2ADPA

Nitrated human manganese superoxide dismutase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
196
structure length
195
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Crystal structure of nitrated human manganese superoxide dismutase: mechanism of inactivation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 70
structure length 195
sequence length 196
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 2adpA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 2adpA02
1XREA 4JZGA 1BS3A 1AP6A 1VEWA 1MSDA 1GN2A 1XUQA 4JYYA 2AW9A 1XDCA 3BFRA 3MDSA 2CDYA 4YIPA 3AK3A 4F6EA 1QNMA 3KKYA 2ADPA 2P4KA 4BR6A 3RN4A 4JZ2A 4GUNA 1MMMA 3QVNA 1ZTEA 3CEIA 4YIOA 1AP5A 1MA1A 1ZUQA 3EVKA 4E4EA 1IDSA 2ADQB 1N0NA 3C3TA 1Y67A 2CE4A 1EN4A 3OT7A 5AG2A 1AR4A 1IX9A 1B06A 1ZSPA 2QKAA 3DC6A 3IC9A 1KKCA 3LSUA 1I08A 1SZXA 1AVMA 1PM9A 1BSMA 2RCVA 1EM1A 1LUVA 1PL4A 1WB7A 4FFKA 1MNGA 2QKCA 1P7GA 1VARA 1XILA 1EN5A 2GDSA 4C7UA 1GN4A 1JR9A 3K9SA 3C3SA 3AK1A 3TJTA 1I0HA 1EN6A 1D5NA 1IXBA 4X9QA 1JA8A 1N0JA 1ZLZA 3AK2A 1WB8A 1GN6A 1BT8A 3DC5A 1LUWA 5A9GA 1GN3A 1AR5A
chains in the Genus database with same CATH superfamily
2EIKC 1QVFU 2NR5A 1JJ2U 2HLDG 3KDRA 1M9NA 2Q7HA 1GN2A 4UVAA 1ROPA 2WLNA 1MG1A 2JJ1G 4K0KB 4PI2A 4WF9V 4FMTA 2KQXA 4H37A 4F6EA 4B3TB 3D36A 4DW0A 4RAIA 2EX3A 2ZDIC 3CRMA 4JI4B 2H3OA 1P84F 2ZM6B 1H2KA 3HR0A 4CZZA 1K7DA 4B3MO 4YJ3B 3CCEV 4RUFA 3CCRV 1K9MW 3QTCA 1NR7A 2IJKA 5KHJA 2ZNIA 3R65A 3LNMB 4OX9O 3MHHC 3SJAC 4JTDB 2YC0A 2ADQB 4FLXA 2FYUH 2CUGA 2WLKA 1M1KW 3RYFA 2EIMB 2GV9A 2JGDB 2A0LA 1XNQO 3IC9A 4D7TA 3W7XA 1M57B 1YHQV 1SZXA 4DR4B 3RT3C 2VQEB 4DUZB 4DV3B 3EXAA 3BHPA 1K92A 1KECA 1MZFA 2ZCEA 3H1IH 1XHZA 1N32B 4LP8A 3TK1A 2ZQMA 2CTWA 5J9PC 1J5EO 3RYHA 1NI8A 1J95A 3C3SA 4B3RB 2BOCC 5CMUA 3TJTA 2BSKA 4O4LA 4DV5B 1AI4A 5C93A 2CGOA 2PY5A 1ENVA 1IJGA 1KU9A 1SQGA 2F93B 3QNEA 5L3GA 1P7BA 4DR6B 1VQ8V 3ABUA 3G80A 5E79Z 4B7KA 2UUAB 2RJZA 3OGCC 3JAKA 2ATKC 3PN1A 4PI0A 4LF8O 5KUKA 1YJNV 2CTRA 5CBHA 1K4DC 1Q5OA 1S3JA 3SPIA 1N8RW 1H8HG 4YHHB 4ABMA 4PDRA 5KA6A 2CTPA 1WLEA 4FJCC 3EHBB 3WB0A 5BR8O 4UXNA 2UXDB 4JYAB 1P4RA 1RPOA 3ETDA 1N34O 1W59A 3CJHA 4PA9A 3CPWU 2CE4A 2Q4PA 2IJJA 4MVQA 3C90A 4DV6B 3M99B 2ZKOA 4X64B 1HNWB 2DYSC 2ZE6A 1SS3A 1ZSPA 3TGUH 3N2KB 2H8PC 2QKAA 3DC6A 1NH2D 2P06A 4JI0B 4JI8B 3E8FA 2UU9O 2VWKA 4GYCB 4DV2B 4AQYB 2VQFO 2FB5A 4MVSA 5IYDO 2WSSG 1EN5A 2OIEA 3TXQA 5BY1A 3ASOC 1XL4A 1BHBA 1IBKO 3K5NA 3ZMUA 1SA0B 5LXTB 1VQPV 2EINB 4Q6GA 1NKDA 1D5NA 4CS2A 3BY6A 1SQFA 2GUZA 1FJGO 3MHSC 3HKDA 2Q0AA 4W4KA 1JMKC 4NTWA 4F4LA 1XEQA 4LWSA 1LUWA 4EFEA 3JALA 1GN3A 3OUSA 4UVCA 2HFEC 2B9ZA 4X1YB 3E35A 1QBZA 3E86A 4GX2A 2D3OW 1SETA 4BIUA 4YJ2A 5JQGA 2UUCO 1S72V 1Y74B 4ZOLB 2BTQA 5EZYB 1HNXB 1S77D 3HKCB 1CXZB 2YIDA 3JD4A 2A79B 4DR1B 3AK3A 3IAYA 3APQA 2DE0X 4MTOA 2Q68A 3AG2B 4HZ3A 2DYRC 2F1MA 5JH7B 4DV4B 2WA4A 4DRXA 1S0VA 3ZJZA 4LF5O 1FFXA 2OYQA 3JASA 1H5WA 2Y4TA 5LOVA 3OGIB 4DO2A 1OCCC 4JI5B 1R6TA 2KB1A 4OPAA 1D5AA 1SF9A 3SJCC 3RYIA 4DR5O 4PA7A 4J7ZA 4HBNA 1EFRG 1GMGA 3JD2A 3CCUV 5LMUO 1FAFA 4FPPA 2IM9A 4UCOA 4X66O 2R9RB 1EM1A 2L6LA 3BAAA 3CXHF 3D36C 2MK3A 1KQSU 4U3JB 3K9SA 3JAWB 2KSDA 1MABG 4MVUA 3RBZA 3CCJV 4ZKIA 3FFQA 4DR7O 5JVDA 4X65O 3VQVA 2NLJC 4R8CA 4TV8A 3DGEA 3FYIB 2ZIOA 4I55B 2UXBB 4B08A 3CRCA 3AG1C 2VS0A 2QWOB 2QM4A 2RN9A 1MZEA 1AR5A 2Q5ZA 3ASNC 4I5SA 4DR3O 4PV1B 2LGWA 4LCUC 1E1RG 2ZDIA 5J2TB 2AW9A 3CX5F 2W0XA 4KXRA 4PD4F 3ZHRA 1QR8A 3LSSA 1AI6A 2YI9A 5B1NA 4PHZA 4IGGA 1V54B 3ETGA 3OAAG 1KUQA 2EBOA 4X8AA 1NTKH 5LHHA 3JATB 3ETEA 4FLYA 3E8BA 3CCMV 1D2DA 2F4VB 4MVZA 5CA1B 4DV0O 3H1HH 2WLIB 3ZRWB 1XHXA 1N0NA 3UT5A 1KP2A 2Q6AA 4X1KB 1AR4A 2DMXA 3NXSA 2V7QG 4TSFG 3B8MA 3D3IA 1N36B 2JEXA 2XAJA 4YY3O 4JI2B 2HEPA 3L75H 1KKCA 1ZX3A 4TUYB 3QO7A 4LNUA 1VQNV 1XL6A 1FPOA 4JI4O 2XNDG 3F5WC 1YDXA 5LP6B 3U11A 1VQ5V 4WCEV 2R72A 3JYCA 1JR9A 4DV1B 3IJ4A 3RVZA 3HKBA 3WB1A 4QGPA 3P32A 4WBNB 4UB6Z 5DEDA 5LBQA 3OEHG 3ZRXA 5FPRA 4JYCA 1GTOA 4R50A 2R70A 2VQEO 4DV3O 5CN0A 2P90A 2P67A 4B3SB 1BS3A 3JD0A 4PDVA 1VQ6V 4KHPO 1VEWA 4ZIBA 1MOFA 2EILC 1H2GA 3BFRA 3JARB 1HNZB 4DV5O 5KAIZ 3A2FA 1QNMA 3I55V 2YIBA 1NBMG 4BR6A 4K3AA 1MSWD 3M7MX 2EULA 4DR2O 1JNBA 4MVOA 1W0KG 5B1OA 2IU3A 3P3NA 3OFNG 1GRJA 5EC2C 4NXNO 1YF2A 1L1FA 4JTAB 1K5QA 2QTOA 3AG7A 5CB4A 1YSCA 2F43G 4MTXA 4MS2A 1F23A 3R66A 4IYHA 2UXXA 3CCVV 1H2LA 2YIBD 3K03A 5DM6V 1SQBH 1PL0A 2E5LB 3LSUA 1I08A 1YEWA 2RCVA 2YEVA 3JD3A 3AG3B 4FFKA 4JGSA 2ETNA 2K9PA 2QWQB 4RWUA 5L3BA 1JVMA 1RP3B 4X62O 2CH7B 2M7WA 3ABLC 5KMGB 3F7VC 1GKFA 2ILMA 4UCSA 5DN6G 4KFMA 5JCOA 1K8AW 4PA6A 3CRQA 2Q69A 3OMIB 4X64O 5IDJA 1HNWO 1RPRA 4LFBO 4LF9B 3THOA 1BL8A 1ZLZA 4JI0O 2WPDG 3DC5A 4TWKA 3T2MA 1M56B 4RQEA 2YS8A 1OCRB 1IBLO 3A0RA 1AP6A 1XMQB 1IBMB 2XOKG 4J10A 3MDSA 5EBMC 4X89A 1THZA 5B3SB 1QVGU 1FXKB 2ARHA 5GW7A 3WU2Z 3RYCB 4JI7B 5KHIA 5LGTA 2FKXA 4IIJA 2B1IA 3A0BZ 5KHKA 1Q81W 3K08A 2LGQA 4XDLA 1JFFA 4TV9A 4MTFA 5L3FA 5BXZA 2P4VA 1MA1A 2WA3A 1PNKA 2A7WA 5C8YA 5KHGA 5EYPB 1O9GA 3E83A 4NXMO 1GM7A 2ZE5A 3K0GA 1OCZB 3ABTA 4I0XB 5IT9N 1XQ8A 3Q4HA 5IJ9A 3GVMA 4WFHA 3SGIA 3RYHB 2Q67A 5D5PA 3AG4B 4GKKO 4AHCA 4HYOA 2UXCO 3RW0A 2A06H 5BZBA 4JF3A 4GZRB 3QO5A 3SPCA 3CC4V 2HVKC 1TGOA 1IZ3A 4JI3B 4JI5O 5JWPA 5J2UA 1F7YA 1HR0B 4JV5B 5GTIZ 1AR1B 3IFXA 4X20A 1JA8A 3LDEA 3K59A 3BABA 5LA6B 4CBCA 4EB6A 3P3PA 4PA4A 1Q6HA 1I94O 3E22A 2F95B 3KCYA 2WWWA 3CXCU 4UV8A 2EJRA 1VF7A 3K57A 1K4CC 2CK3G 3ETQA 4WFAV 2HJFC 1JJOA 4LH6A 3K0DA 5GTHZ 5IYZA 4JI6B 1LNQA 3SDLA 3K5LA 2ZINA 2ZIMA 4LF7B 3W7TA 3SYAA 2L35A 3N2GB 3CC2V 3CP1A 3HKEB 1FOUA 2Y0PA 4YJ3A 1K3EA 3X2QB 1I5XA 3RN4A 4JZ2A 2CTQA 4F6RB 5JJNB 2UXBO 2IBZH 4A5UB 4HNAB 2ZXWC 1V54C 2KKWA 4WFBV 4UFZA 4R6ZA 4EFBA 3H1JH 4LF4O 3OTOB 2ZNJA 3APOA 5KA5A 2WLLB 2JGDA 3SR2C 4O4JB 4ASUG 1EN4A 5A2QN 5AG2A 4TOIA 4UCRA 3B77A 4LFCO 3SPGA 4FLTA 4I4TA 4I50B 1XI1A 2PZSA 2BCCH 4P9PA 2Y4UA 5IY5B 1WAZA 4P30A 3UM7A 3GB7C 1G8MA 4O2BB 3G71V 3DXRA 1YJ9V 3ABKB 1B04A 4G2KA 3T1YB 5EIBC 3WB2A 1OV9A 2GUZB 5LP6C 4IHJB 3B09A 3FAVB 2KG7A 5GONB 4DXWA 1N33O 1CPYA 1SRYA 3LNNA 5ITZB 4O2AA 3CSXA 4EEQA 3OEEG 1N36O 3IC7A 1BMFG 2RMKB 1YTFD 5DECA 2PYLA 4K35A 1RM1C 1XNRB 1L8DA 4BWAA 2JIZG 1WJZA 2XAHA 1X59A 3OTFA 2WLMA 3FKSG 1VQOV 3STLC 1SERA 2PTMA 2UUBB 1WPXA 2CDYA 2HJDA 2E3CA 1GO3F 3HPLC 4BW9A 4GKJB 4CH6A 5JCOC 4G27B 1I7FA 3W7UA 4LF6O 3K9AA 3E8GA 2QWRB 2EIJB 2QTSA 2FTKA 5CA0B 3RYIB 2YUAA 5FNVB 1FKAO 4B3SO 1EBOA 5KHHA 4P2ZA 1Y6XA 3ABMB 4LFAO 4LR3A 1OCOC 3EVKA 1K97A 3KG2A 1WN7A 3N2KA 4D7SA 2CAZC 2LW7A 4ZBMA 1UPGA 3ZX6A 3UQ8A 1Y76B 2OCCB 3QO8A 1WA8B 2FMLA 4I7ZB 1FXVA 5LYJA 1M4UA 1S5HC 1PM9A 3BVOA 4U3FH 1VQ7V 5H5NA 1XMOB 2HG5C 2M6YA 5IJ0B 1SA0A 1K34A 1P7GA 3B2EE 3JCZA 4B3MB 4TV8B 3CD6V 5B1BB 5HFLA 3ZN0A 2BOBC 2JGUA 2HR3A 1PPJH 4N23A 4X9QA 4BIOA 4PDMA 2QJ1A 2W6IG 2P6JA 2JJ2G 3OM3B 2Y69B 2E5LO 4X1YA 4PELA 4LH7A 4WFEA 2PI5A 5HFMA 2WAMA 2Q8VA 1Y74A 1SKVA 4B7EA 3CE2A 1VQMV 4ZOLA 4DW1A 4ZI7B 3HKCA 5H6QA 4RO2A 3CB2A 1M56C 4MW8A 1Q6UA 1G4YB 1OCRC 1XUQA 5KX5A 5LHGA 1QLEC 5JH7A 4KUMA 3LSQA 3B8NA 2UXNA 4X88A 3WG7B 2ADPA 2Z3YA 1FXKC 3JCUZ 3SYPA 3QVNA 5L3EA 3VBBA 4TQDA 4YIOA 2RDCA 1ZL8B 1KD1W 2XT9A 1QLNA 1XMQO 5IYBO 4E4EA 3I5DA 2E76B 3K79A 2H94A 4WFFA 3VQXA 1IBMO 2QM7A 4LF8B 1VQ9V 1IXMA 1IURA 4DV7O 1YXBA 4JI1B 2LP7A 3NR7A 1TA8A 2BTOA 3FX7A 3QF7A 4NR1A 3LUTB 3ZMZA 3ZHTA 2G38A 2Q7EA 4FM1A 2HHHB 4ZHQB 1OCZC 4U3JA 4IYIA 3QG5A 1BSMA 3ZMVA 4FVMA 3HKBB 1RSOB 4DK0A 1Q82W 2QEXV 4X1IB 4QPJA 2GHYA 3AG4C 2LO1A 5F2VO 1VQKV 4K0KO 3UKMA 4MT8A 3MD0A 4J7JA 1N34B 1GH6A 1NR1A 1SQPH 2YXHA 1DTOA 4B3TO 2DWEC 4I55A 1YJWV 3UCSC 2QWPB 4H44B 1TUBA 4RUEA 2EIMC 3ZHQA 1LR1A 2WLHA 3VQYA 1A32A 2IH3C 1R6NA 2ZM6O 5IWAB 4CC6A 1M57C 2C2AA 2GTSA 2Y0IA 2JDIG 2YXLA 3DSQA 5A9GA 2PF4E 5J2TA 1JOYA 1R6KA 2VQFB 3FB7C 4QIWF 4N21A 3ICXA 2OWOA 1IVSA 3OW2U 1IBKB 3OR7C 3PJSK 3SYCA 2JS5A 4YXWG 1VIBA 2W6JG 1ZWIC 2GBOA 4DR4O 3ZMSA 4DUZO 3CCQV 2O57A 1FJGB 2XHBA 5CB4B 1N32O 4FZ0A 5CA1A 1N4CA 3ZIAG 2XAFA 3A8TA 5H9CA 1OJHA 2WLIA 4BIZA 3ZRWA 5FLXN 1B3QA 3ASOB 4B3RO 4O4IA 1OHHG 2F23A 4X1KA 2NN4A 2Z0AA 4KP4A 4L87A 1IX9A 4DR6O 4JAVA 1NVPB 2MW2B 5LP6A 3CS5A 2HP8A 1AVMA 1K5SA 4JAUA 5IYCO 2UUAO 3ZN1A 4QJFB 1PL4A 4FFBB 2QKCA 4LF5B 2X7RB 1PNLA 2P7TC 4JPRA 4WBNA 3E2EA 4XBFA 2PUSA 3T1CA 5EIBD 3K5MA 2NNUA 1GK9A 3G67A 4YHHO 4J42A 1IXBA 4OXSA 4FLZA 5BMVB 2Q0OC 1TAEA 2R9IA 4DR5B 2DJVA 1FYJA 3AK2A 2DYRB 3H01A 3G6BA 1YCIA 2UXDO 4JYAO 5LMUB 3HB3B 5E1AC 4X66B 5L3DA 1W2BU 4NTYA 4O4HB 4GX5A 3BPZA 2Q73A 4GX0A 1PP9H 4U7NA 2QE7G 4DV6O 5CBFA 5CA3A 3BA9A 2DWDC 2AXTZ 2EINC 2W0FC 1V55B 5EBWC 4TV9B 4JI8O 4UCVA 2RNBA 4WFGA 4OGQB 1SESA 3KKYA 4DV2O 2P4KA 4AQYO 4DR7B 2OTLV 2XTAA 4X65B 1M93A 1G6UA 1MMMA 3U10A 5B1AB 3SJQC 1XNRO 1AP5A 2IW5A 4FM0A 1ZUQA 4H13B 4E2LA 3G6EV 4NTXA 3AEIA 2LFSA 1Z2GA 1NU1H 3BEHA 3FB5C 3ABMC 1XBLA 3T1HB 1US6A 3M8AA 3GWKC 1JCHA 3AG2C 5EBLC 3ZBHA 1NS1A 2QWNB 3ZHSA 3AG1B 3RYFB 5KMGA 2OCCC 1OZ0A 1LUVA 2OIGA 4W4LA 1TVKA 4X20B 4KL1A 2Z5UA 1VARA 4Z2WA 2V4DA 4L8JA 3K58A 1HNXO 3O9OA 4DR1O 2AZ0A 5B1BC 4DV0B 1AB3A 2A3QA 2B1GA 1BZKA 2ZE7A 1BQ0A 3RVYA 4DV4O 2BSKB 4O4LB 3O65A 4CH3A 2P5OA 4LBEC 4YY3B 5IYZB 1GN6A 1BT8A 2BE3A 4K8ZA 2DQ3A 2Y69C 1XMOO 3UO3A 4DK1A 3ZEDA 4FLVA 3I56V 4G28B 4TQFA 1Q8IA 2PYJA 5FPOA 1FXKA 1R3JC 1MSDA 1H2NA 3K3WA 4IL6Z 4FM2A 4DUYB 3RYCA 1S76D 3JAKB 4GCZA 1SQXH 1AROP 4MW3A 3J81N 5K1PA 1P49A 4J11A 3T4DA 2QDOA 3H1LH 4JAAA 3L74H 3P30A 2AHYA 4GUNA 1U97A 2XUMA 3WG7C 1DGSA 5LGUA 5EYPA 4I4TB 3CWBH 1NH2B 1X4TA 1NTMH 1HW7A 4I0XA 1H8EG 4KHPB 2GTAA 3DXRB 2OT5A 2DW4A 3OT7A 1YTFB 3SPHA 1Y4MA 1E1QG 3CJHB 4UVBA 3L71H 1H2SB 4U7OA 3W7SA 5LMNB 2EZPA 4NVPA 1WP7A 1H2MA 4J9ZB 3F5TA 4PJ0Z 2KG7B 3U0ZA 4DR2B 4JASA 4ICGA 4O2AB 2HKOA 1KYOF 5LA6A 1QR9A 4NXNB 1SQVH 1VF6C 2EILB 3B4SA 2D2CB 1COWG 1I0HA 4CH5A 4JI1O 2PI4A 2Y48A 4CH4A 1WP8A 3OE7G 4JYBA 2K1EA 3GWOA 3K06A 4QPKA 2HHHO 3H1KH 2AGAA 5LGNA 3HKDB 2F4VO 3LDDA 4XDKA 1XREA 2X6CA 1R3LC 2LFRA 3FB6C 3JAMN 3N2GA 3HKEA 1XOUA 4X62B 4LWSB 3JALB 4JYYA 1Q86W 1PV0A 1BHAA 4F6RA 1AI5A 3OMAB 4JI2O 1KP3A 4YIPA 1R1BA 1M90W 2IU0A 1Q43A 4HNAA 4YJ2B 5JQGB 3CCLV 2BTQB 4LFBB 5IWAO 1NT2B 2HVJC 2WLLA 1K73W 2E74B 4DV1O 2AHZA 3RFRA 4O4JA 1QHTA 3A0HZ 3ABLB 2QGNA 4DRXB 1IBLB 1FFXB 4I50A 5LYJB 3LDCA 5JJEB 1IDSA 2LW1A 4UV9A 4CS4A 3JASB 1UJWB 5LOVB 4UCTA 4O2BA 3S3XA 1PKXA 3ZCCA 1B06A 3OUFA 2JK5C 4NB5A 4J7KA 3L70H 1HP8A 4PDLA 1L0NH 4IHJA 3FAVA 5GONA 1MNGA 5LHIA 2YSUB 1S5JA 1GN4A 1T5EA 1KBHA 5ITZA 1HNZO 1Z5VA 5H6RA 3K5OA 3E89A 2ITCC 3AK1A 1Q6IA 1B6QA 1KC8W 1EZJA 3ZS8C 1KKDA 3IGAC 4GX1A 4NXMB 1HDJA 5EK0A 3T4ZA 4GT1A 1R3IC 2EIKB 5KX5B 5LXTA 1SZTA 5JVDB 4AILC 3BRCA 3ZHUA 3JSNA 3DTUB 4P9OA 3AG3C 1H38A 3BA8A 4AI8A 1CEZA 4GKKB 4OX9B 2UXCB 4RQFA 4I9QA 1I5YA 1XDCA 3JD1A 2VWJA 3B40A 1YITV 1FS0G 1ORQC 2IJIA 4FZ1A 3CRRA 3RWRD 3STZC 1DK1A 1XNQB 2XAGA 4H0LB 2QKSA 5CA0A 4MVMA 3VQWA 1V55C 1GAXA 1O9HA 2X6BA 1VMGA 1WNSA 3F7YC 5FNVA 2JRIA 1I94B 5EZYA 1AJQA 4BW5A 2EZOA 2QSAA 2OCHA 1Z5WA 3SJBC 2XAQA 3ZHVA 2YXYA 3FB8C 1YI2V 4J9YB 5B1AC 1J5EB 1VQ4V 1BCCH 1Y76A 4QE7A 1WA8A 3C3TA 4FIPC 4LF9O 4QNHB 5B66Z 3H9VA 4UB8Z 4MSWC 5B3SC 2V1DA 1F4MA 2ZD9A 2IJHA 3UT5B 5IJ0A 1GM8A 1W0JG 1AILA 2B5UA 2N05A 1G1XB 4EKWA 3TETA 1UFIA 4JTCB 1V9PA 4GLXA 5LL6Y 1WB7A 3OMNB 4R7CA 1TUBB 4LNUB 3BCCH 2JVDA 2YDEA 1Q3EA 1U96A 4D6TH 4HAMA 5JJJB 4NKGB 4LF4B 3S3WA 1QU7A 1JPXA 2CGNA 3CMEV 4JI7O 2FL4A 3ZRSA 3T1HO 3N27A 4Z1VA 4XDJA 1N0JA 4LFCB 3ZRVA 3L73H 3JAWA 3VOUA 2ZE8A 5FL7G 3TCUA 4ZI7A 2ZXWB 3ZMTA 4NYKA 1YVWA 1BGYH 5BR8B 3J7AU 2X6AA 3L9DA 1YIJV 1JQ0A 3SYOA 1GM9A 1KB9F 3MAQA 2YICA 5K1XA 2N74A 1ZAUA 1AI7A 3CC7V 3FYEB 1N33B 2JEUA 1AJPA 4K8XA 4O4IB 1NTZH 2UU9B 1ZL8A 1ZTEA 3E8HA 5KUMA 3CEIA 3SPJA 3CMAV 2XASA 1E79G 3CRAA 1SC5B 1DLBA 5KLVH 4FLUA 2LQTA 4JI3O 2QA4V 1RFYA 4IT5A 1DF4A 1S5LZ 1HR0O 4JV5O 4CC5A 4MVRA 2DYSB 3ML0A 1KMIZ 1PD3A 3UO2A 4DUYO 2ZR3A 2WLJA 3JATA 4ZHQA 1BE3H 5B5EZ 1CP9A 4FLWA 2P22C 1RSOA 4OPHA 2F66C 4H33A 3X2QC 1VF6A 4X1IA 4FK5C 5EC1C 1Y66A 1EZVH 3EFFK 4LF6B 1RM1B 3OR6C 2AZ2A 1PNMA 2VRZA 3KZIZ 3J80N 1QCEA 2N04A 4C7UA 1Q7YW 4JI6O 4TUYA 2YEVB 4LF7O 1F51A 2UUCB 1AJNA 1NZ6A 1QQCA 3FD9A 4LFAB 1EN6A 2A9HA 2X0LA 1FFTB 3TXSA 3SYQA 3CCSV 3JSLA 3W7WA 5LMNO 5IY5C 2DOSA 1WB8A 3ABKC 3OTOO 1URFA 3D3QA 1SQQH 1K33A 2Q7GA 1TUEB 4JZGA 1JX9A 3OD4A 2E75B 1OCOB 2ITDC 2R9AA 5IE9A 1R73A 2DN9A 1F4NA 2IH1C 5TISZ 4Z1MG 1L0LH 2YI8A 4J80A 3D8CA 1WPBA 3CHXA 2ODMA 1DF5A 3T1YO 3JARA 1OCCB 1BQZA 2QM8A 4IIJB 2EJ7A 5CBGA 1M5IA 2ZT9B 2PGGA 3KCXA 4DYLA 1JFFB 4PA3A 1Y67A 4UUJC 4LC1A 5KAFZ 4CS3A 2LJ2A 5H2FZ 1TVKB 4TT3G 5C8YB 1YZBA 4FFBA 2GSMB 1FXHA 3CYOA 2ZR2A 1VF5B 3WFVA 3K04A 2EIJC 4Q20A 3Q4HB 5IJ9B 1HWYA 5D5QA 5L3CA 1FD9A 1XILA 4DR3B 2GDSA 2QR4A 1NVPD 2JS3A 2DQ0A 3L72H 4UCUA 1R3KC 5BMVA 2UUBO 2YIAA 1QLEB 4BAYA 4GKJO 4QE9A 2OTJV 2CH7A 4I9WA 3RGBA 4DV7B 1VQLV 4J41A 5J2UB 1NQTA 2Q9LA 4O4HA 3G4SV 3ASNB 1VP7A 2RQ6A 4EB6B 1Q90D 1NJIW 4MTGA 3E22B
chains in the Genus database with same CATH topology
1XREA 4JZGA 1BS3A 1AP6A 3KDRA 1VEWA 1MSDA 1GN2A 1XUQA 4JYYA 2AW9A 1XDCA 3BFRA 3MDSA 2CDYA 4YIPA 3AK3A 4F6EA 1QNMA 3KKYA 2ADPA 2P4KA 4BR6A 3RN4A 4JZ2A 4GUNA 1MMMA 3QVNA 1ZTEA 3CEIA 4YIOA 1AP5A 1MA1A 1ZUQA 3EVKA 4E4EA 1IDSA 2ADQB 1N0NA 3C3TA 1Y67A 2CE4A 1EN4A 3OT7A 5AG2A 1AR4A 1IX9A 1B06A 1ZSPA 2QKAA 3DC6A 3IC9A 1KKCA 3LSUA 1I08A 1SZXA 1AVMA 1PM9A 1BSMA 2RCVA 1EM1A 1LUVA 1PL4A 1WB7A 4FFKA 1MNGA 2QKCA 1P7GA 1VARA 1XILA 1EN5A 2GDSA 4C7UA 1GN4A 1JR9A 3K9SA 3C3SA 3AK1A 3TJTA 1I0HA 1EN6A 1D5NA 1IXBA 4X9QA 1JA8A 1N0JA 1ZLZA 3AK2A 1WB8A 1GN6A 1BT8A 3DC5A 1LUWA 5A9GA 1GN3A 1AR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRE A;  4JZG A;  1BS3 A;  1AP6 A;  1VEW A;  1MSD A;  1GN2 A;  1XUQ A;  4JYY A;  2AW9 A;  1XDC A;  3BFR A;  3MDS A;  2CDY A;  4YIP A;  3AK3 A;  4F6E A;  1QNM A;  3KKY A;  2ADP A;  2P4K A;  4BR6 A;  3RN4 A;  4JZ2 A;  4GUN A;  1MMM A;  3QVN A;  1ZTE A;  3CEI A;  4YIO A;  1AP5 A;  1MA1 A;  1ZUQ A;  3EVK A;  4E4E A;  1IDS A;  2ADQ B;  1N0N A;  3C3T A;  1Y67 A;  2CE4 A;  1EN4 A;  3OT7 A;  5AG2 A;  1AR4 A;  1IX9 A;  1B06 A;  1ZSP A;  2QKA A;  3DC6 A;  3IC9 A;  1KKC A;  3LSU A;  1I08 A;  1SZX A;  1AVM A;  1PM9 A;  1BSM A;  2RCV A;  1EM1 A;  1LUV A;  1PL4 A;  1WB7 A;  4FFK A;  1MNG A;  2QKC A;  1P7G A;  1VAR A;  1XIL A;  1EN5 A;  2GDS A;  4C7U A;  1GN4 A;  1JR9 A;  3K9S A;  3C3S A;  3AK1 A;  3TJT A;  1I0H A;  1EN6 A;  1D5N A;  1IXB A;  4X9Q A;  1JA8 A;  1N0J A;  1ZLZ A;  3AK2 A;  1WB8 A;  1GN6 A;  1BT8 A;  3DC5 A;  1LUW A;  5A9G A;  1GN3 A;  1AR5 A; 
#chains in the Genus database with same CATH topology
 2EIK C;  1QVF U;  2NR5 A;  1JJ2 U;  2HLD G;  3KDR A;  1M9N A;  2Q7H A;  1GN2 A;  4UVA A;  1ROP A;  2WLN A;  1MG1 A;  2JJ1 G;  4K0K B;  4PI2 A;  4WF9 V;  4FMT A;  2KQX A;  4H37 A;  4F6E A;  4B3T B;  3D36 A;  4DW0 A;  4RAI A;  2EX3 A;  2ZDI C;  3CRM A;  4JI4 B;  2H3O A;  1P84 F;  2ZM6 B;  1H2K A;  3HR0 A;  4CZZ A;  1K7D A;  4B3M O;  4YJ3 B;  3CCE V;  4RUF A;  3CCR V;  1K9M W;  3QTC A;  1NR7 A;  2IJK A;  5KHJ A;  2ZNI A;  3R65 A;  3LNM B;  4OX9 O;  3MHH C;  3SJA C;  4JTD B;  2YC0 A;  2ADQ B;  4FLX A;  2FYU H;  2CUG A;  2WLK A;  1M1K W;  3RYF A;  2EIM B;  2GV9 A;  2JGD B;  2A0L A;  1XNQ O;  3IC9 A;  4D7T A;  3W7X A;  1M57 B;  1YHQ V;  1SZX A;  4DR4 B;  3RT3 C;  2VQE B;  4DUZ B;  4DV3 B;  3EXA A;  3BHP A;  1K92 A;  1KEC A;  1MZF A;  2ZCE A;  3H1I H;  1XHZ A;  1N32 B;  4LP8 A;  3TK1 A;  2ZQM A;  2CTW A;  5J9P C;  1J5E O;  3RYH A;  1NI8 A;  1J95 A;  3C3S A;  4B3R B;  2BOC C;  5CMU A;  3TJT A;  2BSK A;  4O4L A;  4DV5 B;  1AI4 A;  5C93 A;  2CGO A;  2PY5 A;  1ENV A;  1IJG A;  1KU9 A;  1SQG A;  2F93 B;  3QNE A;  5L3G A;  1P7B A;  4DR6 B;  1VQ8 V;  3ABU A;  3G80 A;  5E79 Z;  4B7K A;  2UUA B;  2RJZ A;  3OGC C;  3JAK A;  2ATK C;  3PN1 A;  4PI0 A;  4LF8 O;  5KUK A;  1YJN V;  2CTR A;  5CBH A;  1K4D C;  1Q5O A;  1S3J A;  3SPI A;  1N8R W;  1H8H G;  4YHH B;  4ABM A;  4PDR A;  5KA6 A;  2CTP A;  1WLE A;  4FJC C;  3EHB B;  3WB0 A;  5BR8 O;  4UXN A;  2UXD B;  4JYA B;  1P4R A;  1RPO A;  3ETD A;  1N34 O;  1W59 A;  3CJH A;  4PA9 A;  3CPW U;  2CE4 A;  2Q4P A;  2IJJ A;  4MVQ A;  3C90 A;  4DV6 B;  3M99 B;  2ZKO A;  4X64 B;  1HNW B;  2DYS C;  2ZE6 A;  1SS3 A;  1ZSP A;  3TGU H;  3N2K B;  2H8P C;  2QKA A;  3DC6 A;  1NH2 D;  2P06 A;  4JI0 B;  4JI8 B;  3E8F A;  2UU9 O;  2VWK A;  4GYC B;  4DV2 B;  4AQY B;  2VQF O;  2FB5 A;  4MVS A;  5IYD O;  2WSS G;  1EN5 A;  2OIE A;  3TXQ A;  5BY1 A;  3ASO C;  1XL4 A;  1BHB A;  1IBK O;  3K5N A;  3ZMU A;  1SA0 B;  5LXT B;  1VQP V;  2EIN B;  4Q6G A;  1NKD A;  1D5N A;  4CS2 A;  3BY6 A;  1SQF A;  2GUZ A;  1FJG O;  3MHS C;  3HKD A;  2Q0A A;  4W4K A;  1JMK C;  4NTW A;  4F4L A;  1XEQ A;  4LWS A;  1LUW A;  4EFE A;  3JAL A;  1GN3 A;  3OUS A;  4UVC A;  2HFE C;  2B9Z A;  4X1Y B;  3E35 A;  1QBZ A;  3E86 A;  4GX2 A;  2D3O W;  1SET A;  4BIU A;  4YJ2 A;  5JQG A;  2UUC O;  1S72 V;  1Y74 B;  4ZOL B;  2BTQ A;  5EZY B;  1HNX B;  1S77 D;  3HKC B;  1CXZ B;  2YID A;  3JD4 A;  2A79 B;  4DR1 B;  3AK3 A;  3IAY A;  3APQ A;  2DE0 X;  4MTO A;  2Q68 A;  3AG2 B;  4HZ3 A;  2DYR C;  2F1M A;  5JH7 B;  4DV4 B;  2WA4 A;  4DRX A;  1S0V A;  3ZJZ A;  4LF5 O;  1FFX A;  2OYQ A;  3JAS A;  1H5W A;  2Y4T A;  5LOV A;  3OGI B;  4DO2 A;  1OCC C;  4JI5 B;  1R6T A;  2KB1 A;  4OPA A;  1D5A A;  1SF9 A;  3SJC C;  3RYI A;  4DR5 O;  4PA7 A;  4J7Z A;  4HBN A;  1EFR G;  1GMG A;  3JD2 A;  3CCU V;  5LMU O;  1FAF A;  4FPP A;  2IM9 A;  4UCO A;  4X66 O;  2R9R B;  1EM1 A;  2L6L A;  3BAA A;  3CXH F;  3D36 C;  2MK3 A;  1KQS U;  4U3J B;  3K9S A;  3JAW B;  2KSD A;  1MAB G;  4MVU A;  3RBZ A;  3CCJ V;  4ZKI A;  3FFQ A;  4DR7 O;  5JVD A;  4X65 O;  3VQV A;  2NLJ C;  4R8C A;  4TV8 A;  3DGE A;  3FYI B;  2ZIO A;  4I55 B;  2UXB B;  4B08 A;  3CRC A;  3AG1 C;  2VS0 A;  2QWO B;  2QM4 A;  2RN9 A;  1MZE A;  1AR5 A;  2Q5Z A;  3ASN C;  4I5S A;  4DR3 O;  4PV1 B;  2LGW A;  4LCU C;  1E1R G;  2ZDI A;  5J2T B;  2AW9 A;  3CX5 F;  2W0X A;  4KXR A;  4PD4 F;  3ZHR A;  1QR8 A;  3LSS A;  1AI6 A;  2YI9 A;  5B1N A;  4PHZ A;  4IGG A;  1V54 B;  3ETG A;  3OAA G;  1KUQ A;  2EBO A;  4X8A A;  1NTK H;  5LHH A;  3JAT B;  3ETE A;  4FLY A;  3E8B A;  3CCM V;  1D2D A;  2F4V B;  4MVZ A;  5CA1 B;  4DV0 O;  3H1H H;  2WLI B;  3ZRW B;  1XHX A;  1N0N A;  3UT5 A;  1KP2 A;  2Q6A A;  4X1K B;  1AR4 A;  2DMX A;  3NXS A;  2V7Q G;  4TSF G;  3B8M A;  3D3I A;  1N36 B;  2JEX A;  2XAJ A;  4YY3 O;  4JI2 B;  2HEP A;  3L75 H;  1KKC A;  1ZX3 A;  4TUY B;  3QO7 A;  4LNU A;  1VQN V;  1XL6 A;  1FPO A;  4JI4 O;  2XND G;  3F5W C;  1YDX A;  5LP6 B;  3U11 A;  1VQ5 V;  4WCE V;  2R72 A;  3JYC A;  1JR9 A;  4DV1 B;  3IJ4 A;  3RVZ A;  3HKB A;  3WB1 A;  4QGP A;  3P32 A;  4WBN B;  4UB6 Z;  5DED A;  5LBQ A;  3OEH G;  3ZRX A;  5FPR A;  4JYC A;  1GTO A;  4R50 A;  2R70 A;  2VQE O;  4DV3 O;  5CN0 A;  2P90 A;  2P67 A;  4B3S B;  1BS3 A;  3JD0 A;  4PDV A;  1VQ6 V;  4KHP O;  1VEW A;  4ZIB A;  1MOF A;  2EIL C;  1H2G A;  3BFR A;  3JAR B;  1HNZ B;  4DV5 O;  5KAI Z;  3A2F A;  1QNM A;  3I55 V;  2YIB A;  1NBM G;  4BR6 A;  4K3A A;  1MSW D;  3M7M X;  2EUL A;  4DR2 O;  1JNB A;  4MVO A;  1W0K G;  5B1O A;  2IU3 A;  3P3N A;  3OFN G;  1GRJ A;  5EC2 C;  4NXN O;  1YF2 A;  1L1F A;  4JTA B;  1K5Q A;  2QTO A;  3AG7 A;  5CB4 A;  1YSC A;  2F43 G;  4MTX A;  4MS2 A;  1F23 A;  3R66 A;  4IYH A;  2UXX A;  3CCV V;  1H2L A;  2YIB D;  3K03 A;  5DM6 V;  1SQB H;  1PL0 A;  2E5L B;  3LSU A;  1I08 A;  1YEW A;  2RCV A;  2YEV A;  3JD3 A;  3AG3 B;  4FFK A;  4JGS A;  2ETN A;  2K9P A;  2QWQ B;  4RWU A;  5L3B A;  1JVM A;  1RP3 B;  4X62 O;  2CH7 B;  2M7W A;  3ABL C;  5KMG B;  3F7V C;  1GKF A;  2ILM A;  4UCS A;  5DN6 G;  4KFM A;  5JCO A;  1K8A W;  4PA6 A;  3CRQ A;  2Q69 A;  3OMI B;  4X64 O;  5IDJ A;  1HNW O;  1RPR A;  4LFB O;  4LF9 B;  3THO A;  1BL8 A;  1ZLZ A;  4JI0 O;  2WPD G;  3DC5 A;  4TWK A;  3T2M A;  1M56 B;  4RQE A;  2YS8 A;  1OCR B;  1IBL O;  3A0R A;  1AP6 A;  1XMQ B;  1IBM B;  2XOK G;  4J10 A;  3MDS A;  5EBM C;  4X89 A;  1THZ A;  5B3S B;  1QVG U;  1FXK B;  2ARH A;  5GW7 A;  3WU2 Z;  3RYC B;  4JI7 B;  5KHI A;  5LGT A;  2FKX A;  4IIJ A;  2B1I A;  3A0B Z;  5KHK A;  1Q81 W;  3K08 A;  2LGQ A;  4XDL A;  1JFF A;  4TV9 A;  4MTF A;  5L3F A;  5BXZ A;  2P4V A;  1MA1 A;  2WA3 A;  1PNK A;  2A7W A;  5C8Y A;  5KHG A;  5EYP B;  1O9G A;  3E83 A;  4NXM O;  1GM7 A;  2ZE5 A;  3K0G A;  1OCZ B;  3ABT A;  4I0X B;  5IT9 N;  1XQ8 A;  3Q4H A;  5IJ9 A;  3GVM A;  4WFH A;  3SGI A;  3RYH B;  2Q67 A;  5D5P A;  3AG4 B;  4GKK O;  4AHC A;  4HYO A;  2UXC O;  3RW0 A;  2A06 H;  5BZB A;  4JF3 A;  4GZR B;  3QO5 A;  3SPC A;  3CC4 V;  2HVK C;  1TGO A;  1IZ3 A;  4JI3 B;  4JI5 O;  5JWP A;  5J2U A;  1F7Y A;  1HR0 B;  4JV5 B;  5GTI Z;  1AR1 B;  3IFX A;  4X20 A;  1JA8 A;  3LDE A;  3K59 A;  3BAB A;  5LA6 B;  4CBC A;  4EB6 A;  3P3P A;  4PA4 A;  1Q6H A;  1I94 O;  3E22 A;  2F95 B;  3KCY A;  2WWW A;  3CXC U;  4UV8 A;  2EJR A;  1VF7 A;  3K57 A;  1K4C C;  2CK3 G;  3ETQ A;  4WFA V;  2HJF C;  1JJO A;  4LH6 A;  3K0D A;  5GTH Z;  5IYZ A;  4JI6 B;  1LNQ A;  3SDL A;  3K5L A;  2ZIN A;  2ZIM A;  4LF7 B;  3W7T A;  3SYA A;  2L35 A;  3N2G B;  3CC2 V;  3CP1 A;  3HKE B;  1FOU A;  2Y0P A;  4YJ3 A;  1K3E A;  3X2Q B;  1I5X A;  3RN4 A;  4JZ2 A;  2CTQ A;  4F6R B;  5JJN B;  2UXB O;  2IBZ H;  4A5U B;  4HNA B;  2ZXW C;  1V54 C;  2KKW A;  4WFB V;  4UFZ A;  4R6Z A;  4EFB A;  3H1J H;  4LF4 O;  3OTO B;  2ZNJ A;  3APO A;  5KA5 A;  2WLL B;  2JGD A;  3SR2 C;  4O4J B;  4ASU G;  1EN4 A;  5A2Q N;  5AG2 A;  4TOI A;  4UCR A;  3B77 A;  4LFC O;  3SPG A;  4FLT A;  4I4T A;  4I50 B;  1XI1 A;  2PZS A;  2BCC H;  4P9P A;  2Y4U A;  5IY5 B;  1WAZ A;  4P30 A;  3UM7 A;  3GB7 C;  1G8M A;  4O2B B;  3G71 V;  3DXR A;  1YJ9 V;  3ABK B;  1B04 A;  4G2K A;  3T1Y B;  5EIB C;  3WB2 A;  1OV9 A;  2GUZ B;  5LP6 C;  4IHJ B;  3B09 A;  3FAV B;  2KG7 A;  5GON B;  4DXW A;  1N33 O;  1CPY A;  1SRY A;  3LNN A;  5ITZ B;  4O2A A;  3CSX A;  4EEQ A;  3OEE G;  1N36 O;  3IC7 A;  1BMF G;  2RMK B;  1YTF D;  5DEC A;  2PYL A;  4K35 A;  1RM1 C;  1XNR B;  1L8D A;  4BWA A;  2JIZ G;  1WJZ A;  2XAH A;  1X59 A;  3OTF A;  2WLM A;  3FKS G;  1VQO V;  3STL C;  1SER A;  2PTM A;  2UUB B;  1WPX A;  2CDY A;  2HJD A;  2E3C A;  1GO3 F;  3HPL C;  4BW9 A;  4GKJ B;  4CH6 A;  5JCO C;  4G27 B;  1I7F A;  3W7U A;  4LF6 O;  3K9A A;  3E8G A;  2QWR B;  2EIJ B;  2QTS A;  2FTK A;  5CA0 B;  3RYI B;  2YUA A;  5FNV B;  1FKA O;  4B3S O;  1EBO A;  5KHH A;  4P2Z A;  1Y6X A;  3ABM B;  4LFA O;  4LR3 A;  1OCO C;  3EVK A;  1K97 A;  3KG2 A;  1WN7 A;  3N2K A;  4D7S A;  2CAZ C;  2LW7 A;  4ZBM A;  1UPG A;  3ZX6 A;  3UQ8 A;  1Y76 B;  2OCC B;  3QO8 A;  1WA8 B;  2FML A;  4I7Z B;  1FXV A;  5LYJ A;  1M4U A;  1S5H C;  1PM9 A;  3BVO A;  4U3F H;  1VQ7 V;  5H5N A;  1XMO B;  2HG5 C;  2M6Y A;  5IJ0 B;  1SA0 A;  1K34 A;  1P7G A;  3B2E E;  3JCZ A;  4B3M B;  4TV8 B;  3CD6 V;  5B1B B;  5HFL A;  3ZN0 A;  2BOB C;  2JGU A;  2HR3 A;  1PPJ H;  4N23 A;  4X9Q A;  4BIO A;  4PDM A;  2QJ1 A;  2W6I G;  2P6J A;  2JJ2 G;  3OM3 B;  2Y69 B;  2E5L O;  4X1Y A;  4PEL A;  4LH7 A;  4WFE A;  2PI5 A;  5HFM A;  2WAM A;  2Q8V A;  1Y74 A;  1SKV A;  4B7E A;  3CE2 A;  1VQM V;  4ZOL A;  4DW1 A;  4ZI7 B;  3HKC A;  5H6Q A;  4RO2 A;  3CB2 A;  1M56 C;  4MW8 A;  1Q6U A;  1G4Y B;  1OCR C;  1XUQ A;  5KX5 A;  5LHG A;  1QLE C;  5JH7 A;  4KUM A;  3LSQ A;  3B8N A;  2UXN A;  4X88 A;  3WG7 B;  2ADP A;  2Z3Y A;  1FXK C;  3JCU Z;  3SYP A;  3QVN A;  5L3E A;  3VBB A;  4TQD A;  4YIO A;  2RDC A;  1ZL8 B;  1KD1 W;  2XT9 A;  1QLN A;  1XMQ O;  5IYB O;  4E4E A;  3I5D A;  2E76 B;  3K79 A;  2H94 A;  4WFF A;  3VQX A;  1IBM O;  2QM7 A;  4LF8 B;  1VQ9 V;  1IXM A;  1IUR A;  4DV7 O;  1YXB A;  4JI1 B;  2LP7 A;  3NR7 A;  1TA8 A;  2BTO A;  3FX7 A;  3QF7 A;  4NR1 A;  3LUT B;  3ZMZ A;  3ZHT A;  2G38 A;  2Q7E A;  4FM1 A;  2HHH B;  4ZHQ B;  1OCZ C;  4U3J A;  4IYI A;  3QG5 A;  1BSM A;  3ZMV A;  4FVM A;  3HKB B;  1RSO B;  4DK0 A;  1Q82 W;  2QEX V;  4X1I B;  4QPJ A;  2GHY A;  3AG4 C;  2LO1 A;  5F2V O;  1VQK V;  4K0K O;  3UKM A;  4MT8 A;  3MD0 A;  4J7J A;  1N34 B;  1GH6 A;  1NR1 A;  1SQP H;  2YXH A;  1DTO A;  4B3T O;  2DWE C;  4I55 A;  1YJW V;  3UCS C;  2QWP B;  4H44 B;  1TUB A;  4RUE A;  2EIM C;  3ZHQ A;  1LR1 A;  2WLH A;  3VQY A;  1A32 A;  2IH3 C;  1R6N A;  2ZM6 O;  5IWA B;  4CC6 A;  1M57 C;  2C2A A;  2GTS A;  2Y0I A;  2JDI G;  2YXL A;  3DSQ A;  5A9G A;  2PF4 E;  5J2T A;  1JOY A;  1R6K A;  2VQF B;  3FB7 C;  4QIW F;  4N21 A;  3ICX A;  2OWO A;  1IVS A;  3OW2 U;  1IBK B;  3OR7 C;  3PJS K;  3SYC A;  2JS5 A;  4YXW G;  1VIB A;  2W6J G;  1ZWI C;  2GBO A;  4DR4 O;  3ZMS A;  4DUZ O;  3CCQ V;  2O57 A;  1FJG B;  2XHB A;  5CB4 B;  1N32 O;  4FZ0 A;  5CA1 A;  1N4C A;  3ZIA G;  2XAF A;  3A8T A;  5H9C A;  1OJH A;  2WLI A;  4BIZ A;  3ZRW A;  5FLX N;  1B3Q A;  3ASO B;  4B3R O;  4O4I A;  1OHH G;  2F23 A;  4X1K A;  2NN4 A;  2Z0A A;  4KP4 A;  4L87 A;  1IX9 A;  4DR6 O;  4JAV A;  1NVP B;  2MW2 B;  5LP6 A;  3CS5 A;  2HP8 A;  1AVM A;  1K5S A;  4JAU A;  5IYC O;  2UUA O;  3ZN1 A;  4QJF B;  1PL4 A;  4FFB B;  2QKC A;  4LF5 B;  2X7R B;  1PNL A;  2P7T C;  4JPR A;  4WBN A;  3E2E A;  4XBF A;  2PUS A;  3T1C A;  5EIB D;  3K5M A;  2NNU A;  1GK9 A;  3G67 A;  4YHH O;  4J42 A;  1IXB A;  4OXS A;  4FLZ A;  5BMV B;  2Q0O C;  1TAE A;  2R9I A;  4DR5 B;  2DJV A;  1FYJ A;  3AK2 A;  2DYR B;  3H01 A;  3G6B A;  1YCI A;  2UXD O;  4JYA O;  5LMU B;  3HB3 B;  5E1A C;  4X66 B;  5L3D A;  1W2B U;  4NTY A;  4O4H B;  4GX5 A;  3BPZ A;  2Q73 A;  4GX0 A;  1PP9 H;  4U7N A;  2QE7 G;  4DV6 O;  5CBF A;  5CA3 A;  3BA9 A;  2DWD C;  2AXT Z;  2EIN C;  2W0F C;  1V55 B;  5EBW C;  4TV9 B;  4JI8 O;  4UCV A;  2RNB A;  4WFG A;  4OGQ B;  1SES A;  3KKY A;  4DV2 O;  2P4K A;  4AQY O;  4DR7 B;  2OTL V;  2XTA A;  4X65 B;  1M93 A;  1G6U A;  1MMM A;  3U10 A;  5B1A B;  3SJQ C;  1XNR O;  1AP5 A;  2IW5 A;  4FM0 A;  1ZUQ A;  4H13 B;  4E2L A;  3G6E V;  4NTX A;  3AEI A;  2LFS A;  1Z2G A;  1NU1 H;  3BEH A;  3FB5 C;  3ABM C;  1XBL A;  3T1H B;  1US6 A;  3M8A A;  3GWK C;  1JCH A;  3AG2 C;  5EBL C;  3ZBH A;  1NS1 A;  2QWN B;  3ZHS A;  3AG1 B;  3RYF B;  5KMG A;  2OCC C;  1OZ0 A;  1LUV A;  2OIG A;  4W4L A;  1TVK A;  4X20 B;  4KL1 A;  2Z5U A;  1VAR A;  4Z2W A;  2V4D A;  4L8J A;  3K58 A;  1HNX O;  3O9O A;  4DR1 O;  2AZ0 A;  5B1B C;  4DV0 B;  1AB3 A;  2A3Q A;  2B1G A;  1BZK A;  2ZE7 A;  1BQ0 A;  3RVY A;  4DV4 O;  2BSK B;  4O4L B;  3O65 A;  4CH3 A;  2P5O A;  4LBE C;  4YY3 B;  5IYZ B;  1GN6 A;  1BT8 A;  2BE3 A;  4K8Z A;  2DQ3 A;  2Y69 C;  1XMO O;  3UO3 A;  4DK1 A;  3ZED A;  4FLV A;  3I56 V;  4G28 B;  4TQF A;  1Q8I A;  2PYJ A;  5FPO A;  1FXK A;  1R3J C;  1MSD A;  1H2N A;  3K3W A;  4IL6 Z;  4FM2 A;  4DUY B;  3RYC A;  1S76 D;  3JAK B;  4GCZ A;  1SQX H;  1ARO P;  4MW3 A;  3J81 N;  5K1P A;  1P49 A;  4J11 A;  3T4D A;  2QDO A;  3H1L H;  4JAA A;  3L74 H;  3P30 A;  2AHY A;  4GUN A;  1U97 A;  2XUM A;  3WG7 C;  1DGS A;  5LGU A;  5EYP A;  4I4T B;  3CWB H;  1NH2 B;  1X4T A;  1NTM H;  1HW7 A;  4I0X A;  1H8E G;  4KHP B;  2GTA A;  3DXR B;  2OT5 A;  2DW4 A;  3OT7 A;  1YTF B;  3SPH A;  1Y4M A;  1E1Q G;  3CJH B;  4UVB A;  3L71 H;  1H2S B;  4U7O A;  3W7S A;  5LMN B;  2EZP A;  4NVP A;  1WP7 A;  1H2M A;  4J9Z B;  3F5T A;  4PJ0 Z;  2KG7 B;  3U0Z A;  4DR2 B;  4JAS A;  4ICG A;  4O2A B;  2HKO A;  1KYO F;  5LA6 A;  1QR9 A;  4NXN B;  1SQV H;  1VF6 C;  2EIL B;  3B4S A;  2D2C B;  1COW G;  1I0H A;  4CH5 A;  4JI1 O;  2PI4 A;  2Y48 A;  4CH4 A;  1WP8 A;  3OE7 G;  4JYB A;  2K1E A;  3GWO A;  3K06 A;  4QPK A;  2HHH O;  3H1K H;  2AGA A;  5LGN A;  3HKD B;  2F4V O;  3LDD A;  4XDK A;  1XRE A;  2X6C A;  1R3L C;  2LFR A;  3FB6 C;  3JAM N;  3N2G A;  3HKE A;  1XOU A;  4X62 B;  4LWS B;  3JAL B;  4JYY A;  1Q86 W;  1PV0 A;  1BHA A;  4F6R A;  1AI5 A;  3OMA B;  4JI2 O;  1KP3 A;  4YIP A;  1R1B A;  1M90 W;  2IU0 A;  1Q43 A;  4HNA A;  4YJ2 B;  5JQG B;  3CCL V;  2BTQ B;  4LFB B;  5IWA O;  1NT2 B;  2HVJ C;  2WLL A;  1K73 W;  2E74 B;  4DV1 O;  2AHZ A;  3RFR A;  4O4J A;  1QHT A;  3A0H Z;  3ABL B;  2QGN A;  4DRX B;  1IBL B;  1FFX B;  4I50 A;  5LYJ B;  3LDC A;  5JJE B;  1IDS A;  2LW1 A;  4UV9 A;  4CS4 A;  3JAS B;  1UJW B;  5LOV B;  4UCT A;  4O2B A;  3S3X A;  1PKX A;  3ZCC A;  1B06 A;  3OUF A;  2JK5 C;  4NB5 A;  4J7K A;  3L70 H;  1HP8 A;  4PDL A;  1L0N H;  4IHJ A;  3FAV A;  5GON A;  1MNG A;  5LHI A;  2YSU B;  1S5J A;  1GN4 A;  1T5E A;  1KBH A;  5ITZ A;  1HNZ O;  1Z5V A;  5H6R A;  3K5O A;  3E89 A;  2ITC C;  3AK1 A;  1Q6I A;  1B6Q A;  1KC8 W;  1EZJ A;  3ZS8 C;  1KKD A;  3IGA C;  4GX1 A;  4NXM B;  1HDJ A;  5EK0 A;  3T4Z A;  4GT1 A;  1R3I C;  2EIK B;  5KX5 B;  5LXT A;  1SZT A;  5JVD B;  4AIL C;  3BRC A;  3ZHU A;  3JSN A;  3DTU B;  4P9O A;  3AG3 C;  1H38 A;  3BA8 A;  4AI8 A;  1CEZ A;  4GKK B;  4OX9 B;  2UXC B;  4RQF A;  4I9Q A;  1I5Y A;  1XDC A;  3JD1 A;  2VWJ A;  3B40 A;  1YIT V;  1FS0 G;  1ORQ C;  2IJI A;  4FZ1 A;  3CRR A;  3RWR D;  3STZ C;  1DK1 A;  1XNQ B;  2XAG A;  4H0L B;  2QKS A;  5CA0 A;  4MVM A;  3VQW A;  1V55 C;  1GAX A;  1O9H A;  2X6B A;  1VMG A;  1WNS A;  3F7Y C;  5FNV A;  2JRI A;  1I94 B;  5EZY A;  1AJQ A;  4BW5 A;  2EZO A;  2QSA A;  2OCH A;  1Z5W A;  3SJB C;  2XAQ A;  3ZHV A;  2YXY A;  3FB8 C;  1YI2 V;  4J9Y B;  5B1A C;  1J5E B;  1VQ4 V;  1BCC H;  1Y76 A;  4QE7 A;  1WA8 A;  3C3T A;  4FIP C;  4LF9 O;  4QNH B;  5B66 Z;  3H9V A;  4UB8 Z;  4MSW C;  5B3S C;  2V1D A;  1F4M A;  2ZD9 A;  2IJH A;  3UT5 B;  5IJ0 A;  1GM8 A;  1W0J G;  1AIL A;  2B5U A;  2N05 A;  1G1X B;  4EKW A;  3TET A;  1UFI A;  4JTC B;  1V9P A;  4GLX A;  5LL6 Y;  1WB7 A;  3OMN B;  4R7C A;  1TUB B;  4LNU B;  3BCC H;  2JVD A;  2YDE A;  1Q3E A;  1U96 A;  4D6T H;  4HAM A;  5JJJ B;  4NKG B;  4LF4 B;  3S3W A;  1QU7 A;  1JPX A;  2CGN A;  3CME V;  4JI7 O;  2FL4 A;  3ZRS A;  3T1H O;  3N27 A;  4Z1V A;  4XDJ A;  1N0J A;  4LFC B;  3ZRV A;  3L73 H;  3JAW A;  3VOU A;  2ZE8 A;  5FL7 G;  3TCU A;  4ZI7 A;  2ZXW B;  3ZMT A;  4NYK A;  1YVW A;  1BGY H;  5BR8 B;  3J7A U;  2X6A A;  3L9D A;  1YIJ V;  1JQ0 A;  3SYO A;  1GM9 A;  1KB9 F;  3MAQ A;  2YIC A;  5K1X A;  2N74 A;  1ZAU A;  1AI7 A;  3CC7 V;  3FYE B;  1N33 B;  2JEU A;  1AJP A;  4K8X A;  4O4I B;  1NTZ H;  2UU9 B;  1ZL8 A;  1ZTE A;  3E8H A;  5KUM A;  3CEI A;  3SPJ A;  3CMA V;  2XAS A;  1E79 G;  3CRA A;  1SC5 B;  1DLB A;  5KLV H;  4FLU A;  2LQT A;  4JI3 O;  2QA4 V;  1RFY A;  4IT5 A;  1DF4 A;  1S5L Z;  1HR0 O;  4JV5 O;  4CC5 A;  4MVR A;  2DYS B;  3ML0 A;  1KMI Z;  1PD3 A;  3UO2 A;  4DUY O;  2ZR3 A;  2WLJ A;  3JAT A;  4ZHQ A;  1BE3 H;  5B5E Z;  1CP9 A;  4FLW A;  2P22 C;  1RSO A;  4OPH A;  2F66 C;  4H33 A;  3X2Q C;  1VF6 A;  4X1I A;  4FK5 C;  5EC1 C;  1Y66 A;  1EZV H;  3EFF K;  4LF6 B;  1RM1 B;  3OR6 C;  2AZ2 A;  1PNM A;  2VRZ A;  3KZI Z;  3J80 N;  1QCE A;  2N04 A;  4C7U A;  1Q7Y W;  4JI6 O;  4TUY A;  2YEV B;  4LF7 O;  1F51 A;  2UUC B;  1AJN A;  1NZ6 A;  1QQC A;  3FD9 A;  4LFA B;  1EN6 A;  2A9H A;  2X0L A;  1FFT B;  3TXS A;  3SYQ A;  3CCS V;  3JSL A;  3W7W A;  5LMN O;  5IY5 C;  2DOS A;  1WB8 A;  3ABK C;  3OTO O;  1URF A;  3D3Q A;  1SQQ H;  1K33 A;  2Q7G A;  1TUE B;  4JZG A;  1JX9 A;  3OD4 A;  2E75 B;  1OCO B;  2ITD C;  2R9A A;  5IE9 A;  1R73 A;  2DN9 A;  1F4N A;  2IH1 C;  5TIS Z;  4Z1M G;  1L0L H;  2YI8 A;  4J80 A;  3D8C A;  1WPB A;  3CHX A;  2ODM A;  1DF5 A;  3T1Y O;  3JAR A;  1OCC B;  1BQZ A;  2QM8 A;  4IIJ B;  2EJ7 A;  5CBG A;  1M5I A;  2ZT9 B;  2PGG A;  3KCX A;  4DYL A;  1JFF B;  4PA3 A;  1Y67 A;  4UUJ C;  4LC1 A;  5KAF Z;  4CS3 A;  2LJ2 A;  5H2F Z;  1TVK B;  4TT3 G;  5C8Y B;  1YZB A;  4FFB A;  2GSM B;  1FXH A;  3CYO A;  2ZR2 A;  1VF5 B;  3WFV A;  3K04 A;  2EIJ C;  4Q20 A;  3Q4H B;  5IJ9 B;  1HWY A;  5D5Q A;  5L3C A;  1FD9 A;  1XIL A;  4DR3 B;  2GDS A;  2QR4 A;  1NVP D;  2JS3 A;  2DQ0 A;  3L72 H;  4UCU A;  1R3K C;  5BMV A;  2UUB O;  2YIA A;  1QLE B;  4BAY A;  4GKJ O;  4QE9 A;  2OTJ V;  2CH7 A;  4I9W A;  3RGB A;  4DV7 B;  1VQL V;  4J41 A;  5J2U B;  1NQT A;  2Q9L A;  4O4H A;  3G4S V;  3ASN B;  1VP7 A;  2RQ6 A;  4EB6 B;  1Q90 D;  1NJI W;  4MTG A;  3E22 B; 
#chains in the Genus database with same CATH homology
 1XRE A;  4JZG A;  1BS3 A;  1AP6 A;  3KDR A;  1VEW A;  1MSD A;  1GN2 A;  1XUQ A;  4JYY A;  2AW9 A;  1XDC A;  3BFR A;  3MDS A;  2CDY A;  4YIP A;  3AK3 A;  4F6E A;  1QNM A;  3KKY A;  2ADP A;  2P4K A;  4BR6 A;  3RN4 A;  4JZ2 A;  4GUN A;  1MMM A;  3QVN A;  1ZTE A;  3CEI A;  4YIO A;  1AP5 A;  1MA1 A;  1ZUQ A;  3EVK A;  4E4E A;  1IDS A;  2ADQ B;  1N0N A;  3C3T A;  1Y67 A;  2CE4 A;  1EN4 A;  3OT7 A;  5AG2 A;  1AR4 A;  1IX9 A;  1B06 A;  1ZSP A;  2QKA A;  3DC6 A;  3IC9 A;  1KKC A;  3LSU A;  1I08 A;  1SZX A;  1AVM A;  1PM9 A;  1BSM A;  2RCV A;  1EM1 A;  1LUV A;  1PL4 A;  1WB7 A;  4FFK A;  1MNG A;  2QKC A;  1P7G A;  1VAR A;  1XIL A;  1EN5 A;  2GDS A;  4C7U A;  1GN4 A;  1JR9 A;  3K9S A;  3C3S A;  3AK1 A;  3TJT A;  1I0H A;  1EN6 A;  1D5N A;  1IXB A;  4X9Q A;  1JA8 A;  1N0J A;  1ZLZ A;  3AK2 A;  1WB8 A;  1GN6 A;  1BT8 A;  3DC5 A;  1LUW A;  5A9G A;  1GN3 A;  1AR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...