2ADPA

Nitrated human manganese superoxide dismutase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
196
structure length
195
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nitrated human manganese superoxide dismutase: mechanism of inactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 70
structure length 195
sequence length 196
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2adpA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2adpA02
1XILA 3C3SA 1GN3A 1I0HA 1SZXA 1GN6A 1B06A 3AK2A 2RCVA 5A9GA 1KKCA 1PL4A 3IC9A 1ZTEA 1IX9A 3C3TA 3DC5A 3EVKA 3TJTA 3AK1A 2P4KA 1EN6A 2ADPA 1AR5A 1AR4A 3BFRA 3OT7A 1AP5A 2QKCA 4C7UA 4GUNA 4JZ2A 1XREA 1XUQA 1WB8A 3AK3A 1N0NA 1VEWA 4E4EA 1QNMA 1IDSA 1GN4A 1MA1A 1JR9A 1LUVA 1JA8A 1XDCA 1EN5A 1I08A 4JYYA 1AVMA 2QKAA 1IXBA 1MSDA 3DC6A 3RN4A 1D5NA 4YIOA 4BR6A 1BT8A 2CDYA 1ZUQA 1WB7A 1GN2A 5AG2A 1EM1A 1VARA 3KKYA 3LSUA 3CEIA 1ZSPA 1LUWA 1Y67A 4JZGA 1AP6A 4FFKA 4X9QA 1PM9A 1EN4A 3MDSA 2CE4A 1N0JA 1P7GA 1BS3A 4F6EA 2GDSA 3K9SA 2ADQB 1ZLZA 1MNGA 1BSMA 3QVNA 1MMMA 2AW9A 4YIPA
chains in the Genus database with same CATH superfamily
3D8CA 3RT3C 1I0HA 3FB5C 3I56V 4DW0A 3SPHA 4AQYO 4X64O 3SJBC 1R3LC 3FB7C 1JJ2U 1N33B 3B2EE 2UXCO 2EJRA 3NXSA 3B8NA 2UUAO 1DTOA 2ODMA 3FAVA 4JAUA 2HHHO 1NI8A 3OUSA 4FFBA 3K08A 1Q7YW 2HJDA 1KB9F 3QF7A 1M56C 3L74H 1KD1W 4Z1MG 1YJWV 2QKCA 2GUZA 5HFMA 2QE7G 4DV1B 3JARA 4ZIBA 1B3QA 4CBCA 4YHHO 1AI5A 4PV1B 5BR8O 4DR6B 1MA1A 4LH6A 1A32A 2IM9A 3CCVV 4TT3G 1JA8A 5FPRA 1THZA 3CB2A 4JI3B 3JD2A 5LHIA 2JS5A 2HG5C 1QR8A 4J9ZB 1H2NA 4O2AB 4J7JA 1UJWB 3IAYA 2QEXV 1WB7A 1GMGA 1KC8W 4R6ZA 1Z5VA 3OMAB 4FZ1A 4ICGA 3BAAA 3CRRA 1ZSPA 4DV0O 4JI4B 2ZIOA 5EBMC 4X62B 4O4JB 4PHZA 3WB0A 3K5LA 3P3PA 3K9AA 3F7VC 2LW1A 5KHIA 4RWUA 3ETDA 3ABKB 1GAXA 4UCOA 2YXLA 3IFXA 5LBQA 3O9OA 5K1PA 4I0XB 2R9RB 3OD4A 1X4TA 5BMVB 4U3JB 2CTRA 1TUBB 2A9HA 4MVSA 4QGPA 4DUYB 4K3AA 1NJIW 4JPRA 4I50B 4FLWA 2ZDIC 4A5UB 1D2DA 4ZHQA 3SJQC 3C90A 1PNLA 3CRAA 4RAIA 1H2KA 3JCUZ 4PELA 2QR4A 3EVKA 2W6IG 3LSSA 5IYCO 4DR4B 4DV6B 3A0HZ 4X1YB 2HVJC 3HKEB 4MTGA 1KQSU 3W7SA 5EZYB 1M93A 3SJAC 4B3RB 4CH3A 3K59A 1FKAO 1QNMA 4DR1O 1QQCA 3ZN1A 5DEDA 4FVMA 4DV3O 1NVPB 4UVAA 3EXAA 1J5EO 1NH2D 2L6LA 2JK5C 5LMUB 4DR3O 3ZRWB 1HNWO 1ZWIC 5EYPA 5LMUO 3DC6A 2N74A 2YI8A 1TUEB 2XAGA 3RW0A 3OR6C 4G28B 4UB8Z 3CCEV 5IY5C 2P67A 3FAVB 4LCUC 3IC7A 4UVBA 4P9PA 4CS2A 2BSKA 1YXBA 1ROPA 4TWKA 3STZC 4B7KA 2DW4A 3ZMUA 3CPWU 4EB6B 3LDDA 4Z2WA 4U3JA 1XMOO 2Y69C 2GDSA 2EX3A 2ZINA 2ITCC 3JSLA 3K9SA 3E8FA 1IBLB 1K9MW 3AG2C 1BSMA 2XASA 3S3XA 4HZ3A 4YIPA 2LFSA 4ZI7B 3ASOB 4D6TH 5KLVH 1WA8A 3OEHG 5LOVA 4B3RO 1AJPA 4MTFA 4B3TO 2G38A 3QO8A 5IE9A 5GTIZ 5LP6A 1OCCC 4IT5A 3T1HO 3U0ZA 4MVQA 4QNHB 5B1AC 2YSUB 2XNDG 2ITDC 3CCUV 1SA0A 2CK3G 5IDJA 5DECA 2BTOA 3OT7A 3LNMB 4CC5A 3JATA 4J7KA 1MABG 5JQGA 1O9GA 4LC1A 3ZHVA 4JI2B 3ZHUA 4MTOA 1GN4A 1VP7A 2UXNA 2GHYA 1RP3B 5CA1A 3GWOA 4B3SO 1MZFA 4O4IA 4BW9A 2QA4V 3OMNB 2JEXA 1U97A 3HPLC 4I9QA 5L3CA 5C8YA 3CSXA 3JASB 3LSUA 2ARHA 2EIJC 5DN6G 1BCCH 3OGIB 1AROP 1VQ5V 1XHXA 1Y74B 4PI2A 5KX5A 2OCHA 3SPGA 3CXHF 4F6RB 1ZAUA 3ABMC 2GBOA 2ZKOA 2XAQA 4FM1A 4X66O 4JF3A 3U11A 2H8PC 2X6AA 4DR4O 4WFHA 3A8TA 1G8MA 4PA3A 4DV7O 1K97A 1HP8A 1KUQA 3QTCA 3ZBHA 4ZKIA 3K58A 5CA1B 5HFLA 3RVZA 2W6JG 2DYRB 3QVNA 1Q5OA 5KHKA 1SF9A 4Z1VA 3RWRD 1VF7A 1P7BA 1BHBA 3K79A 3CCMV 4DUYO 4AI8A 2NNUA 4DV4B 4LWSB 4MW3A 4XDJA 1ZTEA 2K1EA 4FIPC 4KHPO 4X20A 4OPHA 3E2EA 4JV5B 2HJFC 4F6RA 3IGAC 4GX2A 3SJCC 3T1YB 2BOCC 4YJ3B 3P30A 3N2KA 1R1BA 2RQ6A 2Z3YA 1AR5A 2LW7A 3DSQA 2AHYA 3VBBA 1HNXO 2BCCH 3K5OA 2NLJC 2WWWA 2KQXA 3I5DA 4LP8A 3D3QA 3I55V 5F2VO 1XHZA 2RDCA 3W7UA 2YIBD 1NR1A 4CH5A 5B5EZ 4LF8O 2F95B 3ZMVA 4FLZA 1GH6A 3ZCCA 2BOBC 3D36C 4DV7B 4DRXB 1PP9H 3HKBA 3VQWA 1KYOF 1WP8A 1Y66A 4DR6O 3S3WA 5B66Z 1AILA 3RVYA 1K7DA 4X1YA 3N2KB 4JYAB 2Q69A 2B5UA 1ZX3A 1MOFA 3CRMA 2EJ7A 4LFAB 1GM8A 3APQA 1XI1A 5EZYA 1FJGB 1FXKC 3EFFK 3HKDA 2UXDO 3MD0A 4BWAA 4X66B 3UT5A 3DTUB 3TK1A 1L1FA 4WFBV 2ZCEA 1V9PA 4FLTA 1RPRA 4DRXA 2E5LB 2QTOA 4NXNB 5LMNB 1B04A 1PNMA 2EINC 1K3EA 4MTXA 4O2BA 4RUFA 2Q68A 1QVFU 3LDCA 2Q0AA 4DR2B 4X65O 3JAKB 1FFTB 1Q82W 3SYCA 1OV9A 5KX5B 4LF8B 4PDMA 1P4RA 2P4KA 4JI5B 2Y0PA 1NTMH 5LYJA 4I9WA 2PUSA 1SQVH 1HNXB 3JD0A 5IYZA 1Q8IA 1W0JG 3QO5A 1AJQA 1M1KW 5GONB 3G4SV 1H2GA 3OMIB 4E4EA 5IY5B 4DV2B 4QJFB 4LFBB 5IYBO 4TUYB 3RYHB 5H9CA 3ABUA 4DUZO 4I50A 2OTLV 1V54C 1FOUA 2UUBB 3ASNB 3OAAG 3JALB 4JTCB 1GRJA 2EIJB 4O4JA 4ZOLB 1MSDA 2B9ZA 2JVDA 2Q0OC 3G71V 2EBOA 1Q90D 2VS0A 1SKVA 4H13B 3B09A 4YJ3A 4Q20A 1DF4A 2PTMA 1S3JA 3ZHTA 2K9PA 1YI2V 4NYKA 4N21A 4X9QA 1U96A 1W0KG 5J2TB 4YJ2B 1Q6HA 2UUCO 4I4TB 1OCCB 3TETA 2B1GA 4CH6A 3CYOA 2X0LA 4GKJO 3JALA 1TA8A 4B3TB 5JCOA 1MMMA 4LF6B 2E76B 4PD4F 4DR7B 5H6RA 5KMGB 4O4LA 5CA0B 2A79B 3CX5F 2LGQA 3T1CA 2JJ1G 2AZ0A 1BMFG 2W0FC 4H44B 3SGIA 4K8ZA 4WBNB 2F4VO 3SDLA 3HR0A 2BSKB 3J80N 3M99B 1PNKA 4NTXA 1WLEA 4UCUA 4PJ0Z 3E86A 5EBWC 4EB6A 1CEZA 2YEVA 5KAIZ 3STLC 4LF7B 2WA3A 3K03A 4GKKO 4G27B 1TVKB 3ZHRA 3E35A 4BIUA 3AK3A 3ZHSA 2XAHA 3APOA 4L87A 1VQKV 1NVPD 4PI0A 4JI5O 4ZI7A 3FYIB 3BY6A 4J41A 2QJ1A 5B1AB 2P06A 2ZE8A 3K57A 1R3IC 4J42A 2NR5A 5GW7A 2XTAA 2EILC 3PJSK 2LQTA 1XDCA 2QGNA 4H33A 4MSWC 4Q6GA 5BY1A 4DR2O 3R65A 1YTFB 2CGNA 4CS3A 2CDYA 2WLNA 1QBZA 2CH7A 1HNZO 3L71H 3ZRXA 2ZR3A 1AI7A 1S5LZ 4DR7O 2WPDG 1QHTA 1AP6A 4JI7B 2E75B 1RSOB 3OTFA 4JI1O 3WB2A 2Q73A 2X6CA 2YIBA 3CJHB 4TSFG 4XBFA 4I7ZB 1AI6A 4B08A 2MK3A 2WLLB 3E8BA 1JVMA 1VQ7V 3ZN0A 5DM6V 4GT1A 4FK5C 1WJZA 2YS8A 4PDRA 2P4VA 3ZMZA 1HNZB 3CWBH 5LMNO 2RCVA 3RYFA 4FJCC 3E83A 3ZX6A 4DV1O 1SESA 1PL4A 1H8HG 1WN7A 3FB6C 1K5QA 4W4LA 4WFEA 2ILMA 1K92A 2Q8VA 1VQ9V 4DV5B 2Q6AA 4J9YB 1YF2A 2PF4E 4JYBA 4MT8A 3P32A 5LXTB 5CBHA 4RQEA 1MZEA 3L70H 2EIKC 4X62O 3H1LH 2WLJA 3FFQA 4ZHQB 1PPJH 1JJOA 5IJ0B 3CD6V 3SYPA 3SYAA 3ZMTA 1M57C 3JD3A 1PV0A 2AHZA 4JI6B 2OIGA 1J95A 3OM3B 2UXBO 1NBMG 4U3FH 2UUBO 4X65B 1VF5B 2Q67A 4NXMO 5FNVB 4WCEV 1Q3EA 1YDXA 4NKGB 1GN2A 4FFBB 4YHHB 1RSOA 1N32O 1I7FA 5IWAB 1XBLA 3AG1C 1PM9A 4B3MO 4E2LA 3L73H 1YITV 1VIBA 4TQDA 3IJ4A 4LFBO 2FTKA 2O57A 5KHJA 4MVOA 1G1XB 2P22C 2VQEB 1KECA 1SQBH 1D5AA 2AW9A 3JAMN 1XL6A 3WFVA 1VQMV 3K06A 2JJ2G 2DN9A 3ICXA 3K04A 4K8XA 4IIJA 5J2UA 5A9GA 2QWQB 3ZEDA 2FMLA 3JAKA 3T4ZA 2UXXA 5E79Z 4GX1A 3Q4HB 3JSNA 1NTKH 2XOKG 2EULA 1IBKB 2CTQA 5KA5A 1Q43A 3EHBB 2FB5A 3E89A 3OGCC 1M9NA 3CC4V 4KL1A 1QCEA 4C7UA 1XNRO 2X7RB 4K0KB 5ITZB 1XMQB 1XUQA 2DJVA 3JYCA 5LP6B 3M8AA 5CA3A 2QM8A 3HKCA 1HR0B 1IDSA 4P30A 2JEUA 5J2UB 2XAFA 3D36A 3T1YO 2HP8A 2HVKC 1IBMB 4NR1A 1YVWA 3ZRVA 4XDKA 2NN4A 1M4UA 5LGNA 4DV4O 4OX9O 1HDJA 2LFRA 4MVZA 1B6QA 4LR3A 1KP3A 1Y67A 2ZE7A 2ZE6A 4X1KA 5J2TA 2W0XA 3OE7G 3KCYA 4NXMB 4TV9B 3ASNC 3BVOA 3H1JH 2JGDB 1NU1H 4UV9A 2X6BA 2HHHB 2N04A 1TUBA 3FD9A 3AEIA 5IJ0A 3AG3B 2HEPA 5B3SB 1GKFA 4TV8B 1N32B 3H1HH 2DQ3A 4JYAO 4TOIA 4P9OA 3RYIA 1G6UA 4PDLA 4NTYA 4B3SB 2DWDC 1WP7A 4K35A 1GK9A 4JV5O 2GTAA 5L3DA 5CBGA 3JD4A 4LBEC 1I94B 3CRQA 5J9PC 1XEQA 4EEQA 1W2BU 4DR1B 1WPBA 1FAFA 4CS4A 2QWRB 3CCQV 2H94A 5IJ9A 4O4IB 4JZ2A 1R3KC 2VQEO 2OTJV 4DYLA 2QTSA 2EZOA 3ZHQA 4DV5O 3RYFB 2AXTZ 3UM7A 2KSDA 3W7WA 5FNVA 4LFCO 2ZDIA 5LA6A 3K0DA 1BGYH 4WFGA 4UCVA 3MHSC 1KBHA 1FS0G 3ZIAG 4X89A 2Z5UA 2IU3A 1SA0B 4CH4A 3CCJV 2WLMA 2JGDA 3JAWB 1V55C 2RJZA 1NZ6A 3VQVA 2D2CB 3CXCU 1P84F 1WPXA 2Y4UA 2QM4A 2XAJA 4JZGA 3BA9A 2YXYA 2Y69B 2WSSG 1P49A 3VOUA 4UCRA 1Q81W 2WLIB 1H2MA 3OTOO 1I5XA 5B3SC 2P6JA 3L9DA 2DE0X 3WG7C 3A2FA 3BA8A 2AGAA 3R66A 1AJNA 1JX9A 4BAYA 5LL6Y 2OIEA 4PA9A 4WFFA 3JD1A 1V54B 3SYQA 4GX5A 3G80A 4JYCA 4ZBMA 5JVDA 3UO2A 5BMVA 1OCZB 1IBLO 2WLHA 1IJGA 4NB5A 5EIBC 1XMOB 4R7CA 3AG7A 4DUZB 2IJKA 4UCSA 3AK1A 1EN6A 5LXTA 2PY5A 4JI2O 1Z2GA 1S0VA 5EK0A 3CS5A 1T5EA 1DK1A 3O65A 1BE3H 4N23A 2CTPA 3CMEV 2BTQB 5EBLC 1IXMA 1YJNV 2CAZC 5JCOC 1MG1A 1XREA 3KDRA 1UPGA 4LF4B 3H1IH 2CH7B 4GCZA 4JASA 3TXQA 1SS3A 4JI1B 1OCOB 1TAEA 3FYEB 3AG1B 1LNQA 3OTOB 4JI0B 1VQNV 3UQ8A 4LF9O 1IZ3A 1HW7A 2PGGA 1I08A 4QPJA 3RYCA 4GKKB 4QE9A 4FM2A 5JQGB 1N34O 1NS1A 1JMKC 3UT5B 2F1MA 1SQXH 3CJHA 3K3WA 1CPYA 4UUJC 4TV9A 3FB8C 1M57B 2V1DA 4D7TA 5LHHA 1N8RW 1K34A 1BHAA 1GM9A 3ZRSA 3E22B 1L8DA 1NH2B 3BCCH 3SPCA 1N0JA 1RM1B 4I5SA 5JH7A 4KFMA 4DK1A 4EKWA 2DYRC 2F43G 2UUAB 1K73W 2RNBA 2YI9A 1WA8B 4AHCA 4EFEA 1S76D 2OYQA 1NKDA 4LF9B 1IURA 3CCSV 1ZLZA 2Q9LA 2XT9A 1FJGO 3H01A 1CXZB 2YIAA 4ABMA 1XILA 1YJ9V 3ML0A 4IIJB 1KU9A 2FKXA 3DXRA 4HNAB 5L3GA 2A06H 4YJ2A 3IC9A 2PYJA 3ETQA 3OW2U 2M7WA 1QVGU 4HAMA 4IGGA 1J5EB 4J7ZA 1N36B 4LF5B 1GM7A 4NTWA 5H2FZ 1QU7A 2BTQA 1BQ0A 3CP1A 1VQ4V 3NR7A 1H38A 5JH7B 1G4YB 3J81N 1XNQO 1AP5A 2E5LO 4DV0B 4JI4O 4MS2A 4GKJB 4O4LB 2BE3A 5LOVB 2JDIG 4LFCB 3BABA 1H2LA 3UO3A 2UXCB 2F23A 2H3OA 5KA6A 2JGUA 3OR7C 1S5HC 1Y76B 2RMKB 1Z5WA 5GTHZ 5IYDO 4AQYB 2R70A 3QO7A 4X64B 4P2ZA 1VQLV 2YIDA 3B77A 2ZXWB 1YIJV 3ZMSA 3DGEA 5AG2A 3ABMB 3E22A 5LP6C 1K4DC 3TCUA 4WF9V 1I94O 3WG7B 1FFXA 1Y4MA 5EC1C 1EN4A 3MDSA 4X20B 4AILC 4DR5O 3CCRV 2EIKB 4IHJA 4PA7A 4JI8O 1EBOA 1SRYA 1OJHA 3ETEA 5JJNB 1HWYA 3AG4B 3QNEA 4TV8A 4NXNO 1XOUA 3CMAV 2R9IA 1OZ0A 1KMIZ 1CP9A 2DYSB 3HB3B 1UFIA 4PA6A 4IYHA 3AK2A 4W4KA 1XNRB 5L3BA 1KP2A 3ASOC 3C3TA 2UU9O 2DWEC 2LJ2A 4X1KB 1NT2B 2EZPA 2PYLA 2VWJA 4G2KA 1YEWA 3RGBA 2HR3A 1RFYA 3E8HA 4IHJB 4R8CA 3CCLV 3K5MA 4J11A 5FL7G 1F51A 1LR1A 1OCRB 2QSAA 2ZIMA 1OCOC 3SYOA 4JTAB 2IU0A 4U7OA 1X59A 1WB8A 4CZZA 5KMGA 1PKXA 1BQZA 1K33A 2R9AA 4PA4A 2QWOB 3HKDB 1K4CC 2YDEA 1E79G 2ZR2A 2XHBA 5CB4B 4HYOA 1JOYA 4LNUB 2QKAA 1IXBA 3RN4A 1E1QG 3SPIA 3JAWA 4DR5B 2YEVB 3RBZA 5C93A 1R6TA 1DGSA 2JRIA 3KKYA 2Z0AA 4U7NA 4XDLA 2Y0IA 1OHHG 2DMXA 3LNNA 1YTFD 3G6EV 3K0GA 4IL6Z 3RFRA 3GB7C 1WNSA 2KG7A 2ZNJA 1XNQB 2RN9A 2V4DA 1XQ8A 1AB3A 1SC5B 1AR1B 3JASA 2PI4A 2AZ2A 2MW2B 1BS3A 2ZNIA 4JI8B 3J7AU 3B4SA 4F6EA 3ZJZA 5D5PA 5D5QA 5CBFA 1BZKA 1RPOA 3L72H 1L0LH 2N05A 2QM7A 4UV8A 4FMTA 1YHQV 3KCXA 5CN0A 3HKEA 4FM0A 1VF6C 1VF6A 1NR7A 4X1IB 1DF5A 2OWOA 2JS3A 2LP7A 2C2AA 1IX9A 4NVPA 4RO2A 1Q86W 4RQFA 2F4VB 2VRZA 1COWG 2YXHA 3MAQA 3TJTA 2IH3C 1JQ0A 2IJIA 1IBKO 3FX7A 4LWSA 3VQYA 4L8JA 1KKDA 5C8YB 3T2MA 1FPOA 3BFRA 2OCCC 4IYIA 1K5SA 1N34B 4KHPB 4QE7A 4FZ0A 3A0BZ 1SQFA 1JCHA 4PDVA 3X2QC 4O2BB 2IBZH 3JCZA 2WAMA 4JI6O 3AG2B 3UCSC 4X88A 5IYZB 2IW5A 1LUVA 1WAZA 5GONA 2OT5A 3JATB 3RYCB 1EN5A 4JYYA 3T1HB 2Y48A 3JARB 3T4DA 4JI7O 4UCTA 3P3NA 3ETGA 2ZE5A 4D7SA 4R50A 2R72A 4LF7O 2CUGA 5LYJB 1VARA 4K0KO 3L75H 1R6NA 1LUWA 3N2GB 3HKBB 5LGUA 2GV9A 4FFKA 4BW5A 2KKWA 1FXVA 3LDEA 4FLUA 2Y4TA 3AG4C 5KUKA 2ETNA 1GTOA 4MW8A 1EZVH 2VQFO 3CRCA 3QG5A 2DYSC 1VQ8V 4ZOLA 4GYCB 2ADQB 3THOA 1S5JA 3SPJA 3CHXA 2GSMB 3WB1A 1S77D 5B1BC 1NQTA 1GN3A 1O9HA 1H2SB 2PI5A 2ZD9A 3CE2A 1B06A 2UUCB 1RM1C 4CC6A 1FYJA 4KXRA 4B7EA 3N2GA 5BZBA 3KZIZ 1R3JC 2EINB 5ITZA 1HNWB 1EFRG 2WLLA 1SQPH 4DV3B 2KB1A 4KUMA 1FXHA 3A0RA 1AI4A 2P90A 2Q7GA 5K1XA 1I5YA 2DQ0A 1QLEB 4UVCA 4GUNA 1SZTA 4J10A 2EILB 5H5NA 1R73A 4H37A 1ZL8B 5KAFZ 5L3FA 4TQFA 4LH7A 3H9VA 1R6KA 4OPAA 3ABTA 5FPOA 4JI0O 4RUEA 1FD9A 4BR6A 1BT8A 4TUYA 3RYHA 1SERA 1OCZC 1Y6XA 3GVMA 1US6A 4UXNA 4LF4O 4UB6Z 3SR2C 3CEIA 2V7QG 3W7XA 3BHPA 1FFXB 1PL0A 1TVKA 1W59A 4WFAV 4DW1A 2CGOA 5EYPB 3VQXA 1GO3F 2HKOA 1XL4A 4DR3B 1FXKA 4MVUA 2Q5ZA 1P7GA 2WA4A 3N27A 4DK0A 1QLNA 2VQFB 5LHGA 2QKSA 4LNUA 2FL4A 2ZT9B 1JPXA 4BIOA 2GUZB 3PN1A 4I0XA 2QWNB 3M7MX 2DOSA 3C3SA 3ABLC 1SZXA 2LGWA 1GN6A 1F4NA 2E74B 2A3QA 5E1AC 4UFZA 4ASUG 1OCRC 4MVRA 4DV6O 1KKCA 3D3IA 2WLIA 5FLXN 1YCIA 2YICA 3DC5A 5CMUA 2OCCB 2ZQMA 3K5NA 4LFAO 1QLEC 4I55A 5BR8B 4O2AA 3BEHA 3TGUH 1YSCA 5BXZA 2EIMC 1AR4A 4WBNA 1H8EG 5LGTA 5A2QN 1ZL8A 4QIWF 1Y76A 5TISZ 5JVDB 2YC0A 2M6YA 1N0NA 1VEWA 4JAVA 4X1IA 1M56B 1Q6IA 4OX9B 4HBNA 4LF6O 3RYIB 1JR9A 3BRCA 4DO2A 5KUMA 1MSWD 2P5OA 4O4HA 1VQ6V 3U10A 1ORQC 1AVMA 1E1RG 3ZRWA 4JAAA 1XMQO 5KHHA 1D5NA 4YIOA 1F4MA 3ZS8C 1JFFB 2IJJA 1ZUQA 1HR0O 2ZM6B 4DV2O 2Q7HA 1EM1A 2ATKC 2ZM6O 2VWKA 3CC7V 3TXSA 2KG7B 4GX0A 4JI3O 3AG3C 2CE4A 2HLDG 1YZBA 5JJEB 1VQOV 5KHGA 5B1BB 3ABLB 5H6QA 4BIZA 1IVSA 1F23A 1VMGA 1MNGA 4FLYA 4FLVA 2P7TC 4OXSA 3ABKC 1L0NH 2CTWA 3OUFA 3BPZA 4GLXA 5B1NA 4QPKA 4YXWG 4I4TA 5JJJB 3LSQA 3HKCB 4FLXA 1SQGA 1ENVA 2ZXWC 1N33O 3G6BA 4JTDB 1QR9A 3X2QB 4OGQB 1VQPV 4H0LB 2EIMB 5IJ9B 3F5TA 3E8GA 2IJHA 1S72V 3WU2Z 2QWPB 1FXKB 2ADPA 3GWKC 1M90W 4B3MB 2D3OW 1SETA 5CB4A 3FKSG 2FYUH 2E3CA 2L35A 4YY3B 2JIZG 4FPPA 1URFA 5LA6B 4HNAA 2IH1C 3F5WC 3UKMA 1TGOA 3MHHC 4JGSA 2F66C 4EFBA 4GZRB 1N36O 4LF5O 1SQQH 4DXWA 1NTZH 2UU9B 2WLKA 2A7WA 2UXBB 5EC2C 1IBMO 1V55B 3CC2V 2QDOA 1EZJA 2GTSA 4YY3O 1JNBA 5B1OA 3G67A 4J80A 2UXDB 2XUMA 2Q4PA 3KG2A 1BL8A 1K8AW 3OEEG 3F7YC 1N4CA 2PZSA 2F93B 4I55B 1JFFA 3W7TA 5IWAO 1Y74A 1M5IA 5CA0A 1PD3A 3B40A 5EIBD 5L3EA 1H5WA 1F7YA 3LUTB 2B1IA 2LO1A 3B8MA 4X8AA 3DXRB 2Q7EA 4KP4A 3H1KH 3OFNG 3Q4HA 5IT9N 4MVMA 1DLBA 1Q6UA 2YUAA 4O4HB 4F4LA 2A0LA 2HFEC 5JWPA
chains in the Genus database with same CATH topology
1XILA 3C3SA 1GN3A 1I0HA 1SZXA 1GN6A 1B06A 3AK2A 2RCVA 5A9GA 1KKCA 1PL4A 3IC9A 1ZTEA 1IX9A 3C3TA 3DC5A 3EVKA 3TJTA 3AK1A 2P4KA 1EN6A 2ADPA 1AR5A 1AR4A 3BFRA 3OT7A 1AP5A 2QKCA 4C7UA 4GUNA 4JZ2A 1XREA 1XUQA 1WB8A 3KDRA 3AK3A 1N0NA 1VEWA 4E4EA 1QNMA 1IDSA 1GN4A 1MA1A 1JR9A 1LUVA 1JA8A 1XDCA 1EN5A 1I08A 4JYYA 1AVMA 2QKAA 1IXBA 1MSDA 3DC6A 3RN4A 1D5NA 4YIOA 4BR6A 1BT8A 2CDYA 1ZUQA 1WB7A 1GN2A 5AG2A 1EM1A 1VARA 3KKYA 3LSUA 3CEIA 1ZSPA 1LUWA 1Y67A 4JZGA 1AP6A 4FFKA 4X9QA 1PM9A 1EN4A 3MDSA 2CE4A 1N0JA 1P7GA 1BS3A 4F6EA 2GDSA 3K9SA 2ADQB 1ZLZA 1MNGA 1BSMA 3QVNA 1MMMA 2AW9A 4YIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIL A;  3C3S A;  1GN3 A;  1I0H A;  1SZX A;  1GN6 A;  1B06 A;  3AK2 A;  2RCV A;  5A9G A;  1KKC A;  1PL4 A;  3IC9 A;  1ZTE A;  1IX9 A;  3C3T A;  3DC5 A;  3EVK A;  3TJT A;  3AK1 A;  2P4K A;  1EN6 A;  2ADP A;  1AR5 A;  1AR4 A;  3BFR A;  3OT7 A;  1AP5 A;  2QKC A;  4C7U A;  4GUN A;  4JZ2 A;  1XRE A;  1XUQ A;  1WB8 A;  3AK3 A;  1N0N A;  1VEW A;  4E4E A;  1QNM A;  1IDS A;  1GN4 A;  1MA1 A;  1JR9 A;  1LUV A;  1JA8 A;  1XDC A;  1EN5 A;  1I08 A;  4JYY A;  1AVM A;  2QKA A;  1IXB A;  1MSD A;  3DC6 A;  3RN4 A;  1D5N A;  4YIO A;  4BR6 A;  1BT8 A;  2CDY A;  1ZUQ A;  1WB7 A;  1GN2 A;  5AG2 A;  1EM1 A;  1VAR A;  3KKY A;  3LSU A;  3CEI A;  1ZSP A;  1LUW A;  1Y67 A;  4JZG A;  1AP6 A;  4FFK A;  4X9Q A;  1PM9 A;  1EN4 A;  3MDS A;  2CE4 A;  1N0J A;  1P7G A;  1BS3 A;  4F6E A;  2GDS A;  3K9S A;  2ADQ B;  1ZLZ A;  1MNG A;  1BSM A;  3QVN A;  1MMM A;  2AW9 A;  4YIP A; 
#chains in the Genus database with same CATH topology
 3D8C A;  3RT3 C;  1I0H A;  3FB5 C;  3I56 V;  4DW0 A;  3SPH A;  4AQY O;  4X64 O;  3SJB C;  1R3L C;  3FB7 C;  1JJ2 U;  1N33 B;  3B2E E;  2UXC O;  2EJR A;  3NXS A;  3B8N A;  2UUA O;  1DTO A;  2ODM A;  3FAV A;  4JAU A;  2HHH O;  1NI8 A;  3OUS A;  4FFB A;  3K08 A;  1Q7Y W;  2HJD A;  1KB9 F;  3QF7 A;  1M56 C;  3L74 H;  1KD1 W;  4Z1M G;  1YJW V;  2QKC A;  2GUZ A;  5HFM A;  2QE7 G;  4DV1 B;  3JAR A;  4ZIB A;  1B3Q A;  4CBC A;  4YHH O;  1AI5 A;  4PV1 B;  5BR8 O;  4DR6 B;  1MA1 A;  4LH6 A;  1A32 A;  2IM9 A;  3CCV V;  4TT3 G;  1JA8 A;  5FPR A;  1THZ A;  3CB2 A;  4JI3 B;  3JD2 A;  5LHI A;  2JS5 A;  2HG5 C;  1QR8 A;  4J9Z B;  1H2N A;  4O2A B;  4J7J A;  1UJW B;  3IAY A;  2QEX V;  1WB7 A;  1GMG A;  1KC8 W;  4R6Z A;  1Z5V A;  3OMA B;  4FZ1 A;  4ICG A;  3BAA A;  3CRR A;  1ZSP A;  4DV0 O;  4JI4 B;  2ZIO A;  5EBM C;  4X62 B;  4O4J B;  4PHZ A;  3WB0 A;  3K5L A;  3P3P A;  3K9A A;  3F7V C;  2LW1 A;  5KHI A;  4RWU A;  3ETD A;  3ABK B;  1GAX A;  4UCO A;  2YXL A;  3IFX A;  5LBQ A;  3O9O A;  5K1P A;  4I0X B;  2R9R B;  3OD4 A;  1X4T A;  5BMV B;  4U3J B;  2CTR A;  1TUB B;  2A9H A;  4MVS A;  4QGP A;  4DUY B;  4K3A A;  1NJI W;  4JPR A;  4I50 B;  4FLW A;  2ZDI C;  4A5U B;  1D2D A;  4ZHQ A;  3SJQ C;  3C90 A;  1PNL A;  3CRA A;  4RAI A;  1H2K A;  3JCU Z;  4PEL A;  2QR4 A;  3EVK A;  2W6I G;  3LSS A;  5IYC O;  4DR4 B;  4DV6 B;  3A0H Z;  4X1Y B;  2HVJ C;  3HKE B;  4MTG A;  1KQS U;  3W7S A;  5EZY B;  1M93 A;  3SJA C;  4B3R B;  4CH3 A;  3K59 A;  1FKA O;  1QNM A;  4DR1 O;  1QQC A;  3ZN1 A;  5DED A;  4FVM A;  4DV3 O;  1NVP B;  4UVA A;  3EXA A;  1J5E O;  1NH2 D;  2L6L A;  2JK5 C;  5LMU B;  4DR3 O;  3ZRW B;  1HNW O;  1ZWI C;  5EYP A;  5LMU O;  3DC6 A;  2N74 A;  2YI8 A;  1TUE B;  2XAG A;  3RW0 A;  3OR6 C;  4G28 B;  4UB8 Z;  3CCE V;  5IY5 C;  2P67 A;  3FAV B;  4LCU C;  3IC7 A;  4UVB A;  4P9P A;  4CS2 A;  2BSK A;  1YXB A;  1ROP A;  4TWK A;  3STZ C;  4B7K A;  2DW4 A;  3ZMU A;  3CPW U;  4EB6 B;  3LDD A;  4Z2W A;  4U3J A;  1XMO O;  2Y69 C;  2GDS A;  2EX3 A;  2ZIN A;  2ITC C;  3JSL A;  3K9S A;  3E8F A;  1IBL B;  1K9M W;  3AG2 C;  1BSM A;  2XAS A;  3S3X A;  4HZ3 A;  4YIP A;  2LFS A;  4ZI7 B;  3ASO B;  4D6T H;  5KLV H;  1WA8 A;  3OEH G;  5LOV A;  4B3R O;  1AJP A;  4MTF A;  4B3T O;  2G38 A;  3QO8 A;  5IE9 A;  5GTI Z;  5LP6 A;  1OCC C;  4IT5 A;  3T1H O;  3U0Z A;  4MVQ A;  4QNH B;  5B1A C;  2YSU B;  2XND G;  2ITD C;  3CCU V;  1SA0 A;  2CK3 G;  5IDJ A;  5DEC A;  2BTO A;  3OT7 A;  3LNM B;  4CC5 A;  3JAT A;  4J7K A;  1MAB G;  5JQG A;  1O9G A;  4LC1 A;  3ZHV A;  4JI2 B;  3ZHU A;  4MTO A;  1GN4 A;  1VP7 A;  2UXN A;  2GHY A;  1RP3 B;  5CA1 A;  3GWO A;  4B3S O;  1MZF A;  4O4I A;  4BW9 A;  2QA4 V;  3OMN B;  2JEX A;  1U97 A;  3HPL C;  4I9Q A;  5L3C A;  5C8Y A;  3CSX A;  3JAS B;  3LSU A;  2ARH A;  2EIJ C;  5DN6 G;  1BCC H;  3OGI B;  1ARO P;  1VQ5 V;  1XHX A;  1Y74 B;  4PI2 A;  5KX5 A;  2OCH A;  3SPG A;  3CXH F;  4F6R B;  1ZAU A;  3ABM C;  2GBO A;  2ZKO A;  2XAQ A;  4FM1 A;  4X66 O;  4JF3 A;  3U11 A;  2H8P C;  2X6A A;  4DR4 O;  4WFH A;  3A8T A;  1G8M A;  4PA3 A;  4DV7 O;  1K97 A;  1HP8 A;  1KUQ A;  3QTC A;  3ZBH A;  4ZKI A;  3K58 A;  5CA1 B;  5HFL A;  3RVZ A;  2W6J G;  2DYR B;  3QVN A;  1Q5O A;  5KHK A;  1SF9 A;  4Z1V A;  3RWR D;  1VF7 A;  1P7B A;  1BHB A;  3K79 A;  3CCM V;  4DUY O;  4AI8 A;  2NNU A;  4DV4 B;  4LWS B;  4MW3 A;  4XDJ A;  1ZTE A;  2K1E A;  4FIP C;  4KHP O;  4X20 A;  4OPH A;  3E2E A;  4JV5 B;  2HJF C;  4F6R A;  3IGA C;  4GX2 A;  3SJC C;  3T1Y B;  2BOC C;  4YJ3 B;  3P30 A;  3N2K A;  1R1B A;  2RQ6 A;  2Z3Y A;  1AR5 A;  2LW7 A;  3DSQ A;  2AHY A;  3VBB A;  1HNX O;  2BCC H;  3K5O A;  2NLJ C;  2WWW A;  2KQX A;  3I5D A;  4LP8 A;  3D3Q A;  3I55 V;  5F2V O;  1XHZ A;  2RDC A;  3W7U A;  2YIB D;  1NR1 A;  4CH5 A;  5B5E Z;  4LF8 O;  2F95 B;  3ZMV A;  4FLZ A;  1GH6 A;  3ZCC A;  2BOB C;  3D36 C;  4DV7 B;  4DRX B;  1PP9 H;  3HKB A;  3VQW A;  1KYO F;  1WP8 A;  1Y66 A;  4DR6 O;  3S3W A;  5B66 Z;  1AIL A;  3RVY A;  1K7D A;  4X1Y A;  3N2K B;  4JYA B;  2Q69 A;  2B5U A;  1ZX3 A;  1MOF A;  3CRM A;  2EJ7 A;  4LFA B;  1GM8 A;  3APQ A;  1XI1 A;  5EZY A;  1FJG B;  1FXK C;  3EFF K;  3HKD A;  2UXD O;  3MD0 A;  4BWA A;  4X66 B;  3UT5 A;  3DTU B;  3TK1 A;  1L1F A;  4WFB V;  2ZCE A;  1V9P A;  4FLT A;  1RPR A;  4DRX A;  2E5L B;  2QTO A;  4NXN B;  5LMN B;  1B04 A;  1PNM A;  2EIN C;  1K3E A;  4MTX A;  4O2B A;  4RUF A;  2Q68 A;  1QVF U;  3LDC A;  2Q0A A;  4DR2 B;  4X65 O;  3JAK B;  1FFT B;  1Q82 W;  3SYC A;  1OV9 A;  5KX5 B;  4LF8 B;  4PDM A;  1P4R A;  2P4K A;  4JI5 B;  2Y0P A;  1NTM H;  5LYJ A;  4I9W A;  2PUS A;  1SQV H;  1HNX B;  3JD0 A;  5IYZ A;  1Q8I A;  1W0J G;  3QO5 A;  1AJQ A;  1M1K W;  5GON B;  3G4S V;  1H2G A;  3OMI B;  4E4E A;  5IY5 B;  4DV2 B;  4QJF B;  4LFB B;  5IYB O;  4TUY B;  3RYH B;  5H9C A;  3ABU A;  4DUZ O;  4I50 A;  2OTL V;  1V54 C;  1FOU A;  2UUB B;  3ASN B;  3OAA G;  3JAL B;  4JTC B;  1GRJ A;  2EIJ B;  4O4J A;  4ZOL B;  1MSD A;  2B9Z A;  2JVD A;  2Q0O C;  3G71 V;  2EBO A;  1Q90 D;  2VS0 A;  1SKV A;  4H13 B;  3B09 A;  4YJ3 A;  4Q20 A;  1DF4 A;  2PTM A;  1S3J A;  3ZHT A;  2K9P A;  1YI2 V;  4NYK A;  4N21 A;  4X9Q A;  1U96 A;  1W0K G;  5J2T B;  4YJ2 B;  1Q6H A;  2UUC O;  4I4T B;  1OCC B;  3TET A;  2B1G A;  4CH6 A;  3CYO A;  2X0L A;  4GKJ O;  3JAL A;  1TA8 A;  4B3T B;  5JCO A;  1MMM A;  4LF6 B;  2E76 B;  4PD4 F;  4DR7 B;  5H6R A;  5KMG B;  4O4L A;  5CA0 B;  2A79 B;  3CX5 F;  2LGQ A;  3T1C A;  2JJ1 G;  2AZ0 A;  1BMF G;  2W0F C;  4H44 B;  3SGI A;  4K8Z A;  4WBN B;  2F4V O;  3SDL A;  3HR0 A;  2BSK B;  3J80 N;  3M99 B;  1PNK A;  4NTX A;  1WLE A;  4UCU A;  4PJ0 Z;  3E86 A;  5EBW C;  4EB6 A;  1CEZ A;  2YEV A;  5KAI Z;  3STL C;  4LF7 B;  2WA3 A;  3K03 A;  4GKK O;  4G27 B;  1TVK B;  3ZHR A;  3E35 A;  4BIU A;  3AK3 A;  3ZHS A;  2XAH A;  3APO A;  4L87 A;  1VQK V;  1NVP D;  4PI0 A;  4JI5 O;  4ZI7 A;  3FYI B;  3BY6 A;  4J41 A;  2QJ1 A;  5B1A B;  2P06 A;  2ZE8 A;  3K57 A;  1R3I C;  4J42 A;  2NR5 A;  5GW7 A;  2XTA A;  2EIL C;  3PJS K;  2LQT A;  1XDC A;  2QGN A;  4H33 A;  4MSW C;  4Q6G A;  5BY1 A;  4DR2 O;  3R65 A;  1YTF B;  2CGN A;  4CS3 A;  2CDY A;  2WLN A;  1QBZ A;  2CH7 A;  1HNZ O;  3L71 H;  3ZRX A;  2ZR3 A;  1AI7 A;  1S5L Z;  4DR7 O;  2WPD G;  1QHT A;  1AP6 A;  4JI7 B;  2E75 B;  1RSO B;  3OTF A;  4JI1 O;  3WB2 A;  2Q73 A;  2X6C A;  2YIB A;  3CJH B;  4TSF G;  4XBF A;  4I7Z B;  1AI6 A;  4B08 A;  2MK3 A;  2WLL B;  3E8B A;  1JVM A;  1VQ7 V;  3ZN0 A;  5DM6 V;  4GT1 A;  4FK5 C;  1WJZ A;  2YS8 A;  4PDR A;  2P4V A;  3ZMZ A;  1HNZ B;  3CWB H;  5LMN O;  2RCV A;  3RYF A;  4FJC C;  3E83 A;  3ZX6 A;  4DV1 O;  1SES A;  1PL4 A;  1H8H G;  1WN7 A;  3FB6 C;  1K5Q A;  4W4L A;  4WFE A;  2ILM A;  1K92 A;  2Q8V A;  1VQ9 V;  4DV5 B;  2Q6A A;  4J9Y B;  1YF2 A;  2PF4 E;  4JYB A;  4MT8 A;  3P32 A;  5LXT B;  5CBH A;  4RQE A;  1MZE A;  3L70 H;  2EIK C;  4X62 O;  3H1L H;  2WLJ A;  3FFQ A;  4ZHQ B;  1PPJ H;  1JJO A;  5IJ0 B;  3CD6 V;  3SYP A;  3SYA A;  3ZMT A;  1M57 C;  3JD3 A;  1PV0 A;  2AHZ A;  4JI6 B;  2OIG A;  1J95 A;  3OM3 B;  2UXB O;  1NBM G;  4U3F H;  2UUB O;  4X65 B;  1VF5 B;  2Q67 A;  4NXM O;  5FNV B;  4WCE V;  1Q3E A;  1YDX A;  4NKG B;  1GN2 A;  4FFB B;  4YHH B;  1RSO A;  1N32 O;  1I7F A;  5IWA B;  1XBL A;  3AG1 C;  1PM9 A;  4B3M O;  4E2L A;  3L73 H;  1YIT V;  1VIB A;  4TQD A;  3IJ4 A;  4LFB O;  2FTK A;  2O57 A;  5KHJ A;  4MVO A;  1G1X B;  2P22 C;  2VQE B;  1KEC A;  1SQB H;  1D5A A;  2AW9 A;  3JAM N;  1XL6 A;  3WFV A;  1VQM V;  3K06 A;  2JJ2 G;  2DN9 A;  3ICX A;  3K04 A;  4K8X A;  4IIJ A;  5J2U A;  5A9G A;  2QWQ B;  3ZED A;  2FML A;  3JAK A;  3T4Z A;  2UXX A;  5E79 Z;  4GX1 A;  3Q4H B;  3JSN A;  1NTK H;  2XOK G;  2EUL A;  1IBK B;  2CTQ A;  5KA5 A;  1Q43 A;  3EHB B;  2FB5 A;  3E89 A;  3OGC C;  1M9N A;  3CC4 V;  4KL1 A;  1QCE A;  4C7U A;  1XNR O;  2X7R B;  4K0K B;  5ITZ B;  1XMQ B;  1XUQ A;  2DJV A;  3JYC A;  5LP6 B;  3M8A A;  5CA3 A;  2QM8 A;  3HKC A;  1HR0 B;  1IDS A;  4P30 A;  2JEU A;  5J2U B;  2XAF A;  3D36 A;  3T1Y O;  2HP8 A;  2HVK C;  1IBM B;  4NR1 A;  1YVW A;  3ZRV A;  4XDK A;  2NN4 A;  1M4U A;  5LGN A;  4DV4 O;  4OX9 O;  1HDJ A;  2LFR A;  4MVZ A;  1B6Q A;  4LR3 A;  1KP3 A;  1Y67 A;  2ZE7 A;  2ZE6 A;  4X1K A;  5J2T A;  2W0X A;  3OE7 G;  3KCY A;  4NXM B;  4TV9 B;  3ASN C;  3BVO A;  3H1J H;  2JGD B;  1NU1 H;  4UV9 A;  2X6B A;  2HHH B;  2N04 A;  1TUB A;  3FD9 A;  3AEI A;  5IJ0 A;  3AG3 B;  2HEP A;  5B3S B;  1GKF A;  4TV8 B;  1N32 B;  3H1H H;  2DQ3 A;  4JYA O;  4TOI A;  4P9O A;  3RYI A;  1G6U A;  4PDL A;  4NTY A;  4B3S B;  2DWD C;  1WP7 A;  4K35 A;  1GK9 A;  4JV5 O;  2GTA A;  5L3D A;  5CBG A;  3JD4 A;  4LBE C;  1I94 B;  3CRQ A;  5J9P C;  1XEQ A;  4EEQ A;  1W2B U;  4DR1 B;  1WPB A;  1FAF A;  4CS4 A;  2QWR B;  3CCQ V;  2H94 A;  5IJ9 A;  4O4I B;  4JZ2 A;  1R3K C;  2VQE O;  2OTJ V;  4DYL A;  2QTS A;  2EZO A;  3ZHQ A;  4DV5 O;  3RYF B;  2AXT Z;  3UM7 A;  2KSD A;  3W7W A;  5FNV A;  4LFC O;  2ZDI A;  5LA6 A;  3K0D A;  1BGY H;  4WFG A;  4UCV A;  3MHS C;  1KBH A;  1FS0 G;  3ZIA G;  4X89 A;  2Z5U A;  2IU3 A;  1SA0 B;  4CH4 A;  3CCJ V;  2WLM A;  2JGD A;  3JAW B;  1V55 C;  2RJZ A;  1NZ6 A;  3VQV A;  2D2C B;  3CXC U;  1P84 F;  1WPX A;  2Y4U A;  2QM4 A;  2XAJ A;  4JZG A;  3BA9 A;  2YXY A;  2Y69 B;  2WSS G;  1P49 A;  3VOU A;  4UCR A;  1Q81 W;  2WLI B;  1H2M A;  3OTO O;  1I5X A;  5B3S C;  2P6J A;  3L9D A;  2DE0 X;  3WG7 C;  3A2F A;  3BA8 A;  2AGA A;  3R66 A;  1AJN A;  1JX9 A;  4BAY A;  5LL6 Y;  2OIE A;  4PA9 A;  4WFF A;  3JD1 A;  1V54 B;  3SYQ A;  4GX5 A;  3G80 A;  4JYC A;  4ZBM A;  5JVD A;  3UO2 A;  5BMV A;  1OCZ B;  1IBL O;  2WLH A;  1IJG A;  4NB5 A;  5EIB C;  1XMO B;  4R7C A;  3AG7 A;  4DUZ B;  2IJK A;  4UCS A;  3AK1 A;  1EN6 A;  5LXT A;  2PY5 A;  4JI2 O;  1Z2G A;  1S0V A;  5EK0 A;  3CS5 A;  1T5E A;  1DK1 A;  3O65 A;  1BE3 H;  4N23 A;  2CTP A;  3CME V;  2BTQ B;  5EBL C;  1IXM A;  1YJN V;  2CAZ C;  5JCO C;  1MG1 A;  1XRE A;  3KDR A;  1UPG A;  4LF4 B;  3H1I H;  2CH7 B;  4GCZ A;  4JAS A;  3TXQ A;  1SS3 A;  4JI1 B;  1OCO B;  1TAE A;  3FYE B;  3AG1 B;  1LNQ A;  3OTO B;  4JI0 B;  1VQN V;  3UQ8 A;  4LF9 O;  1IZ3 A;  1HW7 A;  2PGG A;  1I08 A;  4QPJ A;  3RYC A;  4GKK B;  4QE9 A;  4FM2 A;  5JQG B;  1N34 O;  1NS1 A;  1JMK C;  3UT5 B;  2F1M A;  1SQX H;  3CJH A;  3K3W A;  1CPY A;  4UUJ C;  4TV9 A;  3FB8 C;  1M57 B;  2V1D A;  4D7T A;  5LHH A;  1N8R W;  1K34 A;  1BHA A;  1GM9 A;  3ZRS A;  3E22 B;  1L8D A;  1NH2 B;  3BCC H;  3SPC A;  1N0J A;  1RM1 B;  4I5S A;  5JH7 A;  4KFM A;  4DK1 A;  4EKW A;  2DYR C;  2F43 G;  2UUA B;  1K73 W;  2RNB A;  2YI9 A;  1WA8 B;  4AHC A;  4EFE A;  1S76 D;  2OYQ A;  1NKD A;  4LF9 B;  1IUR A;  3CCS V;  1ZLZ A;  2Q9L A;  2XT9 A;  1FJG O;  3H01 A;  1CXZ B;  2YIA A;  4ABM A;  1XIL A;  1YJ9 V;  3ML0 A;  4IIJ B;  1KU9 A;  2FKX A;  3DXR A;  4HNA B;  5L3G A;  2A06 H;  4YJ2 A;  3IC9 A;  2PYJ A;  3ETQ A;  3OW2 U;  2M7W A;  1QVG U;  4HAM A;  4IGG A;  1J5E B;  4J7Z A;  1N36 B;  4LF5 B;  1GM7 A;  4NTW A;  5H2F Z;  1QU7 A;  2BTQ A;  1BQ0 A;  3CP1 A;  1VQ4 V;  3NR7 A;  1H38 A;  5JH7 B;  1G4Y B;  3J81 N;  1XNQ O;  1AP5 A;  2E5L O;  4DV0 B;  4JI4 O;  4MS2 A;  4GKJ B;  4O4L B;  2BE3 A;  5LOV B;  2JDI G;  4LFC B;  3BAB A;  1H2L A;  3UO3 A;  2UXC B;  2F23 A;  2H3O A;  5KA6 A;  2JGU A;  3OR7 C;  1S5H C;  1Y76 B;  2RMK B;  1Z5W A;  5GTH Z;  5IYD O;  4AQY B;  2R70 A;  3QO7 A;  4X64 B;  4P2Z A;  1VQL V;  2YID A;  3B77 A;  2ZXW B;  1YIJ V;  3ZMS A;  3DGE A;  5AG2 A;  3ABM B;  3E22 A;  5LP6 C;  1K4D C;  3TCU A;  4WF9 V;  1I94 O;  3WG7 B;  1FFX A;  1Y4M A;  5EC1 C;  1EN4 A;  3MDS A;  4X20 B;  4AIL C;  4DR5 O;  3CCR V;  2EIK B;  4IHJ A;  4PA7 A;  4JI8 O;  1EBO A;  1SRY A;  1OJH A;  3ETE A;  5JJN B;  1HWY A;  3AG4 B;  3QNE A;  4TV8 A;  4NXN O;  1XOU A;  3CMA V;  2R9I A;  1OZ0 A;  1KMI Z;  1CP9 A;  2DYS B;  3HB3 B;  1UFI A;  4PA6 A;  4IYH A;  3AK2 A;  4W4K A;  1XNR B;  5L3B A;  1KP2 A;  3ASO C;  3C3T A;  2UU9 O;  2DWE C;  2LJ2 A;  4X1K B;  1NT2 B;  2EZP A;  2PYL A;  2VWJ A;  4G2K A;  1YEW A;  3RGB A;  2HR3 A;  1RFY A;  3E8H A;  4IHJ B;  4R8C A;  3CCL V;  3K5M A;  4J11 A;  5FL7 G;  1F51 A;  1LR1 A;  1OCR B;  2QSA A;  2ZIM A;  1OCO C;  3SYO A;  4JTA B;  2IU0 A;  4U7O A;  1X59 A;  1WB8 A;  4CZZ A;  5KMG A;  1PKX A;  1BQZ A;  1K33 A;  2R9A A;  4PA4 A;  2QWO B;  3HKD B;  1K4C C;  2YDE A;  1E79 G;  2ZR2 A;  2XHB A;  5CB4 B;  4HYO A;  1JOY A;  4LNU B;  2QKA A;  1IXB A;  3RN4 A;  1E1Q G;  3SPI A;  3JAW A;  4DR5 B;  2YEV B;  3RBZ A;  5C93 A;  1R6T A;  1DGS A;  2JRI A;  3KKY A;  2Z0A A;  4U7N A;  4XDL A;  2Y0I A;  1OHH G;  2DMX A;  3LNN A;  1YTF D;  3G6E V;  3K0G A;  4IL6 Z;  3RFR A;  3GB7 C;  1WNS A;  2KG7 A;  2ZNJ A;  1XNQ B;  2RN9 A;  2V4D A;  1XQ8 A;  1AB3 A;  1SC5 B;  1AR1 B;  3JAS A;  2PI4 A;  2AZ2 A;  2MW2 B;  1BS3 A;  2ZNI A;  4JI8 B;  3J7A U;  3B4S A;  4F6E A;  3ZJZ A;  5D5P A;  5D5Q A;  5CBF A;  1BZK A;  1RPO A;  3L72 H;  1L0L H;  2N05 A;  2QM7 A;  4UV8 A;  4FMT A;  1YHQ V;  3KCX A;  5CN0 A;  3HKE A;  4FM0 A;  1VF6 C;  1VF6 A;  1NR7 A;  4X1I B;  1DF5 A;  2OWO A;  2JS3 A;  2LP7 A;  2C2A A;  1IX9 A;  4NVP A;  4RO2 A;  1Q86 W;  4RQF A;  2F4V B;  2VRZ A;  1COW G;  2YXH A;  3MAQ A;  3TJT A;  2IH3 C;  1JQ0 A;  2IJI A;  1IBK O;  3FX7 A;  4LWS A;  3VQY A;  4L8J A;  1KKD A;  5C8Y B;  3T2M A;  1FPO A;  3BFR A;  2OCC C;  4IYI A;  1K5S A;  1N34 B;  4KHP B;  4QE7 A;  4FZ0 A;  3A0B Z;  1SQF A;  1JCH A;  4PDV A;  3X2Q C;  4O2B B;  2IBZ H;  3JCZ A;  2WAM A;  4JI6 O;  3AG2 B;  3UCS C;  4X88 A;  5IYZ B;  2IW5 A;  1LUV A;  1WAZ A;  5GON A;  2OT5 A;  3JAT B;  3RYC B;  1EN5 A;  4JYY A;  3T1H B;  2Y48 A;  3JAR B;  3T4D A;  4JI7 O;  4UCT A;  3P3N A;  3ETG A;  2ZE5 A;  4D7S A;  4R50 A;  2R72 A;  4LF7 O;  2CUG A;  5LYJ B;  1VAR A;  4K0K O;  3L75 H;  1R6N A;  1LUW A;  3N2G B;  3HKB B;  5LGU A;  2GV9 A;  4FFK A;  4BW5 A;  2KKW A;  1FXV A;  3LDE A;  4FLU A;  2Y4T A;  3AG4 C;  5KUK A;  2ETN A;  1GTO A;  4MW8 A;  1EZV H;  2VQF O;  3CRC A;  3QG5 A;  2DYS C;  1VQ8 V;  4ZOL A;  4GYC B;  2ADQ B;  3THO A;  1S5J A;  3SPJ A;  3CHX A;  2GSM B;  3WB1 A;  1S77 D;  5B1B C;  1NQT A;  1GN3 A;  1O9H A;  1H2S B;  2PI5 A;  2ZD9 A;  3CE2 A;  1B06 A;  2UUC B;  1RM1 C;  4CC6 A;  1FYJ A;  4KXR A;  4B7E A;  3N2G A;  5BZB A;  3KZI Z;  1R3J C;  2EIN B;  5ITZ A;  1HNW B;  1EFR G;  2WLL A;  1SQP H;  4DV3 B;  2KB1 A;  4KUM A;  1FXH A;  3A0R A;  1AI4 A;  2P90 A;  2Q7G A;  5K1X A;  1I5Y A;  2DQ0 A;  1QLE B;  4UVC A;  4GUN A;  1SZT A;  4J10 A;  2EIL B;  5H5N A;  1R73 A;  4H37 A;  1ZL8 B;  5KAF Z;  5L3F A;  4TQF A;  4LH7 A;  3H9V A;  1R6K A;  4OPA A;  3ABT A;  5FPO A;  4JI0 O;  4RUE A;  1FD9 A;  4BR6 A;  1BT8 A;  4TUY A;  3RYH A;  1SER A;  1OCZ C;  1Y6X A;  3GVM A;  1US6 A;  4UXN A;  4LF4 O;  4UB6 Z;  3SR2 C;  3CEI A;  2V7Q G;  3W7X A;  3BHP A;  1FFX B;  1PL0 A;  1TVK A;  1W59 A;  4WFA V;  4DW1 A;  2CGO A;  5EYP B;  3VQX A;  1GO3 F;  2HKO A;  1XL4 A;  4DR3 B;  1FXK A;  4MVU A;  2Q5Z A;  1P7G A;  2WA4 A;  3N27 A;  4DK0 A;  1QLN A;  2VQF B;  5LHG A;  2QKS A;  4LNU A;  2FL4 A;  2ZT9 B;  1JPX A;  4BIO A;  2GUZ B;  3PN1 A;  4I0X A;  2QWN B;  3M7M X;  2DOS A;  3C3S A;  3ABL C;  1SZX A;  2LGW A;  1GN6 A;  1F4N A;  2E74 B;  2A3Q A;  5E1A C;  4UFZ A;  4ASU G;  1OCR C;  4MVR A;  4DV6 O;  1KKC A;  3D3I A;  2WLI A;  5FLX N;  1YCI A;  2YIC A;  3DC5 A;  5CMU A;  2OCC B;  2ZQM A;  3K5N A;  4LFA O;  1QLE C;  4I55 A;  5BR8 B;  4O2A A;  3BEH A;  3TGU H;  1YSC A;  5BXZ A;  2EIM C;  1AR4 A;  4WBN A;  1H8E G;  5LGT A;  5A2Q N;  1ZL8 A;  4QIW F;  1Y76 A;  5TIS Z;  5JVD B;  2YC0 A;  2M6Y A;  1N0N A;  1VEW A;  4JAV A;  4X1I A;  1M56 B;  1Q6I A;  4OX9 B;  4HBN A;  4LF6 O;  3RYI B;  1JR9 A;  3BRC A;  4DO2 A;  5KUM A;  1MSW D;  2P5O A;  4O4H A;  1VQ6 V;  3U10 A;  1ORQ C;  1AVM A;  1E1R G;  3ZRW A;  4JAA A;  1XMQ O;  5KHH A;  1D5N A;  4YIO A;  1F4M A;  3ZS8 C;  1JFF B;  2IJJ A;  1ZUQ A;  1HR0 O;  2ZM6 B;  4DV2 O;  2Q7H A;  1EM1 A;  2ATK C;  2ZM6 O;  2VWK A;  3CC7 V;  3TXS A;  2KG7 B;  4GX0 A;  4JI3 O;  3AG3 C;  2CE4 A;  2HLD G;  1YZB A;  5JJE B;  1VQO V;  5KHG A;  5B1B B;  3ABL B;  5H6Q A;  4BIZ A;  1IVS A;  1F23 A;  1VMG A;  1MNG A;  4FLY A;  4FLV A;  2P7T C;  4OXS A;  3ABK C;  1L0N H;  2CTW A;  3OUF A;  3BPZ A;  4GLX A;  5B1N A;  4QPK A;  4YXW G;  4I4T A;  5JJJ B;  3LSQ A;  3HKC B;  4FLX A;  1SQG A;  1ENV A;  2ZXW C;  1N33 O;  3G6B A;  4JTD B;  1QR9 A;  3X2Q B;  4OGQ B;  1VQP V;  4H0L B;  2EIM B;  5IJ9 B;  3F5T A;  3E8G A;  2IJH A;  1S72 V;  3WU2 Z;  2QWP B;  1FXK B;  2ADP A;  3GWK C;  1M90 W;  4B3M B;  2D3O W;  1SET A;  5CB4 A;  3FKS G;  2FYU H;  2E3C A;  2L35 A;  4YY3 B;  2JIZ G;  4FPP A;  1URF A;  5LA6 B;  4HNA A;  2IH1 C;  3F5W C;  3UKM A;  1TGO A;  3MHH C;  4JGS A;  2F66 C;  4EFB A;  4GZR B;  1N36 O;  4LF5 O;  1SQQ H;  4DXW A;  1NTZ H;  2UU9 B;  2WLK A;  2A7W A;  2UXB B;  5EC2 C;  1IBM O;  1V55 B;  3CC2 V;  2QDO A;  1EZJ A;  2GTS A;  4YY3 O;  1JNB A;  5B1O A;  3G67 A;  4J80 A;  2UXD B;  2XUM A;  2Q4P A;  3KG2 A;  1BL8 A;  1K8A W;  3OEE G;  3F7Y C;  1N4C A;  2PZS A;  2F93 B;  4I55 B;  1JFF A;  3W7T A;  5IWA O;  1Y74 A;  1M5I A;  5CA0 A;  1PD3 A;  3B40 A;  5EIB D;  5L3E A;  1H5W A;  1F7Y A;  3LUT B;  2B1I A;  2LO1 A;  3B8M A;  4X8A A;  3DXR B;  2Q7E A;  4KP4 A;  3H1K H;  3OFN G;  3Q4H A;  5IT9 N;  4MVM A;  1DLB A;  1Q6U A;  2YUA A;  4O4H B;  4F4L A;  2A0L A;  2HFE C;  5JWP A; 
#chains in the Genus database with same CATH homology
 1XIL A;  3C3S A;  1GN3 A;  1I0H A;  1SZX A;  1GN6 A;  1B06 A;  3AK2 A;  2RCV A;  5A9G A;  1KKC A;  1PL4 A;  3IC9 A;  1ZTE A;  1IX9 A;  3C3T A;  3DC5 A;  3EVK A;  3TJT A;  3AK1 A;  2P4K A;  1EN6 A;  2ADP A;  1AR5 A;  1AR4 A;  3BFR A;  3OT7 A;  1AP5 A;  2QKC A;  4C7U A;  4GUN A;  4JZ2 A;  1XRE A;  1XUQ A;  1WB8 A;  3KDR A;  3AK3 A;  1N0N A;  1VEW A;  4E4E A;  1QNM A;  1IDS A;  1GN4 A;  1MA1 A;  1JR9 A;  1LUV A;  1JA8 A;  1XDC A;  1EN5 A;  1I08 A;  4JYY A;  1AVM A;  2QKA A;  1IXB A;  1MSD A;  3DC6 A;  3RN4 A;  1D5N A;  4YIO A;  4BR6 A;  1BT8 A;  2CDY A;  1ZUQ A;  1WB7 A;  1GN2 A;  5AG2 A;  1EM1 A;  1VAR A;  3KKY A;  3LSU A;  3CEI A;  1ZSP A;  1LUW A;  1Y67 A;  4JZG A;  1AP6 A;  4FFK A;  4X9Q A;  1PM9 A;  1EN4 A;  3MDS A;  2CE4 A;  1N0J A;  1P7G A;  1BS3 A;  4F6E A;  2GDS A;  3K9S A;  2ADQ B;  1ZLZ A;  1MNG A;  1BSM A;  3QVN A;  1MMM A;  2AW9 A;  4YIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...