2GUZ A;  4LF5 B;  1NI8 A;  1IXB A;  4Z2W A;  1J5E O;  2HFE C;  4K3A A;  1G6U A;  1M57 B;  5KX5 B;  1HP8 A;  5FPR A;  4H0L B;  1EBO A;  1MA1 A;  1VQO V;  2Q68 A;  2MK3 A;  4YHH B;  1VF5 B;  2DW4 A;  5EYP A;  4OPH A;  1KP2 A;  1RPR A;  2Q7E A;  3HKE B;  2CH7 B;  4LF5 O;  2RDC A;  2Y69 B;  3RWR D;  1SQF A;  4BIO A;  4FZ0 A;  1ROP A;  4DV4 B;  5FNV B;  2EIN C;  1VQ7 V;  1OCZ B;  2QM7 A;  4JI5 B;  4DUZ B;  1NJI W;  5J2U B;  1TUB B;  4YHH O;  1Y6X A;  4JAV A;  1YTF B;  2PY5 A;  3TK1 A;  4B7E A;  3U10 A;  3T1Y B;  5LHG A;  2VQF B;  5GTH Z;  4J10 A;  3OR7 C;  4JAA A;  4NYK A;  1Y74 A;  4DV4 O;  2YXY A;  5EBL C;  4PEL A;  2Z0A A;  4X64 B;  3LSU A;  4MVS A;  4JI5 O;  4DUZ O;  1SQV H;  3FB5 C;  1VP7 A;  1IXM A;  5LOV A;  1N33 B;  1AI5 A;  3AG2 B;  2IJJ A;  3VQY A;  3TET A;  1Y76 B;  3E8B A;  4DRX A;  3T1Y O;  3E86 A;  4I55 A;  1FAF A;  2VQF O;  4XBF A;  4W4K A;  2XHB A;  1NQT A;  1R3L C;  1VQ5 V;  1AJP A;  4X64 O;  2H94 A;  3OM3 B;  3T1C A;  1WA8 A;  4FLX A;  1L1F A;  2DMX A;  1S72 V;  1N33 O;  3F5W C;  1BMF G;  2IW5 A;  2ZDI C;  3OW2 U;  2A9H A;  4O4I B;  4H13 B;  4BW9 A;  1DTO A;  3BA9 A;  2W0X A;  3SPC A;  1I5Y A;  2AZ2 A;  2BOC C;  4EFB A;  4D7S A;  4A5U B;  4GUN A;  3U11 A;  3JCU Z;  1OZ0 A;  4FLZ A;  3P32 A;  1BQZ A;  5IWA B;  2HVK C;  4HBN A;  2VS0 A;  2IM9 A;  3JAS A;  1M4U A;  1LUV A;  3AK2 A;  3SJQ C;  4CH6 A;  3IAY A;  2QEX V;  1Y67 A;  3E8G A;  1RSO B;  3U0Z A;  1BL8 A;  1XUQ A;  4FLT A;  4IHJ B;  1R1B A;  1XDC A;  1EZJ A;  3CPW U;  5IWA O;  1KUQ A;  5LXT B;  2E74 B;  2E75 B;  2QGN A;  4JPR A;  5CBG A;  4FLU A;  2P5O A;  4NTW A;  4X9Q A;  1JNB A;  2NLJ C;  4MTG A;  3LNN A;  5H2F Z;  1QQC A;  4KL1 A;  2EIJ B;  1VQL V;  2ZIN A;  1P49 A;  3DC5 A;  1KEC A;  3OE7 G;  1VQ4 V;  5CN0 A;  1LNQ A;  1OCO B;  5K1P A;  1JPX A;  3RYH A;  4BR6 A;  4L8J A;  5IY5 C;  4MVM A;  3OFN G;  1XNQ B;  3ZRX A;  1PM9 A;  4O2B B;  1GAX A;  4O2A B;  1BS3 A;  1H8H G;  2JVD A;  1GN2 A;  3B2E E;  1QLE B;  4WFG A;  4LFA B;  4MW8 A;  4IYH A;  1VQ9 V;  2CDY A;  1KB9 F;  3OT7 A;  5BXZ A;  1EZV H;  4DO2 A;  1TA8 A;  1XNQ O;  2QJ1 A;  1RM1 B;  2WLL B;  3BAA A;  1M57 C;  3S3X A;  4JGS A;  1P7B A;  3E8H A;  1WPB A;  3GWK C;  4LFA O;  2LP7 A;  2DN9 A;  2Q69 A;  4X1Y B;  4U7N A;  2UXD B;  4U3J B;  4B3M B;  3IC7 A;  1Z5W A;  3SR2 C;  5JWP A;  3A8T A;  3QO5 A;  2Y69 C;  2YID A;  2Y4T A;  4ABM A;  1AI7 A;  2A0L A;  1P7G A;  1OCZ C;  3CXH F;  4YXW G;  2L6L A;  2EBO A;  4GYC B;  5IT9 N;  2UXD O;  4X1K A;  3HPL C;  3N2K A;  5H9C A;  1Y66 A;  2IH1 C;  3ZN0 A;  3STL C;  5LP6 B;  1BT8 A;  1M5I A;  5JVD B;  2LW7 A;  1JVM A;  3UCS C;  2QTS A;  5KX5 A;  4Z1M G;  4DV1 B;  2Q7G A;  5ITZ B;  2KG7 B;  4FJC C;  3CXC U;  3OEE G;  3AG2 C;  2OTL V;  3WFV A;  1QCE A;  4X1I B;  5KLV H;  1NS1 A;  2CH7 A;  3ETE A;  4CC5 A;  3FB8 C;  4PA4 A;  1XMQ B;  5FNV A;  4R50 A;  1DLB A;  5J2U A;  4PHZ A;  4DV1 O;  3HKB B;  1BSM A;  2PF4 E;  3ZRV A;  1AP6 A;  5B66 Z;  4ZI7 B;  1S77 D;  3JD2 A;  3TXS A;  1K33 A;  4RWU A;  4U3F H;  4GX2 A;  3FFQ A;  3ABM B;  4UCS A;  1FKA O;  2IH3 C;  4J7J A;  4JF3 A;  5BR8 B;  1VQ8 V;  1GK9 A;  1XMQ O;  2V7Q G;  1L8D A;  5C93 A;  3SJC C;  3MDS A;  3J7A U;  4DR3 O;  2ILM A;  2ETN A;  2HJF C;  2WA3 A;  2WLJ A;  1AI4 A;  1QLN A;  3HKC B;  5FLX N;  3H01 A;  4LWS B;  1H2G A;  5EZY A;  5D5P A;  1I7F A;  1Y76 A;  4DR1 B;  3JAT B;  5GTI Z;  1SER A;  2YI9 A;  2AHZ A;  1YHQ V;  5LHH A;  5BR8 O;  4UV8 A;  1W59 A;  4YJ3 B;  1NVP B;  2PYL A;  1ZX3 A;  1U96 A;  4F6E A;  2XND G;  1H38 A;  1VQN V;  3CCE V;  1PKX A;  2WAM A;  4DR1 O;  1CPY A;  1SA0 A;  2OCH A;  3K03 A;  1NT2 B;  4O4I A;  2Q9L A;  4QPK A;  2FML A;  4HAM A;  4UVC A;  2K9P A;  2Q0A A;  1KYO F;  2C2A A;  3C3S A;  4AQY B;  4I50 B;  2EIJ C;  1H2S B;  2FL4 A;  4UCR A;  4UCT A;  5LBQ A;  3LSS A;  4P9P A;  4TQF A;  5KA5 A;  1AP5 A;  1EM1 A;  1OCO C;  3OR6 C;  2JGU A;  1YJW V;  1E1R G;  1U97 A;  2N04 A;  2JK5 C;  2YSU B;  2YXH A;  4J7K A;  3K58 A;  2ADQ B;  1RSO A;  3ZMV A;  4X65 B;  1KBH A;  5EC1 C;  4AQY O;  1BCC H;  4F6R A;  2Q4P A;  1HDJ A;  3E2E A;  1KKC A;  5EBM C;  3BA8 A;  2JDI G;  2PI4 A;  2DWD C;  5LXT A;  1M56 B;  1QLE C;  3JD3 A;  4PA9 A;  4MW3 A;  4CH4 A;  4NB5 A;  4WFA V;  4J42 A;  5LA6 B;  3L9D A;  4X65 O;  1IBL B;  3CCQ V;  1RM1 C;  2WSS G;  1H5W A;  2XAH A;  4YJ2 B;  4O4L B;  4WFB V;  4JI8 B;  4B3S B;  3L70 H;  2P67 A;  5JH7 A;  3D8C A;  1OCR B;  3FD9 A;  5B1A B;  3ZX6 A;  2LGW A;  1K4D C;  5A9G A;  1S3J A;  5KAF Z;  3APO A;  4TUY A;  3WB2 A;  1SQG A;  1IBL O;  2GSM B;  4UB6 Z;  5EK0 A;  2FYU H;  4O2A A;  1B6Q A;  4JI8 O;  4B3S O;  1V9P A;  4TOI A;  4GZR B;  3K5O A;  3ABU A;  2WLL A;  4BIU A;  5JQG B;  3BEH A;  1AJQ A;  5LP6 C;  1M9N A;  2L35 A;  2F43 G;  3K06 A;  4KFM A;  3K57 A;  1E79 G;  4PA6 A;  2Q5Z A;  3G4S V;  4UCU A;  2PI5 A;  4MVZ A;  1CEZ A;  3IC9 A;  2RMK B;  4X1Y A;  4TV9 B;  1D5A A;  5IYZ B;  2EJR A;  1Q82 W;  1XI1 A;  2Q6A A;  1NH2 D;  2XAS A;  3OUF A;  4FM2 A;  2QWQ B;  1R3K C;  3MD0 A;  1VMG A;  1S5J A;  3K04 A;  2H3O A;  2YIB D;  2LO1 A;  4I7Z B;  3RYC B;  4P30 A;  3CRM A;  5H6Q A;  2ZR2 A;  2ZE7 A;  3ABM C;  1YJ9 V;  3SYO A;  5JVD A;  2EUL A;  3RYI B;  1HNX B;  1G8M A;  5J2T B;  3N2G B;  4JV5 B;  2F4V B;  3MHH C;  3BRC A;  4DXW A;  3JAK B;  1B04 A;  4FFK A;  5ITZ A;  2KG7 A;  1TVK B;  2BTQ B;  4MVU A;  3CCS V;  1LR1 A;  2RCV A;  4X1I A;  5JJE B;  4KXR A;  2CTR A;  2IBZ H;  2ZD9 A;  1QVF U;  1L0N H;  2Q67 A;  4FIP C;  4WFF A;  1FXH A;  1HNX O;  3AEI A;  4JV5 O;  2EIM B;  2F4V O;  2UXC B;  4PDR A;  3G80 A;  2X6A A;  3HKB A;  4JTA B;  4IIJ B;  4FLV A;  4ZI7 A;  1V54 B;  2RQ6 A;  4AI8 A;  5B5E Z;  1SZT A;  4F4L A;  4NTX A;  3ZMS A;  2QR4 A;  3VQX A;  3AG1 B;  2GV9 A;  1TAE A;  1BHA A;  1IDS A;  2BSK B;  4CH3 A;  5CA3 A;  2UXC O;  1FXK B;  3FAV B;  3RYF A;  4LWS A;  3RGB A;  3JAT A;  4DR6 B;  3ABT A;  3B09 A;  4TWK A;  3KDR A;  3DGE A;  1BGY H;  5IE9 A;  2KB1 A;  3OTF A;  3CCM V;  1I5X A;  1HNW B;  5IJ9 B;  2DE0 X;  4GX0 A;  3UQ8 A;  5JJJ B;  2XAJ A;  3RVY A;  3HKD B;  3FYI B;  4DK1 A;  4CH5 A;  1JX9 A;  4RQF A;  4I9Q A;  1M56 C;  4DR6 O;  2YDE A;  1ARO P;  3CCV V;  3K59 A;  2QWR B;  4JI3 B;  3KG2 A;  4ZOL B;  3ZRS A;  2ITD C;  4DR7 B;  1HNW O;  4I50 A;  1O9G A;  2CTP A;  3ASN B;  3T4D A;  5D5Q A;  1OCR C;  1GKF A;  5CMU A;  5B1A C;  1EN4 A;  4KP4 A;  3JD1 A;  3ICX A;  4JI3 O;  1XRE A;  1D5N A;  3G71 V;  4DR7 O;  3NR7 A;  1X59 A;  2HR3 A;  2CAZ C;  2NNU A;  3HB3 B;  4OPA A;  3K3W A;  1R6N A;  1YI2 V;  3QTC A;  1K3E A;  5KHJ A;  4JI0 B;  5KAI Z;  3ZMU A;  3B8M A;  2F93 B;  2W6J G;  4Z1V A;  3RW0 A;  1YSC A;  5BMV B;  3DC6 A;  3MHS C;  4MVO A;  2AZ0 A;  1VQK V;  3AK3 A;  4EB6 B;  4JI0 O;  2A79 B;  3QVN A;  3RVZ A;  2DYS B;  3I56 V;  4LNU B;  3LUT B;  3K9S A;  1KQS U;  3D3Q A;  4GCZ A;  2R70 A;  5EC2 C;  2WPD G;  1SQQ H;  3ETG A;  5LGN A;  1VF7 A;  5DEC A;  4JAU A;  3C3T A;  3L74 H;  2ZQM A;  3R65 A;  2PZS A;  1NR7 A;  1US6 A;  1V55 B;  1UJW B;  3ZHV A;  2ZNJ A;  2B1I A;  3JSL A;  1X4T A;  1VQM V;  5JQG A;  4J11 A;  3ABL B;  4J7Z A;  1G4Y B;  2QWP B;  4LP8 A;  1FYJ A;  4DV0 B;  4O4H A;  3K08 A;  5LL6 Y;  3ZRW B;  3JD0 A;  3SPH A;  2IJH A;  1AVM A;  2QWN B;  2Q73 A;  1BHB A;  4MT8 A;  4TV9 A;  5IYZ A;  5IYC O;  2ZIO A;  1MNG A;  5LMU B;  2A06 H;  3JSN A;  2YIC A;  3CRC A;  4RQE A;  4DV0 O;  1Q43 A;  2ZDI A;  2IJK A;  2EIM C;  2ZE5 A;  2KSD A;  2HEP A;  2QM8 A;  2UUC B;  2RJZ A;  4DW0 A;  2JS3 A;  1V54 C;  5BZB A;  1N32 B;  4FVM A;  1PNL A;  1WB8 A;  2BE3 A;  5LMU O;  5JCO C;  4EEQ A;  2UXX A;  3SYQ A;  2DYR B;  3RYI A;  5J2T A;  1UFI A;  3AG1 C;  3N2G A;  3JAK A;  3Q4H A;  1FXK C;  1CXZ B;  2Y48 A;  2UUC O;  3FB7 C;  4XDK A;  1IUR A;  1XHX A;  1N32 O;  1B3Q A;  2W6I G;  5LHI A;  2CGN A;  3H1K H;  2UXN A;  1R73 A;  1SF9 A;  4LF7 B;  3B4S A;  2CK3 G;  1RFY A;  4C7U A;  3ZBH A;  2ZKO A;  1DF4 A;  1E1Q G;  1QR9 A;  5JJN B;  1RPO A;  2F66 C;  1W0J G;  1S5H C;  4B7K A;  2QDO A;  5KMG B;  4IIJ A;  2EZP A;  4R8C A;  1N8R W;  1YVW A;  3CWB H;  3DXR A;  4LF8 B;  1SES A;  1AB3 A;  1YEW A;  5JCO A;  2OYQ A;  4JI7 B;  1Q3E A;  4LF7 O;  1ZWI C;  2FKX A;  4N21 A;  2WA4 A;  2OCC B;  5CA0 B;  2BSK A;  2XUM A;  1FXK A;  2LFS A;  3L71 H;  4LC1 A;  2A3Q A;  1NH2 B;  1QHT A;  4CC6 A;  4LF8 O;  1SQX H;  5FPO A;  4DW1 A;  1AIL A;  4JI7 O;  3P3N A;  1PV0 A;  3ZED A;  3D36 C;  1K7D A;  3HKD A;  4CS3 A;  1GM9 A;  4B3M O;  1M90 W;  1MOF A;  1P84 F;  4DV3 B;  4FM1 A;  1N34 B;  4ZOL A;  4UB8 Z;  4I9W A;  1SZX A;  2Q0O C;  1WLE A;  3SPJ A;  3L75 H;  3QO8 A;  3A0H Z;  1VQ6 V;  1ZLZ A;  4JYC A;  3ML0 A;  4UCO A;  3SJA C;  3HKE A;  1WNS A;  2UU9 B;  3CEI A;  4DV3 O;  3E35 A;  5DM6 V;  4PD4 F;  4Q20 A;  2DYS C;  4N23 A;  2OT5 A;  4MVQ A;  3ZHS A;  4FLY A;  2F95 B;  3B8N A;  3ZMT A;  1TUB A;  1EN6 A;  1KP3 A;  3CHX A;  2ZE8 A;  4G28 B;  3ZHU A;  4ZKI A;  2AGA A;  4ZHQ B;  4LFB B;  4X62 B;  1LUW A;  3LDE A;  2R9I A;  3WU2 Z;  5C8Y B;  3CCU V;  4AHC A;  1UPG A;  2EJ7 A;  1OJH A;  2UU9 O;  4KUM A;  4RAI A;  1M1K W;  1Z2G A;  1V55 C;  2ODM A;  4JYB A;  2Q7H A;  4LFB O;  3ABL C;  4PDL A;  4X62 O;  4H33 A;  1DF5 A;  1YTF D;  3O9O A;  2RNB A;  1KC8 W;  4PA7 A;  2ZT9 B;  4JI6 B;  3CRQ A;  5IJ0 B;  4CS4 A;  3SYC A;  5F2V O;  2F23 A;  1XL6 A;  2HVJ C;  4X66 B;  4OXS A;  2WLI B;  2R72 A;  3OMN B;  1K4C C;  1MZE A;  4E4E A;  2IU0 A;  1EN5 A;  1MSD A;  1FS0 G;  1KD1 W;  5BY1 A;  4LCU C;  4K0K B;  5J9P C;  4CZZ A;  4JI6 O;  1IBK B;  2NR5 A;  2DYR C;  2GUZ B;  2QKA A;  5LMN B;  2M6Y A;  4X66 O;  3JCZ A;  2IU3 A;  4CS2 A;  3ZRW A;  2XAF A;  1NU1 H;  5IYB O;  3E8F A;  4IHJ A;  2WWW A;  5KHI A;  3R66 A;  3E22 B;  4XDL A;  4K0K O;  1GRJ A;  1H2K A;  1YCI A;  1Q8I A;  3RBZ A;  1IBK O;  3CSX A;  4TV8 B;  5LMN O;  4LF4 B;  1PPJ H;  1Q6I A;  5H5N A;  1S5L Z;  2JEX A;  1J95 A;  3M7M X;  3BFR A;  2KKW A;  1NBM G;  2BTO A;  3L72 H;  3T2M A;  4G27 B;  1VEW A;  3GWO A;  1VF6 C;  2AW9 A;  4LF4 O;  2OCC C;  1Q81 W;  4RUE A;  2IJI A;  3JAW B;  4WFE A;  4LF6 B;  4IGG A;  1B06 A;  1K97 A;  3W7S A;  4O2B A;  1HNZ B;  2WLM A;  1N0N A;  2E76 B;  3H1H H;  4DRX B;  3FYE B;  1SS3 A;  3THO A;  4I55 B;  3BVO A;  4TT3 G;  4ZIB A;  2LQT A;  3ASO B;  2OIE A;  2P90 A;  1XNR B;  5KMG A;  4LF6 O;  1TGO A;  2QE7 G;  4O4J B;  1HNZ O;  3WG7 B;  4TSF G;  3FX7 A;  1R3J C;  1CP9 A;  3M99 B;  4QJF B;  2FB5 A;  4QIW F;  4W4L A;  5KHH A;  5TIS Z;  1VF6 A;  3TGU H;  3K0G A;  5CA0 A;  1WPX A;  3JAL B;  2ATK C;  2QTO A;  1XNR O;  4UV9 A;  4UVB A;  3K5M A;  3K5L A;  4UCV A;  4U3J A;  4B3R B;  1K5Q A;  5KUK A;  5EIB D;  1AR4 A;  1FFX B;  3CME V;  2P06 A;  3J80 N;  4MSW C;  1SQP H;  2YIB A;  2BCC H;  3KZI Z;  4J9Z B;  2MW2 B;  3SYP A;  5CA1 B;  1Q5O A;  2CTQ A;  5LGU A;  2GDS A;  4IT5 A;  2CGO A;  4FM0 A;  4B3R O;  3TJT A;  1Z5V A;  1XQ8 A;  3SDL A;  5LP6 A;  3O65 A;  1HWY A;  4J9Y B;  1WP7 A;  4ICG A;  1R6K A;  5IYD O;  3W7X A;  2EIK B;  2E3C A;  1I08 A;  1XIL A;  1F7Y A;  4FK5 C;  1WAZ A;  1VQP V;  4CBC A;  2PTM A;  1G1X B;  5LYJ B;  3LDC A;  3K79 A;  4X20 B;  4MTF A;  1PL0 A;  4I0X B;  2CE4 A;  1M93 A;  1MZF A;  1I0H A;  2HG5 C;  4DV7 B;  4FLW A;  2WLH A;  2ARH A;  2GBO A;  4QE9 A;  3P3P A;  5C8Y A;  3BY6 A;  4RUF A;  1AR5 A;  1XBL A;  4EKW A;  5B3S B;  1ZAU A;  2X7R B;  3OGC C;  4NTY A;  2XTA A;  1ZL8 B;  2BOB C;  1MAB G;  5E1A C;  1IBM B;  1MSW D;  2Q8V A;  4DV7 O;  4TQD A;  2JJ2 G;  4ZBM A;  1A32 A;  3HKC A;  3UM7 A;  1F4M A;  3G6B A;  2XT9 A;  2EIL B;  2HP8 A;  2UUA B;  3OTO B;  4YJ3 A;  1T5E A;  1K5S A;  1HW7 A;  1IBM O;  3FB6 C;  1GN4 A;  3CRA A;  4MTX A;  4NVP A;  3M8A A;  3LSQ A;  1IZ3 A;  5IJ0 A;  1F51 A;  2ZXW B;  2Y0I A;  4WBN B;  4DV6 B;  2PGG A;  3HR0 A;  3BPZ A;  2WLI A;  2FTK A;  2UUA O;  2X6B A;  3OUS A;  3OTO O;  4UVA A;  1JQ0 A;  1F4N A;  2B5U A;  1NTM H;  4PI2 A;  4D7T A;  4X1K B;  4JZG A;  4DV6 O;  2P6J A;  1W0K G;  3A2F A;  3W7T A;  4I5S A;  3MAQ A;  1KU9 A;  4H44 B;  4QGP A;  2LW1 A;  3E22 A;  3VQV A;  2HJD A;  1XEQ A;  2B1G A;  4BWA A;  1QU7 A;  4TV8 A;  3ASO C;  1N36 B;  1SQB H;  5FL7 G;  3QG5 A;  5LA6 A;  2UUB B;  2HLD G;  5KHG A;  4K35 A;  3EVK A;  1ENV A;  3CYO A;  4UFZ A;  3UT5 B;  4YJ2 A;  3WG7 C;  4O4L A;  4NXN B;  1R3I C;  3VQW A;  4R6Z A;  3ZMZ A;  1N36 O;  4DUY B;  1COW G;  1SC5 B;  2Z5U A;  1K9M W;  2UUB O;  4K8Z A;  3JAW A;  5L3E A;  2GTS A;  2YIA A;  4IL6 Z;  2ZM6 B;  2QA4 V;  1XMO B;  4YIO A;  5IDJ A;  5KUM A;  2N05 A;  3CCL V;  1JOY A;  1WP8 A;  4NXN O;  5EZY B;  1WJZ A;  1TUE B;  4NKG B;  4DUY O;  2F1M A;  2B9Z A;  4Q6G A;  5DED A;  4JI4 B;  2H8P C;  2ZM6 O;  1XMO O;  4FPP A;  3CD6 V;  1FPO A;  4O4J A;  2JJ1 G;  1ORQ C;  1Q86 W;  5CB4 B;  1SA0 B;  2XOK G;  5L3B A;  2ITC C;  3GVM A;  2VWJ A;  1PL4 A;  3B77 A;  1FJG B;  2EIK C;  4FFB B;  1JMK C;  1IVS A;  3JAL A;  3C90 A;  3X2Q B;  5KHK A;  3ZJZ A;  4GKK B;  1YDX A;  3E83 A;  4X89 A;  3VBB A;  4JI4 O;  3ZHQ A;  1FFT B;  3QF7 A;  4MTO A;  2P4V A;  4UUJ C;  1OCC B;  4J80 A;  4YIP A;  1FFX A;  4J41 A;  1GM8 A;  4DR4 B;  1AJN A;  4MS2 A;  1DK1 A;  2EZO A;  1FXV A;  5CA1 A;  3QO7 A;  2Y4U A;  3SPG A;  1FJG O;  3CC2 V;  4MVR A;  4LH7 A;  5DN6 G;  4GKK O;  3RYC A;  1K8A W;  4ASU G;  4F6R B;  5B3S C;  1H2N A;  5AG2 A;  3F5T A;  3IJ4 A;  3E89 A;  2DOS A;  3RN4 A;  1N4C A;  4IYI A;  4DR4 O;  4HNA B;  3CJH B;  3RT3 C;  1XOU A;  4WF9 V;  1JFF B;  4KHP B;  1PNK A;  1Q6U A;  2ZNI A;  1TVK A;  2BTQ A;  5L3G A;  5LYJ A;  2EIL C;  5GON B;  4X20 A;  2LJ2 A;  1ZUQ A;  5JH7 B;  1YZB A;  3BCC H;  2HHH B;  4I0X A;  2P4K A;  3S3W A;  4PI0 A;  4GX5 A;  2WLN A;  4KHP O;  4TUY B;  4B08 A;  2ZXW C;  2VQE B;  4P2Z A;  1MG1 A;  2VRZ A;  5EBW C;  2P7T C;  1I94 B;  1GH6 A;  1H2M A;  3CC7 V;  1ZL8 A;  2HHH O;  1NTZ H;  4JTC B;  5B1O A;  2R9R B;  4PV1 B;  5K1X A;  3JAM N;  3FAV A;  3P30 A;  3SGI A;  3CX5 F;  2EX3 A;  3ASN C;  3CP1 A;  1Y4M A;  1FD9 A;  2JEU A;  2VQE O;  4EFE A;  3ABK B;  2W0F C;  2ZCE A;  4JTD B;  4OGQ B;  1SET A;  1VAR A;  4UXN A;  3SPI A;  1I94 O;  5IJ9 A;  4I4T B;  2DQ0 A;  4GLX A;  3W7U A;  4DYL A;  4LF9 B;  4WBN A;  2XAG A;  1ZTE A;  3CCR V;  1JJO A;  3T1H B;  4NXM B;  2X6C A;  4LR3 A;  4GKJ B;  2YEV B;  2O57 A;  3AG3 B;  1QVG U;  3SJB C;  5LGT A;  4PA3 A;  4QPJ A;  1IX9 A;  2YI8 A;  2OTJ V;  1ZSP A;  4LF9 O;  2DWE C;  5B1B B;  3T1H O;  2ADP A;  4NXM O;  3UO2 A;  1O9H A;  3SYA A;  1N34 O;  4GKJ O;  3DSQ A;  1Q90 D;  3K9A A;  3JAR B;  3TXQ A;  1EFR G;  4FMT A;  3D36 A;  2A7W A;  1S0V A;  1QNM A;  4NR1 A;  4BAY A;  1JA8 A;  1NZ6 A;  4DK0 A;  3WB0 A;  2YUA A;  3CRR A;  5H6R A;  3QNE A;  2G38 A;  2DQ3 A;  4GT1 A;  4E2L A;  4K8X A;  4DR3 B;  1KMI Z;  3G67 A;  3OMA B;  5CBF A;  2YXL A;  3UT5 A;  5BMV A;  3A0B Z;  3N27 A;  1BE3 H;  4P9O A;  5L3C A;  1VIB A;  4LH6 A;  4EB6 A;  3CB2 A;  1Q6H A;  2LGQ A;  3KKY A;  3X2Q C;  3AG7 A;  4BIZ A;  3T4Z A;  4LNU A;  1HR0 B;  5A2Q N;  3JYC A;  4BW5 A;  4RO2 A;  3RYF B;  3W7W A;  2HKO A;  4DV2 B;  1YIJ V;  1OCC C;  5GW7 A;  3FKS G;  4YY3 B;  3H9V A;  1NKD A;  3ZHR A;  3B40 A;  2YC0 A;  2M7W A;  3UO3 A;  3D3I A;  1GM7 A;  5L3D A;  2JGD B;  2XAQ A;  4JI1 B;  1QBZ A;  3LNM B;  1XL4 A;  4R7C A;  1HR0 O;  5E79 Z;  3EHB B;  1YF2 A;  3H1L H;  1YIT V;  3EXA A;  4DV2 O;  2JIZ G;  3VOU A;  5CB4 A;  4YY3 O;  1RP3 B;  3WB1 A;  2AXT Z;  2Y0P A;  2QSA A;  2PUS A;  4DV5 B;  4FFB A;  4JI1 O;  4QE7 A;  3TCU A;  2R9A A;  2X0L A;  2Z3Y A;  3OEH G;  4JYA B;  1GMG A;  1P4R A;  5EYP B;  1IJG A;  4PDM A;  2OWO A;  5HFM A;  3CE2 A;  1FOU A;  3CCJ V;  3CS5 A;  3AK1 A;  1NTK H;  2UXB B;  2V1D A;  4DV5 O;  2LFR A;  1H2L A;  4WCE V;  2AHY A;  1H8E G;  1PP9 H;  4JYA O;  3AG4 B;  1N0J A;  2ZE6 A;  3KCX A;  4HNA A;  4DR5 B;  3CMA V;  1JCH A;  3CJH A;  2V4D A;  4FZ1 A;  1Y74 B;  1JFF A;  2UXB O;  2GTA A;  3APQ A;  1L0L H;  5EIB C;  1URF A;  1MMM A;  5LOV B;  4LBE C;  1PD3 A;  3JD4 A;  3ABK C;  5GON A;  1OHH G;  1THZ A;  2GHY A;  3H1I H;  1YXB A;  3GB7 C;  3F7Y C;  4DR5 O;  2EIN B;  2D2C B;  1K73 W;  1WB7 A;  1SKV A; 
#chains in the Genus database with same CATH homology
 1XRE A;  1D5N A;  4FFK A;  1BSM A;  1PM9 A;  1SZX A;  1AP6 A;  1GN6 A;  1VAR A;  1PL4 A;  2RCV A;  1BS3 A;  2GDS A;  1WB8 A;  1ZLZ A;  1GN2 A;  3TJT A;  1JR9 A;  1EN4 A;  2QKC A;  3CEI A;  2CDY A;  3MDS A;  4JZG A;  1GN3 A;  5A9G A;  3OT7 A;  4YIP A;  1ZTE A;  4JYY A;  1EN6 A;  1I08 A;  1XIL A;  3DC6 A;  1LUW A;  3BFR A;  1IX9 A;  3AK3 A;  5AG2 A;  1ZSP A;  3RN4 A;  4GUN A;  4C7U A;  1IDS A;  1VEW A;  3QVN A;  2AW9 A;  4F6E A;  2CE4 A;  3K9S A;  1I0H A;  1IXB A;  2ADP A;  3AK1 A;  3EVK A;  4BR6 A;  1B06 A;  3KDR A;  1LUV A;  1MA1 A;  1P7G A;  1QNM A;  3AK2 A;  1N0N A;  1Y67 A;  1XUQ A;  1AR5 A;  1JA8 A;  3C3T A;  3C3S A;  1N0J A;  1XDC A;  3IC9 A;  1ZUQ A;  2P4K A;  1AP5 A;  1EM1 A;  1BT8 A;  4X9Q A;  4YIO A;  1MMM A;  2ADQ B;  3DC5 A;  1AVM A;  4E4E A;  1EN5 A;  1KKC A;  1MSD A;  3KKY A;  1GN4 A;  1MNG A;  4JZ2 A;  1WB7 A;  3LSU A;  2QKA A;  1AR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...