2ADPA

Nitrated human manganese superoxide dismutase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
196
structure length
195
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nitrated human manganese superoxide dismutase: mechanism of inactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 70
structure length 195
sequence length 196
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2adpA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2adpA02
2CE4A 1SZXA 1MSDA 1AP6A 1QNMA 3BFRA 1MNGA 1PM9A 1JA8A 1N0JA 3C3TA 1LUWA 2ADQB 1B06A 4FFKA 2AW9A 1ZSPA 1WB7A 1MMMA 3DC6A 1XDCA 1IXBA 1AP5A 1XILA 1ZUQA 1ZLZA 1VEWA 1XUQA 1JR9A 1XREA 3K9SA 2QKAA 1N0NA 3AK3A 1AR4A 3KKYA 2GDSA 1I0HA 1PL4A 4F6EA 1ZTEA 1I08A 1AR5A 1GN3A 3EVKA 4JZ2A 1P7GA 3CEIA 1IX9A 4X9QA 4JYYA 4BR6A 1BS3A 4YIOA 1WB8A 2QKCA 2ADPA 3IC9A 4E4EA 4GUNA 3AK1A 1EN5A 1D5NA 4C7UA 3DC5A 1BT8A 1GN6A 5A9GA 2P4KA 4YIPA 1IDSA 3LSUA 5AG2A 1EN4A 1GN2A 1KKCA 4JZGA 1EN6A 3TJTA 1Y67A 2RCVA 3MDSA 1EM1A 1MA1A 1BSMA 1LUVA 3C3SA 3OT7A 2CDYA 3QVNA 1VARA 1AVMA 3AK2A 3RN4A 1GN4A
chains in the Genus database with same CATH superfamily
1GKFA 1M5IA 3BFRA 1HNXB 2JRIA 3F5WC 1YTFD 2XOKG 3FFQA 3UO2A 3H01A 3ZHRA 2QR4A 3ABLC 5B5EZ 1I5XA 2L35A 5EYPB 5EZYB 2WLJA 1HW7A 4FJCC 4JPRA 5EZYA 3ICXA 5LP6A 2UXNA 2LFSA 2YIBD 2UUAO 4X1IB 1XILA 4LF4B 3OMIB 3G6BA 4DV1O 1J95A 1XREA 3E8BA 3OEEG 2DYRC 2F95B 4JGSA 5IWAO 4CH4A 2BSKB 3RBZA 1EBOA 1I0HA 5ITZB 3ASNB 1L0NH 2Y0PA 4X8AA 1PL0A 1JVMA 1WPBA 1AI5A 4DV1B 5C8YA 2R9AA 3SYCA 5KLVH 3EFFK 1Q7YW 1P49A 2IH3C 3FD9A 4NKGB 1VQ5V 4B3TO 1F4MA 5J2TA 2GTAA 2OTLV 1ENVA 3RGBA 2ADPA 4LP8A 4I50A 4DV3O 4BAYA 2QA4V 4MTGA 4O4HB 2PGGA 3DC5A 1M57C 4QGPA 2JS3A 2YICA 5CN0A 4NB5A 4DR7O 4H44B 2A9HA 3BVOA 3PN1A 3TETA 4RQEA 5JCOA 2OIEA 5BXZA 3AG7A 4MTFA 4UUJC 1VQLV 1HR0B 4KFMA 2WPDG 2RJZA 3CJHA 4O2BA 4KXRA 4B7KA 1OCCC 3I55V 1RPOA 1Q8IA 4DR7B 4QE7A 4J7JA 5JJNB 3CCSV 1XL6A 5IJ0A 1VF6C 2RMKB 2BCCH 5LYJA 1GRJA 3TXQA 2YIDA 2YIAA 2E75B 2EULA 3GB7C 1M93A 3ZBHA 3CB2A 3E83A 4J11A 4EEQA 2PY5A 4G27B 4JI2O 2UXDO 5B66Z 4GX1A 4JI4O 1XEQA 3L72H 3B09A 1QVGU 1DGSA 4YJ2A 4E2LA 2HG5C 1N34O 1FS0G 4GX5A 1AR5A 5IE9A 4JZ2A 4JI4B 4I9WA 1BMFG 1KU9A 2W0FC 2HVKC 2XAGA 4AILC 4JI8B 4NXMO 1IBKO 2KG7B 5DEDA 3J7AU 4HNAB 4BIUA 2HJFC 2WLKA 3KCXA 4Q20A 3CC7V 1GK9A 1OCOC 1YEWA 3QG5A 4HZ3A 1EN5A 1MOFA 1HNZO 4JI8O 4NXMB 4DUYO 1BHBA 3WG7B 1V9PA 1PPJH 3ZEDA 2Q0AA 4JV5O 3K5LA 1JNBA 4L8JA 4GKKB 3X2QB 1R3KC 3KDRA 1EM1A 1RSOA 4O4JA 5JQGB 1U96A 3CD6V 1SQGA 4U7OA 1WA8A 3IFXA 2H94A 1NTMH 2LGQA 2HKOA 4UV9A 2R72A 4D6TH 3H1JH 2XTAA 4TUYA 3AG4B 1OZ0A 2Q5ZA 2V1DA 5EBWC 1OCZB 5CA3A 2AGAA 1H8HG 2UU9B 1AI7A 3J81N 1A32A 3T4ZA 5LGTA 1ZAUA 1BZKA 2WLMA 3E8GA 1Q90D 4NXNB 3RYHB 4RO2A 4DR4B 3N2GB 2A06H 1KYOF 2AXTZ 1XHXA 2ZIOA 2P5OA 5B3SB 3L70H 2D2CB 2EINB 4X89A 5L3EA 1VQPV 4I4TA 5LMNO 1DF5A 1DK1A 1TVKB 4F6EA 5LHHA 3NXSA 5E79Z 3CXCU 3AG2B 5CBFA 1Y74B 4LWSA 1YHQV 4O4LB 4WFBV 1B6QA 4K3AA 3LNMB 1AB3A 1TVKA 3T1HO 3RYHA 4LF6O 3K5NA 5IJ0B 5KHHA 2EIJB 1F4NA 4JTDB 2OWOA 3HPLC 2OCCC 5H5NA 4JI7B 2JEUA 1YJ9V 1GO3F 3IAYA 1QU7A 3F5TA 2EIMB 3M8AA 3GVMA 1HNXO 2F66C 3SGIA 4DK1A 2VQFO 4JI3O 1W59A 2Q0OC 1WA8B 3DSQA 4ZOLB 1BGYH 3JALB 4LF7O 1W2BU 3RN4A 3BEHA 3DTUB 4LR3A 1Q6UA 4FM2A 3K0GA 1Q86W 3B4SA 3JCUZ 1B06A 2EIMC 3ABLB 4DV5O 4MTXA 3AG3B 1N33O 2UUBO 2CK3G 4GYCB 5LXTA 1G8MA 4W4KA 1SETA 3QO8A 5D5PA 1RM1B 4X66B 5H6QA 4DV6O 2CGNA 4O4HA 2DWEC 4DYLA 1AP5A 3JASB 3U10A 3G71V 5FNVA 1S3JA 1VQ8V 1RP3B 1P7BA 3L73H 5KAFZ 4TV9B 4PA7A 4O4JB 2WLIA 4PD4F 2X6CA 1LR1A 2DW4A 4LFBO 2EILC 1ROPA 2GBOA 5H6RA 5DM6V 4GLXA 1Q82W 1FJGO 3ZHUA 4LNUB 3UT5A 4X65B 2ZR3A 4ASUG 4GKKO 1Y6XA 1JJ2U 1IBMB 4LF8O 1TA8A 4TV8A 1MABG 5IDJA 2H3OA 1ORQC 4DK0A 3JAKB 3JD3A 4R8CA 1NVPB 4CBCA 3DXRA 2KG7A 1RFYA 4IYIA 2ZD9A 3OTOB 4WBNB 3W7WA 2YSUB 4CH6A 3K57A 4PELA 1WAZA 4WBNA 3OTFA 4OPAA 1K33A 2UXBB 3CCEV 3WB1A 4K8XA 2Y48A 4JI5O 1S76D 5LYJB 2VS0A 3E8HA 4X1YB 2BE3A 3K08A 1GN4A 3PJSK 3ASNC 4UCOA 3OTOO 1SC5B 4DUZB 3AG1B 2ZR2A 3TXSA 4UVAA 3ZMTA 4UVCA 4MTOA 1S77D 1LUWA 3ZRVA 2P06A 1Z5WA 4DUYB 4JTCB 3O9OA 4ZHQA 2UXCO 4WFGA 3K5OA 4LF9O 2ZCEA 5FPRA 1SA0A 2Y0IA 4B08A 5GTIZ 3MAQA 3CCUV 4DV2O 4FLYA 3A0BZ 3RYCB 4UCVA 4DR3B 4J9YB 2DOSA 3BA9A 4ZI7B 3HR0A 1R6TA 5JVDA 5CMUA 2Q4PA 1N0NA 5LL6Y 3AK3A 2DYSC 4IHJB 3SPHA 3A0HZ 1ZTEA 3RVYA 2QM4A 4EB6A 4JF3A 1RSOB 3OUSA 4ZOLA 1K92A 5JQGA 3APOA 2LP7A 4BW9A 4HNAA 4JI7O 1MZEA 1HNZB 2JK5C 1JFFB 1F23A 1AILA 1V55B 4DR4O 5EBLC 4QPKA 5H9CA 3BRCA 3OAAG 3JARA 1SESA 4E4EA 3JD1A 1WLEA 1XMOB 2QE7G 4O4IB 1F51A 4KL1A 2F1MA 2XHBA 4YIPA 4MVMA 3B8MA 5KA5A 1IVSA 1M4UA 4PA4A 1MA1A 3ZN0A 1THZA 1K8AW 3FYIB 2BOBC 1M9NA 5LA6A 3K5MA 1SQPH 3UM7A 4QIWF 3K0DA 1KECA 1S5LZ 3VQYA 2CTPA 1AP6A 3JAWB 3HKCB 2ZDIA 4DV6B 4DV4B 2HFEC 1GTOA 4AQYO 5EK0A 5IT9N 2QTSA 2ZIMA 2Q7HA 3RWRD 2PF4E 1Q3EA 1WB7A 2DQ3A 3JAWA 3BA8A 4DV0B 2HP8A 1X59A 4J9ZB 2UUCB 3ZJZA 2B1GA 1M1KW 1IXBA 1E1QG 3P3PA 2PYJA 2F4VB 4FVMA 2V7QG 5EIBD 4YHHO 2D3OW 3ZHTA 4X65O 3E86A 1VEWA 4K0KO 2EZOA 3IC7A 3HKDA 2M6YA 4MVQA 3ZMSA 1KC8W 3RW0A 2Y4UA 5IY5C 2QWRB 5J9PC 4U3FH 1GAXA 1BL8A 1S5JA 4K0KB 2P22C 2DYSB 4QNHB 2MW2B 4O2AB 3SR2C 3JSNA 4LFCO 4JI6B 2DN9A 2P7TC 2LJ2A 4JI0B 3S3XA 2NLJC 4XDLA 2VQEB 3JALA 4UV8A 4WCEV 5L3BA 5IYZA 5CA1A 1KKCA 2Q73A 2YEVA 1Y67A 3MDSA 3T4DA 2FMLA 2JGUA 1UPGA 5L3CA 1LUVA 5E1AC 4DXWA 2CDYA 3QVNA 1XNRB 3CS5A 5GTHZ 1SZTA 1IBKB 3B8NA 1QLEB 2DMXA 4CH3A 1XMQO 2UUBB 1MNGA 2GSMB 1NBMG 4G28B 2B1IA 3IGAC 4X66O 1YDXA 4X88A 4ABMA 4F6RB 2ZNIA 2AW9A 3I56V 3CRCA 1ZSPA 2JEXA 5EBMC 4Q6GA 3OM3B 2WWWA 1OCCB 1P84F 4X1KA 4TWKA 4X62O 2YUAA 4UCUA 4I7ZB 2OCCB 2Q8VA 2YXYA 5B1AB 3W7UA 5DN6G 2DJVA 3HKBA 1VIBA 3BPZA 3ASOC 3H9VA 4DUZO 1NR7A 1FJGB 5IJ9A 4J42A 3VQXA 3M7MX 4MS2A 1H2LA 2CUGA 1US6A 4X62B 2ZNJA 3H1LH 5GW7A 1UJWB 3OEHG 4BIOA 4K35A 4PJ0Z 1Z2GA 3SYQA 3NR7A 4ZKIA 3WB0A 5H2FZ 4DR3O 1L8DA 4NXNO 4D7SA 2ZE6A 2QKCA 1V55C 4QJFB 4JAAA 3SDLA 4AI8A 4JYAO 3CRMA 5EIBC 1J5EO 3AK1A 1E79G 3BHPA 4JAVA 2IJJA 1D5NA 2Z0AA 1URFA 4O4IA 1IBLB 4GT1A 1M56B 4H33A 1EN4A 2E76B 1WPXA 4FIPC 3GWKC 4B3SB 4X64B 1PNMA 3KG2A 4JYCA 4ZI7A 3CCJV 2FYUH 2KSDA 3CCMV 1JMKC 2BSKA 3H1IH 3KZIZ 1R6NA 4OPHA 1VQMV 1HP8A 1NVPD 3CRQA 4YHHB 5L3GA 2X0LA 4BIZA 2ZE8A 2OT5A 3F7VC 4QE9A 1JQ0A 1T5EA 4ZBMA 1EFRG 4I0XB 3K58A 4J7ZA 1FD9A 4DR5O 3D36A 3RVZA 2QTOA 4FZ1A 4WFAV 2BTOA 4DR6B 1Z5VA 1K4DC 4NYKA 3APQA 3RYIB 4TQDA 3ZIAG 1XUQA 1UFIA 4UXNA 5JWPA 4TT3G 3SPIA 2ILMA 2QM7A 3ABMC 4NR1A 1DTOA 5LHGA 4JYBA 1TUBB 2RN9A 1I08A 1IXMA 2F23A 1VQ9V 3R65A 4B3MB 4LH6A 1N36O 4OX9O 5B1OA 4X1YA 4XDJA 2R9RB 1NI8A 1M56C 3LSQA 2CTRA 1COWG 2ZT9B 1BS3A 3D36C 4YIOA 2EBOA 2UXDB 4I55B 4B3RB 3O65A 3W7TA 1M57B 5FLXN 5CB4B 2XNDG 3JASA 5C93A 3SPGA 5A9GA 4TQFA 1JJOA 2GTSA 4PA3A 1M90W 1G1XB 1BE3H 1XBLA 3AG1C 1I7FA 3E22A 1QCEA 2KQXA 3Q4HA 4PA6A 5TISZ 4TV9A 5KMGA 1R3IC 4CS2A 2LW7A 4RWUA 3ASOB 3CRRA 4Z1VA 1WN7A 4AQYB 4GZRB 3RYFA 4LFBB 1JFFA 5CBGA 1SQXH 3FX7A 2WLLA 2CE4A 1Q6IA 3CRAA 1QNMA 4K8ZA 1R1BA 2OTJV 3JD2A 1JA8A 1NS1A 2N74A 4G2KA 2ZM6O 1VF6A 3SPJA 1WNSA 4IIJA 1XQ8A 4NTWA 4FFKA 4MVUA 4JI2B 4UVBA 2FL4A 3HKEB 4DR1O 1QLEC 2UXXA 3H1KH 1KMIZ 3RT3C 5CBHA 1V54C 1S5HC 3G67A 4U3JB 3ZS8C 2HEPA 3MHHC 2QKAA 2Q67A 3ZRSA 1HWYA 1N8RW 1N34B 1PV0A 1FPOA 2DYRB 4CS4A 1OHHG 2F43G 5BMVA 5LMUB 2IH1C 5JCOC 2WLNA 1TUEB 3AG4C 4EKWA 3FB5C 4DO2A 4PHZA 1MG1A 2RDCA 2IU0A 2Q7EA 3B2EE 2F93B 4FFBA 4BR6A 3ZRWA 3GWOA 2VWKA 1JOYA 5IJ9B 4F6RA 3B77A 5EYPA 3HKBB 3X2QC 3U0ZA 3SJQC 3H1HH 3ETGA 4FLTA 2NNUA 5IYZB 4AHCA 2FTKA 1NU1H 3OMNB 1GM8A 4U3JA 4WFFA 5JH7B 1VARA 3ZN1A 2YC0A 1Y74A 4LWSB 5IY5B 3R66A 4ZIBA 1H2GA 2NN4A 2C2AA 4MVRA 4LNUA 1SZXA 2CH7A 2Q6AA 4Z2WA 2JJ2G 3IJ4A 1ZWIC 2N05A 3MHSC 4IIJB 1NTZH 3FAVA 1IBLO 4NVPA 3L71H 4U7NA 1KQSU 4DV3B 1Q43A 3ZHSA 5KHKA 2YEVB 2YS8A 2GUZB 5D5QA 3T1YO 1VMGA 4N23A 1NR1A 2GHYA 1U97A 3OGCC 4J80A 4FLWA 1ZUQA 2PZSA 2MK3A 1K73W 4RQFA 2XASA 2QGNA 2ZQMA 3CCRV 2GDSA 4TOIA 2GUZA 3T1YB 2HJDA 2YIBA 5B3SC 3ABTA 1WP7A 2EZPA 3RYFB 5JJEB 1H38A 4UFZA 4PDRA 1N33B 2X6AA 2JDIG 3D3IA 5DECA 3SPCA 5L3FA 4DV0O 1YZBA 3Q4HB 4LF6B 1EZVH 3IC9A 4UB6Z 2F4VO 3LNNA 3FYEB 3N2KB 3THOA 3JD0A 1PNLA 1AJNA 1F7YA 2PI5A 1K4CC 1KBHA 3CCVV 3CE2A 5AG2A 1H2SB 4H0LB 2P67A 2QKSA 3G4SV 4GKJB 1ZL8B 1BSMA 2ZM6B 2JS5A 2QWQB 1AI4A 3C3SA 2W0XA 4LF4O 3OD4A 3TK1A 1AVMA 1NQTA 3STZC 5LA6B 4PDLA 1YXBA 1I5YA 2EJ7A 1TUBA 3QO7A 4A5UB 2Z5UA 4DR1B 5BMVB 3JATA 4GKJO 1H2NA 3JYCA 4YXWG 3N2KA 3DXRB 3OR6C 1E1RG 4DR6O 3ETQA 1VF7A 2LQTA 2R9IA 3RYIA 1CP9A 2YXHA 2VQEO 1RM1C 3HB3B 2RQ6A 4HYOA 2XT9A 3OMAB 1NH2D 4TUYB 1XDCA 3FB8C 3JD4A 3HKEA 3QNEA 2W6JG 3OUFA 1ZLZA 2IJKA 4JI3B 4IT5A 2LW1A 3JCZA 1YITV 5LXTB 4PDVA 5K1XA 2QWPB 1YVWA 2IJHA 3CSXA 4MW3A 2Q9LA 1BQ0A 5J2UA 1GN3A 1P4RA 4FM1A 5HFMA 3K59A 4CS3A 3CX5F 5B1AC 2QEXV 1IZ3A 2JIZG 1IX9A 4CZZA 2YI8A 3AG2C 1WJZA 1IJGA 2B5UA 1BCCH 1L1FA 4R6ZA 1VQ6V 3ETDA 4RAIA 1QHTA 1K97A 5B1BB 1FKAO 3A8TA 1VQNV 1DLBA 4FZ0A 1PKXA 1NJIW 5BZBA 5C8YB 1SERA 2FB5A 1BT8A 5KX5A 1YSCA 3OE7G 2CH7B 4J7KA 3UKMA 4JZGA 4IL6Z 3K9AA 3QTCA 5KMGB 1FOUA 3F7YC 1FAFA 2K9PA 1PD3A 1MSDA 2OCHA 3P32A 3ABUA 3HKDB 1SQQH 3S3WA 3QO5A 2QM8A 1SS3A 5LP6B 1NKDA 3WG7C 4P9OA 1CPYA 2A0LA 3ABKB 4I55A 5JH7A 3CWBH 1O9GA 1YJNV 4P30A 1OCOB 4GX0A 3VBBA 2IU3A 5B1NA 5L3DA 4UB8Z 3AG3C 4I4TB 3CMEV 2QWNB 4LH7A 3BAAA 3ZMUA 3JATB 4NTXA 4YY3O 5CA0A 5EC2C 3OFNG 2JGDA 2HHHO 4PV1B 2HR3A 2Y69B 5BY1A 3ZCCA 3CJHB 1HDJA 1SQFA 3K9SA 2N04A 4TSFG 2ITCC 1R3JC 2IBZH 4RUFA 1MSWD 1KP3A 2XAFA 1ZL8A 4QPJA 3T2MA 4B7EA 4BWAA 3W7SA 2QJ1A 3SYPA 4PA9A 4EB6B 3FB7C 4XBFA 1D2DA 3KCYA 3ZMZA 5IYDO 1DF4A 3M99B 1N32O 4I5SA 3VOUA 3J80N 1B04A 1QVFU 5FPOA 4FLXA 4IYHA 1NTKH 3ML0A 3ABMB 2UXCB 3FKSG 2ARHA 2V4DA 4FK5C 1K5QA 5CA1B 5K1PA 2EIKC 4EFEA 2WLIB 1SRYA 3K3WA 5J2TB 2ODMA 2WSSG 2LO1A 2YI9A 1X4TA 4P2ZA 3AEIA 1GN6A 3BCCH 2UU9O 2OYQA 2AHZA 1VQKV 1IDSA 1I94O 3ABKC 4KHPB 4X20A 4MSWC 1GN2A 1YCIA 3TJTA 2WA4A 1KP2A 4W4LA 1R73A 2BOCC 4BW5A 2E74B 5J2UB 1S72V 2CTQA 1G6UA 4B3MO 3ZMVA 3AK2A 1R3LC 5KUKA 3I5DA 1L0LH 2ZKOA 1I94B 3LDDA 1FXKB 1XNQB 5LMNB 2H8PC 3UO3A 1K7DA 5GONA 1PM9A 2P90A 1N0JA 5KAIZ 2GV9A 4PI2A 1Y4MA 1VQ4V 4LC1A 1SKVA 2ZE5A 1FFXB 4L87A 3K06A 1IBMO 1QR9A 1MMMA 1NT2B 3HKCA 4EFBA 3ZRWB 3A2FA 3CYOA 3T1HB 1YTFB 4DRXA 1Y76A 3LDCA 1N4CA 2EIJC 4X1IA 4X1KB 1YF2A 4N21A 5CB4A 3CHXA 1XOUA 1KUQA 1XNRO 4O4LA 3ZX6A 4DW0A 1SQVH 5LGNA 3KKYA 2XAJA 1XMQB 1Y76B 2X6BA 2XAQA 3ZHQA 5EC1C 1KD1W 1HR0O 2VQFB 1P7GA 2YXLA 4LF7B 5KUMA 3CCLV 1YJWV 1QLNA 4FLVA 3UT5B 2ZINA 5BR8B 3N2GA 4MT8A 5JJJB 4JI6O 2ITDC 1K3EA 4HAMA 4OXSA 4DRXB 4JI0O 5KHGA 1LNQA 1B3QA 5IYCO 5KHJA 3JAKA 2AHYA 4LFAB 4MW8A 1S0VA 4C7UA 3T1CA 1FFXA 1FXKC 3SYAA 2WA3A 4CH5A 4DV7O 1EN6A 4F4LA 2ZE7A 3BABA 2ZXWC 4YJ3A 1RPRA 3EXAA 3E35A 3OT7A 2UXBO 2A79B 4JI5B 3E89A 3E8FA 2X7RB 1XL4A 1K34A 3ETEA 5KA6A 4IHJA 1VQOV 1K9MW 1GM9A 2E5LB 2JJ1G 1PP9H 2ADQB 2VRZA 1KB9F 2QWOB 3G80A 1OV9A 2Y69C 2VWJA 1OCZC 1H2KA 3OR7C 3RFRA 2Q7GA 3RYCA 1KKDA 1AI6A 1R6KA 4LF8B 4DV2B 2E5LO 5FL7G 4CC6A 3A0RA 4ZHQB 3CMAV 1YI2V 3BY6A 2P6JA 1JR9A 2ZXWB 1GMGA 2QSAA 1QQCA 5LOVA 4LCUC 1PNKA 4LF5B 4MVOA 2CAZC 4ICGA 4X9QA 5IWAB 4GX2A 4KHPO 3N27A 4DR2B 2OIGA 4TV8B 1CEZA 3EHBB 4R7CA 4RUEA 4JTAB 4CC5A 5CA0B 1XI1A 3OW2U 2Z3YA 3TGUH 3MD0A 1J5EB 4J10A 2JVDA 5LBQA 3ZHVA 4Z1MG 2PYLA 1XMOO 3JSLA 3L9DA 2CTWA 2P4KA 2P4VA 2EX3A 1W0JG 3CXHF 2XAHA 3STLC 5LOVB 1ZX3A 4JAUA 1YIJV 4XDKA 4JI1O 4P9PA 4J41A 3UCSC 3CC2V 2HLDG 1N36B 4OX9B 5FNVB 2EJRA 2XUMA 1JCHA 4WFEA 1H5WA 5HFLA 2BTQA 1Y66A 2LFRA 2M7WA 2B9ZA 1SF9A 3SJAC 1H2MA 3LSSA 4JI1B 3C90A 3JARB 4MVSA 3SJBC 3CCQV 1D5AA 4YY3B 4KUMA 2RNBA 2PI4A 2HHHB 2WLLB 4X20B 2HVJC 1OCRB 4DR5B 2ZDIC 3CPWU 4FMTA 2WAMA 3DC6A 5ITZA 4B3TB 1FXVA 2UUCO 3SJCC 3FAVB 5KHIA 1JX9A 3D8CA 1Q5OA 1XNQO 1WP8A 3G6EV 5JVDB 3UQ8A 3VQWA 5BR8O 1QBZA 1HNWO 2IW5A 4FM0A 3OGIB 1PL4A 4KP4A 1H8EG 3CP1A 3K03A 3EVKA 3P3NA 1IURA 3SYOA 2A7WA 2UUAB 3LDEA 1SA0B 4JYYA 2Y4TA 1AJPA 1G4YB 4DW1A 2DQ0A 1TGOA 1HNWB 3B40A 5A2QN 4B3RO 2DE0X 1WB8A 2A3QA 4DV4O 4LFCB 4H13B 5F2VO 4R50A 2Q69A 4DV5B 4YJ2B 4HBNA 1VF5B 3LSUA 1MZFA 1GM7A 4UCSA 4FLUA 1AJQA 2G38A 3K04A 1OCRC 2JGDB 3WB2A 2O57A 1K5SA 4UCRA 4LBEC 2DWDC 4UCTA 1VP7A 1Q6HA 4FFBB 1FXKA 1NH2B 4H37A 1FXHA 3C3TA 4PI0A 1W0KG 2IM9A 4FLZA 2IJIA 2W6IG 3QF7A 3DGEA 4O2BB 4DV7B 4I0XA 1GH6A 2PUSA 5KX5B 4MVZA 5LP6C 5GONB 2E3CA 1CXZB 3WFVA 1FYJA 1EZJA 2PTMA 2EILB 2EIKB 4DR2O 2Q68A 4D7TA 2ATKC 2K1EA 4JASA 5LHIA 1AR4A 2KKWA 1JPXA 4B3SO 1FFTB 4JV5B 4O2AA 3CC4V 4YJ3B 1O9HA 3L74H 3P30A 4X64O 4I50B 2NR5A 2QDOA 1BQZA 2R70A 3CEIA 1BHAA 3TCUA 2ETNA 4WFHA 4LFAO 3WU2Z 4FPPA 3W7XA 1SQBH 1TAEA 5B1BC 3E22B 2FKXA 2L6LA 2BTQB 5LGUA 1XHZA 2LGWA 1NZ6A 2EINC 3ZRXA 4I9QA 3U11A 4JYAB 4NTYA 4PDMA 4GUNA 4OGQB 2YDEA 2AZ2A 4LF9B 3LUTB 1QR8A 3D3QA 3VQVA 1VQ7V 1OJHA 3K79A 3JAMN 1AR1B 4WF9V 2RCVA 4LF5O 3E2EA 1V54B 2WLHA 2AZ0A 2KB1A 1N32B 2CGOA 5IYBO 5LMUO 4GCZA 3FB6C 3L75H 1Q81W 4IGGA 1AROP
chains in the Genus database with same CATH topology
2CE4A 1SZXA 1MSDA 1AP6A 1QNMA 3BFRA 1MNGA 1PM9A 1JA8A 1N0JA 3C3TA 1LUWA 2ADQB 1B06A 4FFKA 2AW9A 1ZSPA 1WB7A 1MMMA 3DC6A 1XDCA 1IXBA 1AP5A 1XILA 1ZUQA 1ZLZA 1VEWA 1XUQA 1JR9A 1XREA 3K9SA 2QKAA 1N0NA 3AK3A 1AR4A 3KKYA 2GDSA 1I0HA 1PL4A 4F6EA 1ZTEA 1I08A 1AR5A 1GN3A 3EVKA 4JZ2A 1P7GA 3CEIA 1IX9A 4X9QA 4JYYA 4BR6A 1BS3A 4YIOA 1WB8A 2QKCA 2ADPA 3IC9A 4E4EA 4GUNA 3AK1A 1EN5A 1D5NA 4C7UA 3DC5A 1BT8A 1GN6A 5A9GA 2P4KA 4YIPA 1IDSA 3LSUA 5AG2A 1EN4A 1GN2A 1KKCA 4JZGA 1EN6A 3TJTA 1Y67A 2RCVA 3MDSA 1EM1A 3KDRA 1MA1A 1BSMA 1LUVA 3C3SA 3OT7A 2CDYA 3QVNA 1VARA 1AVMA 3AK2A 3RN4A 1GN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CE4 A;  1SZX A;  1MSD A;  1AP6 A;  1QNM A;  3BFR A;  1MNG A;  1PM9 A;  1JA8 A;  1N0J A;  3C3T A;  1LUW A;  2ADQ B;  1B06 A;  4FFK A;  2AW9 A;  1ZSP A;  1WB7 A;  1MMM A;  3DC6 A;  1XDC A;  1IXB A;  1AP5 A;  1XIL A;  1ZUQ A;  1ZLZ A;  1VEW A;  1XUQ A;  1JR9 A;  1XRE A;  3K9S A;  2QKA A;  1N0N A;  3AK3 A;  1AR4 A;  3KKY A;  2GDS A;  1I0H A;  1PL4 A;  4F6E A;  1ZTE A;  1I08 A;  1AR5 A;  1GN3 A;  3EVK A;  4JZ2 A;  1P7G A;  3CEI A;  1IX9 A;  4X9Q A;  4JYY A;  4BR6 A;  1BS3 A;  4YIO A;  1WB8 A;  2QKC A;  2ADP A;  3IC9 A;  4E4E A;  4GUN A;  3AK1 A;  1EN5 A;  1D5N A;  4C7U A;  3DC5 A;  1BT8 A;  1GN6 A;  5A9G A;  2P4K A;  4YIP A;  1IDS A;  3LSU A;  5AG2 A;  1EN4 A;  1GN2 A;  1KKC A;  4JZG A;  1EN6 A;  3TJT A;  1Y67 A;  2RCV A;  3MDS A;  1EM1 A;  1MA1 A;  1BSM A;  1LUV A;  3C3S A;  3OT7 A;  2CDY A;  3QVN A;  1VAR A;  1AVM A;  3AK2 A;  3RN4 A;  1GN4 A; 
#chains in the Genus database with same CATH topology
 1GKF A;  1M5I A;  3BFR A;  1HNX B;  2JRI A;  3F5W C;  1YTF D;  2XOK G;  3FFQ A;  3UO2 A;  3H01 A;  3ZHR A;  2QR4 A;  3ABL C;  5B5E Z;  1I5X A;  2L35 A;  5EYP B;  5EZY B;  2WLJ A;  1HW7 A;  4FJC C;  4JPR A;  5EZY A;  3ICX A;  5LP6 A;  2UXN A;  2LFS A;  2YIB D;  2UUA O;  4X1I B;  1XIL A;  4LF4 B;  3OMI B;  3G6B A;  4DV1 O;  1J95 A;  1XRE A;  3E8B A;  3OEE G;  2DYR C;  2F95 B;  4JGS A;  5IWA O;  4CH4 A;  2BSK B;  3RBZ A;  1EBO A;  1I0H A;  5ITZ B;  3ASN B;  1L0N H;  2Y0P A;  4X8A A;  1PL0 A;  1JVM A;  1WPB A;  1AI5 A;  4DV1 B;  5C8Y A;  2R9A A;  3SYC A;  5KLV H;  3EFF K;  1Q7Y W;  1P49 A;  2IH3 C;  3FD9 A;  4NKG B;  1VQ5 V;  4B3T O;  1F4M A;  5J2T A;  2GTA A;  2OTL V;  1ENV A;  3RGB A;  2ADP A;  4LP8 A;  4I50 A;  4DV3 O;  4BAY A;  2QA4 V;  4MTG A;  4O4H B;  2PGG A;  3DC5 A;  1M57 C;  4QGP A;  2JS3 A;  2YIC A;  5CN0 A;  4NB5 A;  4DR7 O;  4H44 B;  2A9H A;  3BVO A;  3PN1 A;  3TET A;  4RQE A;  5JCO A;  2OIE A;  5BXZ A;  3AG7 A;  4MTF A;  4UUJ C;  1VQL V;  1HR0 B;  4KFM A;  2WPD G;  2RJZ A;  3CJH A;  4O2B A;  4KXR A;  4B7K A;  1OCC C;  3I55 V;  1RPO A;  1Q8I A;  4DR7 B;  4QE7 A;  4J7J A;  5JJN B;  3CCS V;  1XL6 A;  5IJ0 A;  1VF6 C;  2RMK B;  2BCC H;  5LYJ A;  1GRJ A;  3TXQ A;  2YID A;  2YIA A;  2E75 B;  2EUL A;  3GB7 C;  1M93 A;  3ZBH A;  3CB2 A;  3E83 A;  4J11 A;  4EEQ A;  2PY5 A;  4G27 B;  4JI2 O;  2UXD O;  5B66 Z;  4GX1 A;  4JI4 O;  1XEQ A;  3L72 H;  3B09 A;  1QVG U;  1DGS A;  4YJ2 A;  4E2L A;  2HG5 C;  1N34 O;  1FS0 G;  4GX5 A;  1AR5 A;  5IE9 A;  4JZ2 A;  4JI4 B;  4I9W A;  1BMF G;  1KU9 A;  2W0F C;  2HVK C;  2XAG A;  4AIL C;  4JI8 B;  4NXM O;  1IBK O;  2KG7 B;  5DED A;  3J7A U;  4HNA B;  4BIU A;  2HJF C;  2WLK A;  3KCX A;  4Q20 A;  3CC7 V;  1GK9 A;  1OCO C;  1YEW A;  3QG5 A;  4HZ3 A;  1EN5 A;  1MOF A;  1HNZ O;  4JI8 O;  4NXM B;  4DUY O;  1BHB A;  3WG7 B;  1V9P A;  1PPJ H;  3ZED A;  2Q0A A;  4JV5 O;  3K5L A;  1JNB A;  4L8J A;  4GKK B;  3X2Q B;  1R3K C;  3KDR A;  1EM1 A;  1RSO A;  4O4J A;  5JQG B;  1U96 A;  3CD6 V;  1SQG A;  4U7O A;  1WA8 A;  3IFX A;  2H94 A;  1NTM H;  2LGQ A;  2HKO A;  4UV9 A;  2R72 A;  4D6T H;  3H1J H;  2XTA A;  4TUY A;  3AG4 B;  1OZ0 A;  2Q5Z A;  2V1D A;  5EBW C;  1OCZ B;  5CA3 A;  2AGA A;  1H8H G;  2UU9 B;  1AI7 A;  3J81 N;  1A32 A;  3T4Z A;  5LGT A;  1ZAU A;  1BZK A;  2WLM A;  3E8G A;  1Q90 D;  4NXN B;  3RYH B;  4RO2 A;  4DR4 B;  3N2G B;  2A06 H;  1KYO F;  2AXT Z;  1XHX A;  2ZIO A;  2P5O A;  5B3S B;  3L70 H;  2D2C B;  2EIN B;  4X89 A;  5L3E A;  1VQP V;  4I4T A;  5LMN O;  1DF5 A;  1DK1 A;  1TVK B;  4F6E A;  5LHH A;  3NXS A;  5E79 Z;  3CXC U;  3AG2 B;  5CBF A;  1Y74 B;  4LWS A;  1YHQ V;  4O4L B;  4WFB V;  1B6Q A;  4K3A A;  3LNM B;  1AB3 A;  1TVK A;  3T1H O;  3RYH A;  4LF6 O;  3K5N A;  5IJ0 B;  5KHH A;  2EIJ B;  1F4N A;  4JTD B;  2OWO A;  3HPL C;  2OCC C;  5H5N A;  4JI7 B;  2JEU A;  1YJ9 V;  1GO3 F;  3IAY A;  1QU7 A;  3F5T A;  2EIM B;  3M8A A;  3GVM A;  1HNX O;  2F66 C;  3SGI A;  4DK1 A;  2VQF O;  4JI3 O;  1W59 A;  2Q0O C;  1WA8 B;  3DSQ A;  4ZOL B;  1BGY H;  3JAL B;  4LF7 O;  1W2B U;  3RN4 A;  3BEH A;  3DTU B;  4LR3 A;  1Q6U A;  4FM2 A;  3K0G A;  1Q86 W;  3B4S A;  3JCU Z;  1B06 A;  2EIM C;  3ABL B;  4DV5 O;  4MTX A;  3AG3 B;  1N33 O;  2UUB O;  2CK3 G;  4GYC B;  5LXT A;  1G8M A;  4W4K A;  1SET A;  3QO8 A;  5D5P A;  1RM1 B;  4X66 B;  5H6Q A;  4DV6 O;  2CGN A;  4O4H A;  2DWE C;  4DYL A;  1AP5 A;  3JAS B;  3U10 A;  3G71 V;  5FNV A;  1S3J A;  1VQ8 V;  1RP3 B;  1P7B A;  3L73 H;  5KAF Z;  4TV9 B;  4PA7 A;  4O4J B;  2WLI A;  4PD4 F;  2X6C A;  1LR1 A;  2DW4 A;  4LFB O;  2EIL C;  1ROP A;  2GBO A;  5H6R A;  5DM6 V;  4GLX A;  1Q82 W;  1FJG O;  3ZHU A;  4LNU B;  3UT5 A;  4X65 B;  2ZR3 A;  4ASU G;  4GKK O;  1Y6X A;  1JJ2 U;  1IBM B;  4LF8 O;  1TA8 A;  4TV8 A;  1MAB G;  5IDJ A;  2H3O A;  1ORQ C;  4DK0 A;  3JAK B;  3JD3 A;  4R8C A;  1NVP B;  4CBC A;  3DXR A;  2KG7 A;  1RFY A;  4IYI A;  2ZD9 A;  3OTO B;  4WBN B;  3W7W A;  2YSU B;  4CH6 A;  3K57 A;  4PEL A;  1WAZ A;  4WBN A;  3OTF A;  4OPA A;  1K33 A;  2UXB B;  3CCE V;  3WB1 A;  4K8X A;  2Y48 A;  4JI5 O;  1S76 D;  5LYJ B;  2VS0 A;  3E8H A;  4X1Y B;  2BE3 A;  3K08 A;  1GN4 A;  3PJS K;  3ASN C;  4UCO A;  3OTO O;  1SC5 B;  4DUZ B;  3AG1 B;  2ZR2 A;  3TXS A;  4UVA A;  3ZMT A;  4UVC A;  4MTO A;  1S77 D;  1LUW A;  3ZRV A;  2P06 A;  1Z5W A;  4DUY B;  4JTC B;  3O9O A;  4ZHQ A;  2UXC O;  4WFG A;  3K5O A;  4LF9 O;  2ZCE A;  5FPR A;  1SA0 A;  2Y0I A;  4B08 A;  5GTI Z;  3MAQ A;  3CCU V;  4DV2 O;  4FLY A;  3A0B Z;  3RYC B;  4UCV A;  4DR3 B;  4J9Y B;  2DOS A;  3BA9 A;  4ZI7 B;  3HR0 A;  1R6T A;  5JVD A;  5CMU A;  2Q4P A;  1N0N A;  5LL6 Y;  3AK3 A;  2DYS C;  4IHJ B;  3SPH A;  3A0H Z;  1ZTE A;  3RVY A;  2QM4 A;  4EB6 A;  4JF3 A;  1RSO B;  3OUS A;  4ZOL A;  1K92 A;  5JQG A;  3APO A;  2LP7 A;  4BW9 A;  4HNA A;  4JI7 O;  1MZE A;  1HNZ B;  2JK5 C;  1JFF B;  1F23 A;  1AIL A;  1V55 B;  4DR4 O;  5EBL C;  4QPK A;  5H9C A;  3BRC A;  3OAA G;  3JAR A;  1SES A;  4E4E A;  3JD1 A;  1WLE A;  1XMO B;  2QE7 G;  4O4I B;  1F51 A;  4KL1 A;  2F1M A;  2XHB A;  4YIP A;  4MVM A;  3B8M A;  5KA5 A;  1IVS A;  1M4U A;  4PA4 A;  1MA1 A;  3ZN0 A;  1THZ A;  1K8A W;  3FYI B;  2BOB C;  1M9N A;  5LA6 A;  3K5M A;  1SQP H;  3UM7 A;  4QIW F;  3K0D A;  1KEC A;  1S5L Z;  3VQY A;  2CTP A;  1AP6 A;  3JAW B;  3HKC B;  2ZDI A;  4DV6 B;  4DV4 B;  2HFE C;  1GTO A;  4AQY O;  5EK0 A;  5IT9 N;  2QTS A;  2ZIM A;  2Q7H A;  3RWR D;  2PF4 E;  1Q3E A;  1WB7 A;  2DQ3 A;  3JAW A;  3BA8 A;  4DV0 B;  2HP8 A;  1X59 A;  4J9Z B;  2UUC B;  3ZJZ A;  2B1G A;  1M1K W;  1IXB A;  1E1Q G;  3P3P A;  2PYJ A;  2F4V B;  4FVM A;  2V7Q G;  5EIB D;  4YHH O;  2D3O W;  3ZHT A;  4X65 O;  3E86 A;  1VEW A;  4K0K O;  2EZO A;  3IC7 A;  3HKD A;  2M6Y A;  4MVQ A;  3ZMS A;  1KC8 W;  3RW0 A;  2Y4U A;  5IY5 C;  2QWR B;  5J9P C;  4U3F H;  1GAX A;  1BL8 A;  1S5J A;  4K0K B;  2P22 C;  2DYS B;  4QNH B;  2MW2 B;  4O2A B;  3SR2 C;  3JSN A;  4LFC O;  4JI6 B;  2DN9 A;  2P7T C;  2LJ2 A;  4JI0 B;  3S3X A;  2NLJ C;  4XDL A;  2VQE B;  3JAL A;  4UV8 A;  4WCE V;  5L3B A;  5IYZ A;  5CA1 A;  1KKC A;  2Q73 A;  2YEV A;  1Y67 A;  3MDS A;  3T4D A;  2FML A;  2JGU A;  1UPG A;  5L3C A;  1LUV A;  5E1A C;  4DXW A;  2CDY A;  3QVN A;  1XNR B;  3CS5 A;  5GTH Z;  1SZT A;  1IBK B;  3B8N A;  1QLE B;  2DMX A;  4CH3 A;  1XMQ O;  2UUB B;  1MNG A;  2GSM B;  1NBM G;  4G28 B;  2B1I A;  3IGA C;  4X66 O;  1YDX A;  4X88 A;  4ABM A;  4F6R B;  2ZNI A;  2AW9 A;  3I56 V;  3CRC A;  1ZSP A;  2JEX A;  5EBM C;  4Q6G A;  3OM3 B;  2WWW A;  1OCC B;  1P84 F;  4X1K A;  4TWK A;  4X62 O;  2YUA A;  4UCU A;  4I7Z B;  2OCC B;  2Q8V A;  2YXY A;  5B1A B;  3W7U A;  5DN6 G;  2DJV A;  3HKB A;  1VIB A;  3BPZ A;  3ASO C;  3H9V A;  4DUZ O;  1NR7 A;  1FJG B;  5IJ9 A;  4J42 A;  3VQX A;  3M7M X;  4MS2 A;  1H2L A;  2CUG A;  1US6 A;  4X62 B;  2ZNJ A;  3H1L H;  5GW7 A;  1UJW B;  3OEH G;  4BIO A;  4K35 A;  4PJ0 Z;  1Z2G A;  3SYQ A;  3NR7 A;  4ZKI A;  3WB0 A;  5H2F Z;  4DR3 O;  1L8D A;  4NXN O;  4D7S A;  2ZE6 A;  2QKC A;  1V55 C;  4QJF B;  4JAA A;  3SDL A;  4AI8 A;  4JYA O;  3CRM A;  5EIB C;  1J5E O;  3AK1 A;  1E79 G;  3BHP A;  4JAV A;  2IJJ A;  1D5N A;  2Z0A A;  1URF A;  4O4I A;  1IBL B;  4GT1 A;  1M56 B;  4H33 A;  1EN4 A;  2E76 B;  1WPX A;  4FIP C;  3GWK C;  4B3S B;  4X64 B;  1PNM A;  3KG2 A;  4JYC A;  4ZI7 A;  3CCJ V;  2FYU H;  2KSD A;  3CCM V;  1JMK C;  2BSK A;  3H1I H;  3KZI Z;  1R6N A;  4OPH A;  1VQM V;  1HP8 A;  1NVP D;  3CRQ A;  4YHH B;  5L3G A;  2X0L A;  4BIZ A;  2ZE8 A;  2OT5 A;  3F7V C;  4QE9 A;  1JQ0 A;  1T5E A;  4ZBM A;  1EFR G;  4I0X B;  3K58 A;  4J7Z A;  1FD9 A;  4DR5 O;  3D36 A;  3RVZ A;  2QTO A;  4FZ1 A;  4WFA V;  2BTO A;  4DR6 B;  1Z5V A;  1K4D C;  4NYK A;  3APQ A;  3RYI B;  4TQD A;  3ZIA G;  1XUQ A;  1UFI A;  4UXN A;  5JWP A;  4TT3 G;  3SPI A;  2ILM A;  2QM7 A;  3ABM C;  4NR1 A;  1DTO A;  5LHG A;  4JYB A;  1TUB B;  2RN9 A;  1I08 A;  1IXM A;  2F23 A;  1VQ9 V;  3R65 A;  4B3M B;  4LH6 A;  1N36 O;  4OX9 O;  5B1O A;  4X1Y A;  4XDJ A;  2R9R B;  1NI8 A;  1M56 C;  3LSQ A;  2CTR A;  1COW G;  2ZT9 B;  1BS3 A;  3D36 C;  4YIO A;  2EBO A;  2UXD B;  4I55 B;  4B3R B;  3O65 A;  3W7T A;  1M57 B;  5FLX N;  5CB4 B;  2XND G;  3JAS A;  5C93 A;  3SPG A;  5A9G A;  4TQF A;  1JJO A;  2GTS A;  4PA3 A;  1M90 W;  1G1X B;  1BE3 H;  1XBL A;  3AG1 C;  1I7F A;  3E22 A;  1QCE A;  2KQX A;  3Q4H A;  4PA6 A;  5TIS Z;  4TV9 A;  5KMG A;  1R3I C;  4CS2 A;  2LW7 A;  4RWU A;  3ASO B;  3CRR A;  4Z1V A;  1WN7 A;  4AQY B;  4GZR B;  3RYF A;  4LFB B;  1JFF A;  5CBG A;  1SQX H;  3FX7 A;  2WLL A;  2CE4 A;  1Q6I A;  3CRA A;  1QNM A;  4K8Z A;  1R1B A;  2OTJ V;  3JD2 A;  1JA8 A;  1NS1 A;  2N74 A;  4G2K A;  2ZM6 O;  1VF6 A;  3SPJ A;  1WNS A;  4IIJ A;  1XQ8 A;  4NTW A;  4FFK A;  4MVU A;  4JI2 B;  4UVB A;  2FL4 A;  3HKE B;  4DR1 O;  1QLE C;  2UXX A;  3H1K H;  1KMI Z;  3RT3 C;  5CBH A;  1V54 C;  1S5H C;  3G67 A;  4U3J B;  3ZS8 C;  2HEP A;  3MHH C;  2QKA A;  2Q67 A;  3ZRS A;  1HWY A;  1N8R W;  1N34 B;  1PV0 A;  1FPO A;  2DYR B;  4CS4 A;  1OHH G;  2F43 G;  5BMV A;  5LMU B;  2IH1 C;  5JCO C;  2WLN A;  1TUE B;  3AG4 C;  4EKW A;  3FB5 C;  4DO2 A;  4PHZ A;  1MG1 A;  2RDC A;  2IU0 A;  2Q7E A;  3B2E E;  2F93 B;  4FFB A;  4BR6 A;  3ZRW A;  3GWO A;  2VWK A;  1JOY A;  5IJ9 B;  4F6R A;  3B77 A;  5EYP A;  3HKB B;  3X2Q C;  3U0Z A;  3SJQ C;  3H1H H;  3ETG A;  4FLT A;  2NNU A;  5IYZ B;  4AHC A;  2FTK A;  1NU1 H;  3OMN B;  1GM8 A;  4U3J A;  4WFF A;  5JH7 B;  1VAR A;  3ZN1 A;  2YC0 A;  1Y74 A;  4LWS B;  5IY5 B;  3R66 A;  4ZIB A;  1H2G A;  2NN4 A;  2C2A A;  4MVR A;  4LNU A;  1SZX A;  2CH7 A;  2Q6A A;  4Z2W A;  2JJ2 G;  3IJ4 A;  1ZWI C;  2N05 A;  3MHS C;  4IIJ B;  1NTZ H;  3FAV A;  1IBL O;  4NVP A;  3L71 H;  4U7N A;  1KQS U;  4DV3 B;  1Q43 A;  3ZHS A;  5KHK A;  2YEV B;  2YS8 A;  2GUZ B;  5D5Q A;  3T1Y O;  1VMG A;  4N23 A;  1NR1 A;  2GHY A;  1U97 A;  3OGC C;  4J80 A;  4FLW A;  1ZUQ A;  2PZS A;  2MK3 A;  1K73 W;  4RQF A;  2XAS A;  2QGN A;  2ZQM A;  3CCR V;  2GDS A;  4TOI A;  2GUZ A;  3T1Y B;  2HJD A;  2YIB A;  5B3S C;  3ABT A;  1WP7 A;  2EZP A;  3RYF B;  5JJE B;  1H38 A;  4UFZ A;  4PDR A;  1N33 B;  2X6A A;  2JDI G;  3D3I A;  5DEC A;  3SPC A;  5L3F A;  4DV0 O;  1YZB A;  3Q4H B;  4LF6 B;  1EZV H;  3IC9 A;  4UB6 Z;  2F4V O;  3LNN A;  3FYE B;  3N2K B;  3THO A;  3JD0 A;  1PNL A;  1AJN A;  1F7Y A;  2PI5 A;  1K4C C;  1KBH A;  3CCV V;  3CE2 A;  5AG2 A;  1H2S B;  4H0L B;  2P67 A;  2QKS A;  3G4S V;  4GKJ B;  1ZL8 B;  1BSM A;  2ZM6 B;  2JS5 A;  2QWQ B;  1AI4 A;  3C3S A;  2W0X A;  4LF4 O;  3OD4 A;  3TK1 A;  1AVM A;  1NQT A;  3STZ C;  5LA6 B;  4PDL A;  1YXB A;  1I5Y A;  2EJ7 A;  1TUB A;  3QO7 A;  4A5U B;  2Z5U A;  4DR1 B;  5BMV B;  3JAT A;  4GKJ O;  1H2N A;  3JYC A;  4YXW G;  3N2K A;  3DXR B;  3OR6 C;  1E1R G;  4DR6 O;  3ETQ A;  1VF7 A;  2LQT A;  2R9I A;  3RYI A;  1CP9 A;  2YXH A;  2VQE O;  1RM1 C;  3HB3 B;  2RQ6 A;  4HYO A;  2XT9 A;  3OMA B;  1NH2 D;  4TUY B;  1XDC A;  3FB8 C;  3JD4 A;  3HKE A;  3QNE A;  2W6J G;  3OUF A;  1ZLZ A;  2IJK A;  4JI3 B;  4IT5 A;  2LW1 A;  3JCZ A;  1YIT V;  5LXT B;  4PDV A;  5K1X A;  2QWP B;  1YVW A;  2IJH A;  3CSX A;  4MW3 A;  2Q9L A;  1BQ0 A;  5J2U A;  1GN3 A;  1P4R A;  4FM1 A;  5HFM A;  3K59 A;  4CS3 A;  3CX5 F;  5B1A C;  2QEX V;  1IZ3 A;  2JIZ G;  1IX9 A;  4CZZ A;  2YI8 A;  3AG2 C;  1WJZ A;  1IJG A;  2B5U A;  1BCC H;  1L1F A;  4R6Z A;  1VQ6 V;  3ETD A;  4RAI A;  1QHT A;  1K97 A;  5B1B B;  1FKA O;  3A8T A;  1VQN V;  1DLB A;  4FZ0 A;  1PKX A;  1NJI W;  5BZB A;  5C8Y B;  1SER A;  2FB5 A;  1BT8 A;  5KX5 A;  1YSC A;  3OE7 G;  2CH7 B;  4J7K A;  3UKM A;  4JZG A;  4IL6 Z;  3K9A A;  3QTC A;  5KMG B;  1FOU A;  3F7Y C;  1FAF A;  2K9P A;  1PD3 A;  1MSD A;  2OCH A;  3P32 A;  3ABU A;  3HKD B;  1SQQ H;  3S3W A;  3QO5 A;  2QM8 A;  1SS3 A;  5LP6 B;  1NKD A;  3WG7 C;  4P9O A;  1CPY A;  2A0L A;  3ABK B;  4I55 A;  5JH7 A;  3CWB H;  1O9G A;  1YJN V;  4P30 A;  1OCO B;  4GX0 A;  3VBB A;  2IU3 A;  5B1N A;  5L3D A;  4UB8 Z;  3AG3 C;  4I4T B;  3CME V;  2QWN B;  4LH7 A;  3BAA A;  3ZMU A;  3JAT B;  4NTX A;  4YY3 O;  5CA0 A;  5EC2 C;  3OFN G;  2JGD A;  2HHH O;  4PV1 B;  2HR3 A;  2Y69 B;  5BY1 A;  3ZCC A;  3CJH B;  1HDJ A;  1SQF A;  3K9S A;  2N04 A;  4TSF G;  2ITC C;  1R3J C;  2IBZ H;  4RUF A;  1MSW D;  1KP3 A;  2XAF A;  1ZL8 A;  4QPJ A;  3T2M A;  4B7E A;  4BWA A;  3W7S A;  2QJ1 A;  3SYP A;  4PA9 A;  4EB6 B;  3FB7 C;  4XBF A;  1D2D A;  3KCY A;  3ZMZ A;  5IYD O;  1DF4 A;  3M99 B;  1N32 O;  4I5S A;  3VOU A;  3J80 N;  1B04 A;  1QVF U;  5FPO A;  4FLX A;  4IYH A;  1NTK H;  3ML0 A;  3ABM B;  2UXC B;  3FKS G;  2ARH A;  2V4D A;  4FK5 C;  1K5Q A;  5CA1 B;  5K1P A;  2EIK C;  4EFE A;  2WLI B;  1SRY A;  3K3W A;  5J2T B;  2ODM A;  2WSS G;  2LO1 A;  2YI9 A;  1X4T A;  4P2Z A;  3AEI A;  1GN6 A;  3BCC H;  2UU9 O;  2OYQ A;  2AHZ A;  1VQK V;  1IDS A;  1I94 O;  3ABK C;  4KHP B;  4X20 A;  4MSW C;  1GN2 A;  1YCI A;  3TJT A;  2WA4 A;  1KP2 A;  4W4L A;  1R73 A;  2BOC C;  4BW5 A;  2E74 B;  5J2U B;  1S72 V;  2CTQ A;  1G6U A;  4B3M O;  3ZMV A;  3AK2 A;  1R3L C;  5KUK A;  3I5D A;  1L0L H;  2ZKO A;  1I94 B;  3LDD A;  1FXK B;  1XNQ B;  5LMN B;  2H8P C;  3UO3 A;  1K7D A;  5GON A;  1PM9 A;  2P90 A;  1N0J A;  5KAI Z;  2GV9 A;  4PI2 A;  1Y4M A;  1VQ4 V;  4LC1 A;  1SKV A;  2ZE5 A;  1FFX B;  4L87 A;  3K06 A;  1IBM O;  1QR9 A;  1MMM A;  1NT2 B;  3HKC A;  4EFB A;  3ZRW B;  3A2F A;  3CYO A;  3T1H B;  1YTF B;  4DRX A;  1Y76 A;  3LDC A;  1N4C A;  2EIJ C;  4X1I A;  4X1K B;  1YF2 A;  4N21 A;  5CB4 A;  3CHX A;  1XOU A;  1KUQ A;  1XNR O;  4O4L A;  3ZX6 A;  4DW0 A;  1SQV H;  5LGN A;  3KKY A;  2XAJ A;  1XMQ B;  1Y76 B;  2X6B A;  2XAQ A;  3ZHQ A;  5EC1 C;  1KD1 W;  1HR0 O;  2VQF B;  1P7G A;  2YXL A;  4LF7 B;  5KUM A;  3CCL V;  1YJW V;  1QLN A;  4FLV A;  3UT5 B;  2ZIN A;  5BR8 B;  3N2G A;  4MT8 A;  5JJJ B;  4JI6 O;  2ITD C;  1K3E A;  4HAM A;  4OXS A;  4DRX B;  4JI0 O;  5KHG A;  1LNQ A;  1B3Q A;  5IYC O;  5KHJ A;  3JAK A;  2AHY A;  4LFA B;  4MW8 A;  1S0V A;  4C7U A;  3T1C A;  1FFX A;  1FXK C;  3SYA A;  2WA3 A;  4CH5 A;  4DV7 O;  1EN6 A;  4F4L A;  2ZE7 A;  3BAB A;  2ZXW C;  4YJ3 A;  1RPR A;  3EXA A;  3E35 A;  3OT7 A;  2UXB O;  2A79 B;  4JI5 B;  3E89 A;  3E8F A;  2X7R B;  1XL4 A;  1K34 A;  3ETE A;  5KA6 A;  4IHJ A;  1VQO V;  1K9M W;  1GM9 A;  2E5L B;  2JJ1 G;  1PP9 H;  2ADQ B;  2VRZ A;  1KB9 F;  2QWO B;  3G80 A;  1OV9 A;  2Y69 C;  2VWJ A;  1OCZ C;  1H2K A;  3OR7 C;  3RFR A;  2Q7G A;  3RYC A;  1KKD A;  1AI6 A;  1R6K A;  4LF8 B;  4DV2 B;  2E5L O;  5FL7 G;  4CC6 A;  3A0R A;  4ZHQ B;  3CMA V;  1YI2 V;  3BY6 A;  2P6J A;  1JR9 A;  2ZXW B;  1GMG A;  2QSA A;  1QQC A;  5LOV A;  4LCU C;  1PNK A;  4LF5 B;  4MVO A;  2CAZ C;  4ICG A;  4X9Q A;  5IWA B;  4GX2 A;  4KHP O;  3N27 A;  4DR2 B;  2OIG A;  4TV8 B;  1CEZ A;  3EHB B;  4R7C A;  4RUE A;  4JTA B;  4CC5 A;  5CA0 B;  1XI1 A;  3OW2 U;  2Z3Y A;  3TGU H;  3MD0 A;  1J5E B;  4J10 A;  2JVD A;  5LBQ A;  3ZHV A;  4Z1M G;  2PYL A;  1XMO O;  3JSL A;  3L9D A;  2CTW A;  2P4K A;  2P4V A;  2EX3 A;  1W0J G;  3CXH F;  2XAH A;  3STL C;  5LOV B;  1ZX3 A;  4JAU A;  1YIJ V;  4XDK A;  4JI1 O;  4P9P A;  4J41 A;  3UCS C;  3CC2 V;  2HLD G;  1N36 B;  4OX9 B;  5FNV B;  2EJR A;  2XUM A;  1JCH A;  4WFE A;  1H5W A;  5HFL A;  2BTQ A;  1Y66 A;  2LFR A;  2M7W A;  2B9Z A;  1SF9 A;  3SJA C;  1H2M A;  3LSS A;  4JI1 B;  3C90 A;  3JAR B;  4MVS A;  3SJB C;  3CCQ V;  1D5A A;  4YY3 B;  4KUM A;  2RNB A;  2PI4 A;  2HHH B;  2WLL B;  4X20 B;  2HVJ C;  1OCR B;  4DR5 B;  2ZDI C;  3CPW U;  4FMT A;  2WAM A;  3DC6 A;  5ITZ A;  4B3T B;  1FXV A;  2UUC O;  3SJC C;  3FAV B;  5KHI A;  1JX9 A;  3D8C A;  1Q5O A;  1XNQ O;  1WP8 A;  3G6E V;  5JVD B;  3UQ8 A;  3VQW A;  5BR8 O;  1QBZ A;  1HNW O;  2IW5 A;  4FM0 A;  3OGI B;  1PL4 A;  4KP4 A;  1H8E G;  3CP1 A;  3K03 A;  3EVK A;  3P3N A;  1IUR A;  3SYO A;  2A7W A;  2UUA B;  3LDE A;  1SA0 B;  4JYY A;  2Y4T A;  1AJP A;  1G4Y B;  4DW1 A;  2DQ0 A;  1TGO A;  1HNW B;  3B40 A;  5A2Q N;  4B3R O;  2DE0 X;  1WB8 A;  2A3Q A;  4DV4 O;  4LFC B;  4H13 B;  5F2V O;  4R50 A;  2Q69 A;  4DV5 B;  4YJ2 B;  4HBN A;  1VF5 B;  3LSU A;  1MZF A;  1GM7 A;  4UCS A;  4FLU A;  1AJQ A;  2G38 A;  3K04 A;  1OCR C;  2JGD B;  3WB2 A;  2O57 A;  1K5S A;  4UCR A;  4LBE C;  2DWD C;  4UCT A;  1VP7 A;  1Q6H A;  4FFB B;  1FXK A;  1NH2 B;  4H37 A;  1FXH A;  3C3T A;  4PI0 A;  1W0K G;  2IM9 A;  4FLZ A;  2IJI A;  2W6I G;  3QF7 A;  3DGE A;  4O2B B;  4DV7 B;  4I0X A;  1GH6 A;  2PUS A;  5KX5 B;  4MVZ A;  5LP6 C;  5GON B;  2E3C A;  1CXZ B;  3WFV A;  1FYJ A;  1EZJ A;  2PTM A;  2EIL B;  2EIK B;  4DR2 O;  2Q68 A;  4D7T A;  2ATK C;  2K1E A;  4JAS A;  5LHI A;  1AR4 A;  2KKW A;  1JPX A;  4B3S O;  1FFT B;  4JV5 B;  4O2A A;  3CC4 V;  4YJ3 B;  1O9H A;  3L74 H;  3P30 A;  4X64 O;  4I50 B;  2NR5 A;  2QDO A;  1BQZ A;  2R70 A;  3CEI A;  1BHA A;  3TCU A;  2ETN A;  4WFH A;  4LFA O;  3WU2 Z;  4FPP A;  3W7X A;  1SQB H;  1TAE A;  5B1B C;  3E22 B;  2FKX A;  2L6L A;  2BTQ B;  5LGU A;  1XHZ A;  2LGW A;  1NZ6 A;  2EIN C;  3ZRX A;  4I9Q A;  3U11 A;  4JYA B;  4NTY A;  4PDM A;  4GUN A;  4OGQ B;  2YDE A;  2AZ2 A;  4LF9 B;  3LUT B;  1QR8 A;  3D3Q A;  3VQV A;  1VQ7 V;  1OJH A;  3K79 A;  3JAM N;  1AR1 B;  4WF9 V;  2RCV A;  4LF5 O;  3E2E A;  1V54 B;  2WLH A;  2AZ0 A;  2KB1 A;  1N32 B;  2CGO A;  5IYB O;  5LMU O;  4GCZ A;  3FB6 C;  3L75 H;  1Q81 W;  4IGG A;  1ARO P; 
#chains in the Genus database with same CATH homology
 2CE4 A;  1SZX A;  1MSD A;  1AP6 A;  1QNM A;  3BFR A;  1MNG A;  1PM9 A;  1JA8 A;  1N0J A;  3C3T A;  1LUW A;  2ADQ B;  1B06 A;  4FFK A;  2AW9 A;  1ZSP A;  1WB7 A;  1MMM A;  3DC6 A;  1XDC A;  1IXB A;  1AP5 A;  1XIL A;  1ZUQ A;  1ZLZ A;  1VEW A;  1XUQ A;  1JR9 A;  1XRE A;  3K9S A;  2QKA A;  1N0N A;  3AK3 A;  1AR4 A;  3KKY A;  2GDS A;  1I0H A;  1PL4 A;  4F6E A;  1ZTE A;  1I08 A;  1AR5 A;  1GN3 A;  3EVK A;  4JZ2 A;  1P7G A;  3CEI A;  1IX9 A;  4X9Q A;  4JYY A;  4BR6 A;  1BS3 A;  4YIO A;  1WB8 A;  2QKC A;  2ADP A;  3IC9 A;  4E4E A;  4GUN A;  3AK1 A;  1EN5 A;  1D5N A;  4C7U A;  3DC5 A;  1BT8 A;  1GN6 A;  5A9G A;  2P4K A;  4YIP A;  1IDS A;  3LSU A;  5AG2 A;  1EN4 A;  1GN2 A;  1KKC A;  4JZG A;  1EN6 A;  3TJT A;  1Y67 A;  2RCV A;  3MDS A;  1EM1 A;  3KDR A;  1MA1 A;  1BSM A;  1LUV A;  3C3S A;  3OT7 A;  2CDY A;  3QVN A;  1VAR A;  1AVM A;  3AK2 A;  3RN4 A;  1GN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...